Anda di halaman 1dari 113

1

NAFS(JIWA)MENURUTKONSEPALQURAN BABI OLEHJAMRIDAFRIZAL,S.Ag.,M.HUM A.AlQuraandanMetodeTafsir Mawdlui Dalam bahasa Arab, nafs mempunyai banyak arti, dan salah satunya 1 adalahjiwa. Olehkarenaitu,ilmujiwadalambahasaArabdisebutdengannama .2 Nafsdalamartijiwatelahdibicarakanparaahlisejakkurunwaktuyang sangatlama.Danpersoalannafstelahdibahasdalamkajianfilsafat,psikologidan jugailmutasawuf. Dalam filsafat, pengertian jiwa diklasifikasi dengan bermacammacam teori,antaralain: 1. Teori yang memandang bahwa jiwa itu merupakan substansi yang berjenis khusus, yang dilawankan dengan substansi materi, sehingga manusia dipandangmemilikijiwadanraga. 2. Teori yang memandang bahwa jiwa itu merupakan suatu jenis kemampuan, yaknisemacampelakuataupengaruhdalamkegiatankegiatan. 3. Teoriyangmemandangjiwasematamatasebagaisejenisprosesyangtampak padaorganismeorganismehidup. 3 4. Teoriyangmenyamakanpengertianjiwadenganpengertiantingkahlaku.

Dalam psikologi, jiwa lebih dihubungkan dengan tingkah laku sehingga yang diselidiki oleh psikologipsikologi adalah perbuatanperbuatan yang dipandangsebagaigejalagejaladarijiwa.Teoriteoripsikologi,baikpsikoanalisa, BehaviorismemaupunHumanismememandangjiwasebagaisuatuyangberadadi 4 belakangtingkahlaku. Sedangkan di kalangan ahli tasawuf, nafs diartikan sesuatu yang melahirkansifattercela.AlGhazali(w.1111M.)misalnyamenyebutnafs sebagai

Bahasa Arab menggunakan term nafs untuk menyebut banyak hal, seperti: roh, diri manusia, hakikat sesuatu, darah, saudara, kepunyaan, kegaiban, ukuran samakan kulit, jasad, kedekatan, zat, mata, kebesaran dan perhatian (lihat Ibn Manzhur, lisan alArab, Dar al Maarif Jilid Vi, tt h. 4500-4501) 2 Misalnya judul buku Ilm al-Nafs al-Islamii karangan Dr. Ramadlan Muhammad alQazzafi, (Tripoli: Mansyuran Shahifah al-Dawah al-Islamiyah, 1990) 3 Louis O. Kattsoff, Elements of Philosophy, alih bahasa Soeyono Soemargono dengan judul Pengantar Filsafat (Yogyakarta: Tiara Wacana, 1986), cet ke-1, h. 301 4 Teori psikoanalisa menempatkan keinginan bahwa sadar sebagai penggerak tingkah laku. Behaviorisme menempatkan manusia sebagai makhluk yang tidak berdaya menghadapi lingkungan sebagai stimulus, sedangkan teori Psikologi Humanisme sudah memandang manusia sebagai makhluk yang memiliki kemauan baik dalam merespon lingkungan. Lihat Hassan Langgulung. Teori-teori kesehatan mental, perbandingan Psikologi modern dan pendekatan pakar-pakar pendidikan Islam (Kuala Lumpur: Pustaka Huda, 1983), cett. Ke-1, h. 9-26
1

5 pusat potensi marah dan syahwat pada manusia dan 6 sebagaipangkaldarisegalasifattercela pengertianini 7 antara lain dipahami dari hadits yang berbunyi yang artinyamusuhmuyangpalingberatadalah nafsumuyangadadiduasisimu. DalamKamusBesarBahasaIndonesia,nafs(nafsu)jugadipahamisebagai 8 dorongan hati yang kuta untuk berbuat kurang baik, padahal dalam alQuran nafs tidakselaluberkonotasinegatif. Kajiantentangnafsmerupakan bagiandarikajiantentanhakikat manusia itu sendiri. Manusia adalah makhluk yang bisa menempatkan dirinya menjadi subyek dan obyek sekaligus. Kajian tentang manusia selalu menarik, tercermin 9 padadisiplinilmuyangberkembang,baikilmumurnimaupunilmuterapan. Tentangmanusia,alQuranmenggunakantiganama,yaitu(1) 10 (2) dan(3) atau . menurutkebanyakantafsir,manusia sebagai basyar lebih menunjukkan sifat lahiriah serta persamaannya dengan 11 manusia sebagai satu keseluruhan sehingga Nabi pun disebut sebagai basyar, samasepertiyanglain,hanyasajabeliaudiberiwahyuolehTuhan,satuhalyang membuatnya berbeda denganbasyar yang lain, seperti dijelaskandalam surat al Kahfi/18:110 . 12 Sedangkan nama insan yang berasal dari kata (uns) yang berarti 13 jinak, harmoni dan tampak, atau dari kata (nasiya) yang artinya lupa, atau dari (nasayanusu) 14 yangartinyaberguncang,menunjukkepadamanusia
-

5 6

Imam al-Ghazali, Ihya Ulum al-Din (tt: kitab al-Syuab, tth), vol. II h. 1345 Ibid 7 ibid 8 Depdikbud,KamusBesarBahasaIndonesia,(Jakarta:BalaiPustaka,1994),cetke3,h.
9

679. Dr.Muhammad MuhammadJabiryangmentashhihalMunqizhminalDlalalnyaImam alGhazali mengatakan bahwa filsafat (sebagai ilmu dasar) sebenarnya merupakan symbol dari revolusi melawan manipulator yang mengarahkan manusia tanpa bendera kemanusiaan. Menurutnya,filsafattidakbermaksudmenghancurkanagama,tetapikeduanyaberhubungandalam hal mencari kebajikan bagi manusia (lihat Abu Hamid Muhammad ibn Muhammad Ibn MuhammadalGhazali, alMunqizhminalDlala,waKimyaalSaadahwaalQawaidalAsyrah waalAdabfialDin(Beirut:alMaktabahalSaqafiyah,tth),h.16 10 AlQuranmenyebutterm insane sebanyak65kali, ins 12kali, unas lima kali, nasiya satu kali,alNas250kali,basyar37kali,baniAdamtujuhkalidandzurriyahAdamsatukali. 11 IbnKastsirmenafsirkanbasyardarisuratalKahfi110inidenganmenyebutkanbahwa Muhammad sebagai basyar tidak mengetahui halhal yang gaib, tidak mengetahui pula data sejarah masa lalu daribangsabangsayangdisebutalQuran.ApayangdisampaikanolehNabi bukanpengetahuannyakarenabeliausebagai basyar pengetahuannyaterbatassepertiketerbatasan pengetahuan basyar yang lain, hanya saja Allah memberi beliau informasi tentang hal tersebut melalui wahyu. (Muhammad Alial Shabuni, Mukhtashar Tafsir Ibn Katsir (Beirut : Dar al Quran,1981),jilidII,h.440 12 IbnManzhur,LisanalArab(Kairo:daralMaarif,tth),JilidI,h.147150 13 ibid, h.147.menurutIbnAbbas,manusiadisebutinsanekarenasifatpelupanyaterhadapjanji, li nisyanibi. 14 Ibid,jilidVI,h.4575

dengan seluruh totalitasnya, jiwa dan raga. Perbedaan manusia antara yang satu dengan yang lain, bisa merupakan perbedaan fisik, bisa juga perbedaan mental dan kecerdasan. Kata nafs sendiri, dalam alQuran mempunyai aneka makna. Dalam surat alMaidah/5:32, berbunyi menunjuk pada arti totalitas manusia,sedangpadasuratalRad/13/11yangberbunyi menunjuk pada apa saja yang terdapat dalam diri manusia yang menghasilkantingkahlaku,danpadasuratalAnam/6:12yangberbunyi menunjukkepadadiriTuhan.Nafs dalamkontekspembicaraantentang manusiamenunjukkepadasisidalammanusiayangberpotensibaikdanburuk. Penelitiantentanghakikatmanusiaatausekurangkurangnyatentangsifat sifatmanusiayangsecaraalamimelekatpadamanusia,atauhokumhukumyang berlakupadakejiwaanmanusiadalamhalinikonsepnafsdalamalQuranadalah sangat penting. Pentingnya penelitian tentang nafs bukan hanya terbatas pada kebutuhanpengetahuan,tetapijugapadakepentinganmengurai,meramalkandan mengendalikan tingkah laku manusia, baik secara individual maupun secara kelompok,baikdalamkaitannyadenganbidangdakwahataupendidikanmaupun untukkepentinganmenggerakkanmasyarakatdalampembangunannasional. AlQuran mengisyaratkan bahwa nafs sebagai sisi dalam manusia berhubungandengandorongandorongantingkahlaku,sikapdandengantingkah lakuitusendiri.Olehkarenaitukajiantentangnafs dalamalQuranmencakup(1) maknayangdapatdipahamidariungkapannafs,(2)nafssebagaipenggerakatau dorongantingkahlakudan(3)hubungan nafsdengantingkahlakumanusia.
B. Jiwa Menurut Term Nafs AlQuran menyebut nafs dalam bentukbentuk kata jadian . Dalam bentuk mufrad, nafs disebut 77 kali tanpa idlafah dan 65 kali dalam bentuk idlafah. Dalam bentuk jamak nufus disebut 2 kali, sedang dalam bentuk jamak anfus disebut 158 kali. Sedangkan kata tanaffasa, yatanaffasu dan al mutanaffisun masingmasing hanya disebut satu kali. Dalam bahasa Arab, kata nafs mempunyai banyak arti,15 tetapi yang menjadi obyek kajian Dallam tulisan ini adalah nafs seperti yang dimaksud dalam alQuran. Term nafs dalam alQuran semuanya disebut dalam benttuk ism atau kata benda, yakni nafs, nufus dan anfus. Sedangkan kata dalam surat alTakwir/ 81:18 ( dan kata dalam surat alMuthaffifin/ 83: 26 ( ) meskipun katakata itu berasal juga dari kata nafasa/ nafisa, dalam kata jadian seperti itu mempunyai arti yang tidak berhubungan dengan nafs. Sastra Arab kuno menggunakan kata nafs untuk menyebut diri atau seseorang, sementara kata roh digunakan untuk menyebut nafas dan angina. Pada masa awal turunnya alQuran, kata nafs di gunakan untuk menyebut jiwa

Bahasa Arab menggunakan term nafs untuk menyebut banyak hal, seperti roh, diri manusia, hakikat sesuatu, darah, saudara, kepunyaan, kegaiban, ukuran samakan kulit, jasad,kedekatan, zat, mata, kebesaran dan perhatian (lihat Ibn Manzhur, Lisan alArab (Ttp: dar al Ma'arif, tth), Jilid h. 45004501)
15

5. Nafs sebagai jiwa, surat alSyams/ 91: 7 dan surat alFajr/ 89: 27 ( ) 6. Nafs sebagai totalitas manusia, surat alMaidah/ 5:32 dan surat alQashash/ 28: 19, 33 7. Nafs sebagai sisi dalam manusia yang melahirkan tingkah laku, surat alRad/ 13: 11 ( ) dan alAnfal/ 8: 53. Dalam konteks manusia, disamping penggunaan nafs untuk menyebut totalitas manusia, banyak ayat alQuran yang mengisyaratkan gagasan nafs sebagai sesuatu di dalam diri manusia yang mempengaruhi perbuatannya, atau nafs sebagai sisi dalam manusia, sebagai lawan dari sisi luarnya. Ayatayat yang mengisyaratkan adanya sisi luar dan sisi dalam manusia antara lain adalah sebagai berikut:
)(

16 Pada periode Mekkah, alQur'an sudah menyebut alruh al amin, alruh al qudus dan al malaikah wa alruh sepeti yang tersebut dalam Q.s alSyuara/ 26:193, Q.s. alNahl/ 16:102,Q.s al Ma'arij/ 70:4, Q.s. alNaba/ 78:38, Q.s alQadr/ 97:4 17 Misalnya surat alMujadilah/ 58: 22 ( ) mengandung arti pertolongan Allah, dan surat alSyura /42:52 ( ) mengandung arti wahyu alQur'an. Lihat pula surat surat Q.s. alSyuara/ 26:193, Q.s. alNahl/ 16:102, Q.s alMaarij/ 70:4, Q.s alNaba/ 78:38, Q.s al Qadr/ 97:4 18 Tentang penggunaan kalimat roh dan nafs dengan makna silang dapat dilihat antara lain pada kitab alAfhanni kitab sastra masa Bani Umayyah, juga pada kitabkitab hadits, alMuwaththa, Musnad Ibn Hanbal, Shahih Bukhari pada kitab al_Farq bayn alFiraqnya al Baghdadi, alMilal wa al Nihalnya al Syahristani dan lainlain. Lihat pula Ibn Manzhur, Lisan alArab, Dar al Ma'arif dan H.A.R Gibb & J.H. kramers, Shorter Encyclopaedia of Islam (New York Cornell Uniersity Press, 1953), h. 433436 dan Edward William Lanc, ArabicEnglish Lexion, (London: Islamic Texts Society Trust, 1984), volume II, h. 28262829

atau sisi dalam manusia16, sementara roh digunakan untuk menyebut malaikat Jibril atau anugerah ketuhanan yang istimewa.17 Baru pada periode sesudah al Quran secara keseluruhan memasyarakat di dunia Islam, kata nafs digunakan oleh literature Arab untuk menyebut jiwa danroh secara silang, dan keduanya digunakan untuk menyebut rohani, malaikat dan jin. Bahasa Arab juga menggunakan istilah nafsiyun ( ) dan nafsaniyun ( ) untuk menyebut hal 18 hal yang berhubungan dengan nafs. Dalam alQuran, kata nafs mempunyai aneka makna: 1. Nafs, sebagai diri atau seseorang, seperti yang disebut dalam surat Alu Imran/ 3: 61 ( ) , surat Yusuf /12: 54 dan surat alDzariyat / 51: 21 ( ) 2. Nafs, sebagai diri Tuhan, surat alAnam / 6: 12, 54 ( ) 3. Nafs, sebagai person sesuatu, dalam surat alFurqon/ 25:3 dan surat alAnam/ 6:130 4. Nafs sebagia roh, surat alAnam / 6: 93
)(

O=t A#y)J/ nyY >x @2ur ( #ys? $tBur P$ymF{$# s? $tBur 4s\R& @2 @JtrB $tB Nn=t !$# #tGB uqd `tBur m/ tygy_ `tBur tAqs)9$# | r& `B O3ZiB !#uqy A$ytFJ9$# 7x69$# oypk9$#ur =t9$# w !$# c) 3 !$# Br& `B mtRqxts m=yz `Bur myt t/ .`iB Mt7e)yB ms9 $pk]9$$/ 7>$yur @9$$/ `B mRr `iB Ogs9 $tBur 4 ms9 ttB xs #[q 5Qqs)/ !$# y#ur& !#s)ur 3 NkRr'/ $tB (#rit 4Lym BQqs)/ $tB it @A#ur Allah mengetahui apa yang dikandung oleh setiap perempuan, dan kandungan rahim yang kurang Sempurna dan yang bertambah. dan segala sesuatu pada sisi Nya ada ukurannya. Yang mengetahui semua yang ghaib dan yang nampak yang Maha besar lagi Maha Tinggi. Sama saja (bagi Tuhan), siapa diantaramu yang merahasiakan ucapannya, dan siapa yang berterusterang dengan Ucapan itu, dan siapa yang bersembunyi di malam hari dan yang berjalan (menampakkan diri) di siang hari. Bagi manusia ada malaikatmalaikat yang selalu mengikutinya bergiliran, di muka dan di belakangnya, mereka menjaganya atas perintah Allah. Sesungguhnya Allah tidak merobah keadaan sesuatu kaum sehingga mereka merobah keadaan yang ada pada diri mereka sendiri. dan apabila Allah menghendaki keburukan terhadap sesuatu kaum, Maka tak ada yang dapat menolaknya dan sekalikali tak ada pelindung bagi mereka selain Dia. (Q.s. AlRad/ 13:811)

1. Nafs sebagai Totalitas Manusia Kata nafs digunakan alQuran untuk menyebut manusia sebagai totalitas, baik manusia sebagai makhluk yang hidup di dunia maupun manusia yang hidup di alam akhirat. Surat alMaidah/5:32, misalnya menggunakan nafs untuk menyebut totalitas manusia di dunia, yakni manusia hidup yang bisa dibunuh, tetapi pada surat Yasin/ 36: 54, kata nafs digunakan untuk menyebut manusia di alam akhirat.

$yJRr'x6s F{$# 7$|s rr& CtR t/ $GtR @tFs% `tB mRr& @u ) _t/ 4n?t $oY;tF2 y79s @_r& `B 4 $YJy_ }$Y9$# $umr& !$uKRr'x6s $yd$umr& `tBur $YJy_ }$Z9$# @tFs%
...

Oleh Karena itu kami tetapkan (suatu hukum) bagi Bani Israil, bahwa: barangsiapa yang membunuh seorang manusia, bukan Karena orang itu (membunuh) orang lain, atau bukan Karena membuat kerusakan dimuka bumi,

Maka seakanakan dia Telah membunuh manusia seluruhnya]. dan barangsiapa yang memelihara kehidupan seorang manusia, Maka seolaholah dia Telah memelihara kehidupan manusia semuanya. (Q.s alMaidah:32) tbq=yJs? OFZ2 $tB w) crtgB wur $\x tR Nn=? w tPqu9$$s Maka pada hari itu seseorang tidak akan dirugikan sedikitpun dan kamu tidak dibalasi, kecuali dengan apa yang Telah kamu kerjakan. (Q.s Yasin/ 36:54) Penggunaan nafs untuk menyebut totalitas manusia juga dapat dijumpai pada surat alBaqarah/2:61 dan 123, Yusuf / 12:54, alDzariyat / 51: 21, dan al Nahl/ 16: 111. Dari penggunaan term nafs untuk menyebut manusia yang hidup di alam dunia maupun di alam akhirat melahirkan pertanyaan tentang pengertian totalitas manusia. Sebagaimana yang sudah menjadi pemahaman umum bahwa manusia adalah makhluk yang memiliki dua dimensi, yaitu jiwa dan raga. Tanpa jiwadengan fungsifungsinyamanusia dipandang tidak sempurna, dan tanpa jasa, jiwa tidak dapat menjalankan fungsifungsinya. Surat Yasin/ 36: 54 mengisyaratkan adanya paham eskatologi dalam alQuran, yakni bahwa di samping manusia hidup di alam dunia, ada dunia lain, yakni alam akhirat di mana manusia nanti harus mempertanggungjawabkan perbuatannya selama di dunia. Jadi totalitas manusia menurut alQuran bukan hanya bermakna manusia sebagai makhluk dunia, tetapi juga sebagai makhluk akhirat, yakni manusia yang juga harus mempertanggungjawabkan perbuatannya nanti di alam akhirat. Pertanyaan selanjutnya adalah bagaimana wujud kehidupan nafs di akhirat dibanding dengan kehidupan di alam dunia. Alam dunia bersifat materi, dan keberadaan manusia di alam dunia juga bisa didekati dengan ukuran ukuran materi dalam hal ini dengan panca inderameski disisi lain manusia juga memiliki kehidupan spiritual. Alam akhirat bukan alam materi, oleh karena itu tolak ukur alam akhirat berbeda dengan tolak ukur alam dunia. Bagaimana manusia hidup di dunia sudah diketahui oleh ilmu pengetahuan, sedang bagaimana manusia hidup di alam akhirat hanya bisa didekati dengan keyakinan. Menurut alQuran, di alam akhirat nanti, nafs akan dipertemukan dengan badannya. Surat alTakwir/ 81:7 berbunyi: (dan ketika nafs nafs itu dipertemukan (dengan badannya). Kebanyakan tafsir, misalnya tafsir alMaraghi menafsirkan kalimat zuwwiyat dengan arti dipertemukan dengan badannya.19 Penafsiran ini menunjukkan pada ayat lain yang mengisyaratkan bahwa di alam akhirat manusia juga memiliki anggota badan. Surat Yasin/ 36: 65, misalnya berbunyi: tbq63t (#qR%x. $yJ/ Ng=_r& pks?ur Nkr& !$uZJk=s3?ur Ngduqr& #n?t OFwU tPqu9$#

19 Ahmad Mushthafa alMaraghi, Tafsir alMaraghi (Beirut: dar alIhya al Turas alArabiyah, 1985), jilid 10 Juz 30, h. 55

Pada hari Ini kami tutup mulut mereka dan berkatalah kepada kami tangan mereka dan memberi kesaksianlah kaki mereka terhadap apa yang dahulu mereka usahakan. (Q.s Yasin/ 36:65) Demikian juga ayatayat yang menggambarkan keadaan sorga mengisyaratkan adanya bentukbentuk kehidupan yang menyerupai kehidupan manusia di alam dunia, seperti adanya mata air sebagai sumber minuman dan gelas yang diperuntukkan bagi alabrar seperti yang terdapat dalam surat al Insan/76:5 ( ) serta adanya dipandipan dan bidadari seperti dijelaskan surat alThur/ 52: 20 Jika nafs di akhirat nanti akan dipertemukan dengan badannya, pertanyaan yang timbul apakah badan yang lama, yang telah hancur menjadi tanah, atau badan baru yang dirancang untuk hidup di alam rohani. Ditinjau dari kekuasaan Tuhan, maka mempertemukan nafs dengan badannya bukanlah masalah, karena seperti dipaparkan surat Yasin/36: 79 ( ) Tuhan berkuasa menghidupkan yang mati sebagaimana berkuasa menghidupkan pada kali pertama. Selanjutnya hal itu kembali kepada keimanan dan keyakinan. Berbeda dengan alMaraghi, Abdullah Yusuf Ali dalam The Meaning of the Glorius Quran mengartikan dengan dipilih. Jadi menurut Yusuf Ali, pada hari akhirat nanai nafs akan dikelompokkan menjadi tiga golongan, yaitu: nafs yang termasuk dekat dengan Tuhan dan dua selebihnya adalah golongan kanan dan golongan kiri ( ).20 Pendapat Yusuf Ali dalam hal ini sebenarnya merupakan tafsir alQuran bi alQuran, yakni bahwa surat alTakwir/ 81:7 di tafsir dengan surat al Waqiah/56:710, bahwa kelak pada hari kiamat manusia akan dikelompokkan menjadi tiga golongan, .21 Menurut Fakhr alRazi, yang juga diikuti oleh Mohammad Arkoun,22 kalimat zuwwiyat pada surat alTakwir /81:7 dimungkinkan untuk banyak penafsiratn. Pendapatpendapat yang idkutip Imam alRazi, menegaskan prinsip bahwa yang dpertemukan dalam term zuwwijat haruslah di antara dua pihak yang sepadan, maka makna zuwwijat bisa berarti dipertemukan (a) nafs dengan jasadnya, (b) nafsnya orang mukmin
)( )(

20

Abdullah Yusuf Ali, The Meaning of Glorious Qur'an (Beirut: Dar alKutub alLubhani, tth), (Q.s. al

h. 1694
21

Waqiah/ 56: 711) 22 Muhammad Arkoun, alFikr alIslami, Naqa wa Ijtihad (London: dar alSaqi, 1990), h. 75 105). Buku ini sebenarnyamerupakan kumpulan dari artikel dalam bahasa Prancis yang ditulis dalam rangka seminar Internasional bertema Intellectuels et Militans dans le monde islamique yang diselenggarakan oleh Universitas Ness bulan Desember 1988, tapi kemudian diterjemahkan dan dita'liq oleh Hasyim Saleh dengan judul tersebut di atas. Hasyim bekerja keras mengorek pemikiran Arkoun dengan mengajukan 21 topik pertanyaan kepada Arkoun. Hasyim juga secara khusus mewawancarai dan mengulas pemikiran Arkoun pada tiga seminar yang lain.

dengan bidadari, (c) nafsnya orang kafir dengan setan, (d) nafsnya orang Yahudi dengan Yahudi dan Nasrani dengan Nasrani, (e) nafs dengan amalnya.23 Pengertian totalitas manusia juga bermakna bahwa manusia memiliki sisi luar dan sisi dalam. AlQuran mengisyaratkan bahwa nafs juga merupakan sisi dalam manusia. 2. Nafs Sebagai Sisi Dalam Manusia Surat alRad/ 13:10, mengisyaratkan bahwa manusia memiliki sisi dalam dan sisi luar. $pk]9$$/ 7>$yur @9$$/ #tGB uqd `tBur m/ tygy_ `tBur tAqs)9$# | r& `B O3ZiB !#uqy Sama saja (bagi Tuhan), siapa diantaramu yang merahasiakan ucapannya, dan siapa yang berterusterang dengan Ucapan itu, dan siapa yang bersembunyi di malam hari dan yang berjalan (menampakkan diri) di siang hari. (Q.s alRad/ 13:10) Kesanggupan manusia untuk merahasiakan dan berterusterang ( ) dengan ucapannya merupakan petunjuk adanya sisi dalam dan sisi luar dari manusia. AlQuran juga menyebut hubungan antara sisi dalam dan sisi luarnya. Jika sisi luar manusia dapat dilihat pada perbuatan lahirnya, maka sisi dalam, menurut alQuran berfungsi sebagai penggeraknya. Surat alSyams/ 91:7 secara tegas menyebut nafs sebagai jiwa. Jadi sisi dalama manusia adalah jiwanya. Sekurangkurangnya alQuran dua kali menyebut nafs sebagai sisi dalam yang mengandung potensi sebagai penggerak tingkah laku, yaitu pada surat al Rad/13: 11 dalam surat alAnfal / 8: 53 NkRr'/ $tB (#rit 4Lym BQqs)/ $tB it w !$# c) 3 Sesungguhnya Allah tidak merobah keadaan sesuatu kaum sehingga mereka merobah keadaanyang ada pada nafs mereka sendiri. (Q.s AlRad/ 13:11) O=t Jy !$# cr&ur NkRr'/ $tB (#rit 4Lym BQqs% 4n?t $ygyJyRr& pyJoR #ZitB 7t Ns9 !$# cr'/ y79s (siksaan) yang demikian itu adalah Karena Sesungguhnya Allah sekalikali tidak akan meubah sesuatu nikmat yang Telah dianugerahkanNya kepada suatu kaum, hingga kaum itu meubah apaapa yang ada pada diri mereka sendiri dan Sesungguhnya Allah Maha mendengar lagi Maha Mengetahui. (Q.s alAnfal/ 8:53

23

Imam alFakhr alRazi, alTafsir al Kabir, (Beirut Dar Ihya alTurats alArabi, tth) juz XXXI,

h. 69

Pada surat alRad/ 13: 11 di atas, ada dua kalimat yang menunjukkan keadaan sesuatu pada kaum, yaitu kalimat dan . dalam kaidah bahasa Arab, huruf pada kalimat dan mengandung arti berita ( ). Jadi artinya apa yang ada pada sesuatu kaum, dan artinya apa yang ada pada nafs atau sisi dalam mereka. Sedangkan apa kandungan huruf ma dapat dilihat pada konteks ayat terseubt atau munasabah dari ayat sebelum dan sesudahnya. Surat alRad/ 13: 17 menyebutkan tentang kekuasaan Allah dan kesempurnaan ilmuNya pada system jagad raya, serta keheranannya terhadap orang kafir yang tidak percaya. Ayat 89 menyebutkan kesempurnaan pengetahuan Allah terhadap kapasitas dan proses kejadian manusia ketika masih dalam kandungan ibunya. Allah telah menetapkan kapasitas manusia satu persatu sejak dini. Ayat 10 mengisyaratkan bahwa manusia memiliki sisi luar dan sisi dalam, sisi yang tampak dan sisi yang tidak tampak, yang keduanya tapak jelas bagiNya.Pada ayat 11, alQuran menegaskan komitmen Tuhan dalam memberikan rahmat kepada manusia, yakni denganmengirimkan malaikat rahmat untuk selalu menyertai, mengawasi dan menjaganya. Meskipun demikian manusia tetap diberi ruang yang besar untuk menggapai apa yang diinginkan, sehingga apa yang dicapai bergantung usahanya. Tuhan tidak hanya memberikan anugerah berupa nikmat kepada manusia atau masyarakat, tetapi juga memberi kesempatan kepada mereka untuk serta dalam mencapai tujuan yang diinginkan. Jadi pada surat alRad / 13:11 mengisyaratkan peluang keberhasilan manusia dalam memenuhi kebutuhan hidupnya. Pada surat alAnfal/ 8: 53, secara lebih jelas disebutkan bahwa apa yang ada pada suatu kaum itu ialah nikmat Allah bagi manusia. Ayat sebelumnya (52) dan sesudahnya (54) secara jelas menceritakan pasang surut kejayaan dan keturunan Firaun dan orangorang sebelumnya dimana siksaan Tuhan dating disebabkan oleh perbuatan meraka mendustakanNya. Jadi surat alAnfal/8:53 mengisyaratkan bahwa kejayaan suatu kaum bergantung kepada apa yang ada dalam nafs mereka, karena Tuhan tidak akan mencabut atau mendatangkan suatu tingkat kesejahteraan begitu saja kepada suatu kaum tanpa peran mereka, dan peran itu bersumber dari apa yang ada dalam nafs mereka. Dengan demikian kata mengisyaratkan bahwa nafs itu merupakan sisi dalam manusia yang juga merupakan wadah bagai suatu potensi, dan sesuatu itu sangat besar perannya bagi perbuatan manusia. Apa yang ada didalam nafs manusia berperan besar dalam mempertahankan, menambah atau mengurangi tingkat social ekonomi masyarakat. Baik surat alRad maupun al Anfal mengubungkan apa yang ada di dalam nafs dengan perubahan. Apa yang tersembunyai dalam nafs, dan dari sana lahir perbuatan akan dapat melahirkan perubahanperubahan besar dalam kehidupan manusia di muka bumi ini. Pekerjaan melakukan perubahan adalah pekerjaan yang melibatkan gagasan, perasaan dan kemauan. Oleh karena itu apa isi anfus seperti yang dimaksud dalam term pastilah suatu potensi, atau sekurangkurangnya di antara muatan nafs adalah potensi, yakni potensi untuk merasa, berpikir dan
)(

10

berkemauan. Dari term dapat dipahami bahwa nafs bukan alat, tetapi lebih merupakan wadah yang didalamnya terdapat aneka fasilitas. Ia merupakan ruang dalam atau rohani manusia yang sangat luas yang juga menampung aneka fasilitas, ibarat ruang besar yang berkamarkamar, menampung seluruh aspek nafs manusia, yang diisi dari maupun yang tidak disadari. Hal ini diisyaratkan dalam surat Thaha/ 20: 7 yang berbunyi:

s"zr&ur c9$# Nn=t mR*s Aqs)9$$/ yggrB b)ur Dan jika kamu mengeraskan ucapanmu, Maka Sesungguhnya dia mengetahui rahasia dan yang lebih tersembunyi Menurut alMaraghi, alsirr atau rahasia adalah apa yang dirahasiakan seseorang kepada orang lain, sedangkan makna akhfa atau yang tersembunyi adalah apa yang terlintas di dalam hati tetapi sudah tidak disadari, mungkin sama dengan apa yang dalam istilah Ilmu Jiwa disebut alam bawah sadar.24 a. Nafs sebagai Penggerak Tingkah Laku Surat alRad/ 1311, disamping mengisyaratkan nafs sebagai wadah, ia juga mengisyaratkan sebagai penggerak tingkah laku. Tuhan tidak mengubah keadaan suatu kaum sampai mereka mengubah keadaan kaum sampai mereka mengubah isi dari nafs mereka. Jadi nafs bisa dioptimalkan fungsinya untuk menggerakkan tingkahlaku manusia melakukan perubahanperubahan. Sebagai wadah, nafs dapat menampung halhal yang baik maupun yang buruk, seperti terdapat pada surat alSyams/ 91:8, ( ) selanjutnya menurut surat alNaziat/ 79: 40 ( ), jika dijaga dari dorongan syahwat atau hawa nafsu, dan disucikan, seperti yang terdapat dalam Q. S alSyams/ 91:9, nafs meningkatkan kualitasnya. Akan tetapi jia ia dikotori dengan perbuatan maksiat dan menjauhi kebajikan seperti yang disebut dalam surat Q.S. alSyams/ 91:10 , maka nafs menjadi rendah kualitasnya. Kualitas nafs itu berpengaruh terhadap perbuatan. Jika kualitas nafs itu baik, maka kecenderungannya pada menggerakkan perbuatan baik, sebaliknya jika kualitasnya rendah, maka nafs cenderung mudah menggerakkan perbuatan buruk. Akan tetapi dalam menggerakkan tingkah laku dengan segala prosesnya, nafs tidak bekerja secara langsung, karena nafs bukanlah alat. Nafs bekerja melalui jaringan system yang bersifat rohani. Dalam system nafs terdapat sub system yang bekerja sebagai alat yang memungkinkan manusia dapat memahami, berpkir dan merasa, yaitu: qalb, bahirah, ruh dan aql, yang akan dibahas pada bagian lain di belakang. b. Kualitas Nafs AlQuran menegaskan bahwa pada dasarnya nafs diciptakan TUhan dalam keadaan sempurna. Sebagai perangkat dalam (rohani) manusia, nafs
) (

24

Ahmad Mushthafa alMaraghi, op.cit vol. Vi, h. 96

11

dicipta secara lengkap, diilhamkan kepadanya kebaikan dan keburukan agar ia dapat mengetahuinya. $yg9y `tB z>%s{ s%ur $yg8.y `tB yxn=r& s% $yg1uq)s?ur $yduqg $ygyJol;r's $yg1qy $tBur <tRur Dan jiwa serta penyempurnaannya (ciptaannya), maka Allah mengilhamkan kepada jiwa itu (jalan) kefasikan dan ketakwaannya. Sesungguhnya beruntunglah orang yang mensucikan jiwa itu, Dan Sesungguhnya merugilah orang yang mengotorinya. (Q.s alSyams/ 91: 711) Nafs adalah aljawhar atau substansi yang menyebabkan manusia berbeda kualitasnya dengan makhluk yang lain, yakni yang menyebabkan manusia mampu menggagas, berpikir dan merenung, kemudian dengan gagasan dan pikirannya itu manusia mengambil keputusan, dan dengan pikirannya itu manusia juga dapat menangkap ramburambu dan symbolsimbol yang membuatnya harus memilih jalan mana yang harus ditempuh. Menurut alQuran, nafs memiliki kemerdekaan dan memiliki peluang apakah kemudian cenderung kepada kebaikan dan alergi kepada keburukan atau sebaliknya, bergantung kepada faktorfaktor yang mempengaruhinya. Faktor terpenting dalam hal ini adalah bagaimana manusia mengendalikan kodrat fitriahnya, tabiat individualnya serta daya responnya terhadap lingkungan sebelum melakukan suatu perbuatan. Menurut alQuran, nafs memiliki kemerdekaan untuk membedakan antara kebaikan dan keburukan, dan dengan alat bantu yang tersedia, memungkinkan memilih jalan atau mengubah keputusan, sehingga suatu nafs memutuskan untuk memilih jalan yang menuju kepada martabat takwa, dan di waktu yang lain menyimpang ke jalan yang sesat. Dalam surat alIsra/ 17: 15 disebutkan: $Z. $tBur 3 3tz& ur ou#ur s? wur 4 $pkn=t @t $yJR*s @| `tBur ( muZ9 tGku $yJR*s 3ytFd$# `B Zwqu y]y6tR 4Lym t/jyB Barangsiapa yang berbuat sesuai dengan hidayah (Allah), Maka Sesungguhnya dia berbuat itu untuk (keselamatan) dirinya sendiri dan barangsiapa yang sesat Maka Sesungguhnya dia tersesat bagi (kerugian) dirinya sendiri. dan seorang yang berdosa tidak dapat memikul dosa orang lain, dan kami tidak akan meng'azab sebelum kami mengutus seorang rasul. Sejalan dengan kemerdekaan yang diberi oleh Tuhan, nafs juga diberi tanggung jawab dan otonomi. Seperti dijelaskan ayat di atas, bahwa seseorang yang berdosa tidak akan memikul dosa orang lain, dan Tuhan tidak akan memberi azab sebelum terlebih dahulu memberi ramburambu yang harus dipatuhi melalui rasulNya. Kemerdekaan dan tanggung jawab nafs itu diberikan sedemikian rupa hingga Tuhan mengingatkan bahwa Dia mengetahui sisi dalam yang disembunyikan manusia. Surat Qaf/ 50: 16 menyebutkan bahwa apa yang

12

dibicarakan oleh nafs, yang tidak terdengar oleh panca indera manusia, diketahui oleh Tuhan. uq9$# @7ym `B ms9) >t%r& `twUur ( mtR m/ quq? $tB On=tRur z`|SM}$# $uZ)n=yz s)s9ur Dan Sesungguhnya kami Telah menciptakan manusia dan mengetahui apa yang dibisikkan oleh hatinya, dan kami lebih dekat kepadanya daripada urat lehernya, (Q.s. Qaf/ 50:16) Kualitas nafs seseorang bisa meningkat dan bisa menurut dan hal ini berkaitan dengan system yang melibatkan jaringan tabiat dan fitnah manusia. Kualitas nafs yang telah terbentuk pada seseorang membentuk system pengendalian oleh tiaptiap individu, sehingga seseorang kuat dan yang lain ada yang lembah dalam menghadapi godaan yang dating dari luar. Hal ini diisyaratkan oleh alQuran surat alNaziat/ 79: 4041: 3ur'yJ9$# }d spYpg:$# b*s 3uqol;$# `t }Z9$# ygtRur mn/u tP$s)tB t$%s{ `tB $Br&ur Dan adapun orangorang yang takut kepada kebesaran Tuhannya dan menahan diri dari keinginan hawa nafsunya, Maka Sesungguhnya syurgalah tempat tinggal(nya).

Surat alHasyr/ 59: 9 juga menghubungkan kualitas nafs dengan tingkat kecintaan kepada harta benda. cqs=J9$# Nd s9'r's mtR x s-q `tBur 4 .....dan siapa yang dipelihara dari kekikiran dirinya, mereka Itulah orang orang yang beruntung Fisik manusia, meski genetiknya sehat, tetapi proses kehamilan, kelahiran dan lingkungan hidup selanjutnya mempengaruhi tingkat kesehatannya. Demikian juga tingkatan nafs, meskipun pada dasarnya ia dicipta Tuhan dalam keadaan sempurna seperti yang disebut dalam surat alSyams/ 91: 78, tetapi pemeliharaan dan pemupukannya seperti yang diisyaratkan dalam surat al Naziat/ 79:40, surat alHasyr/ 59:9, dan surat alSyams/ 91: 910 di atas melahirkan tingkatan nafs yang berbedabeda pada tiap orang. Pada orang dewasa yang berakal, tingkatan nafs disebut dalam alQuran dalam beberapa tingkatan, seperti alnafs alAmmarah, al Nafs alLawwamah dan alNafs al Muthmainnah. Sedangkan pada anakanak yang belum mukallaf, alQuran menyebut nafs untuk mereka denggan nama nafs zakiyah yang diterjemahkan ke dalam bahasa Indonesia dengan jiwa yang suci. c. Kapasitas Nafs

13

ZpD Zpu#u 7n/u 4n<) _$# pZyJJ9$# Z9$# $pkJ-r't Hai jiwa yang tenang. Kembalilah kepada Tuhanmu dengan hati yang puas lagi diridhaiNya. Akan tetapi kapasitas nafs tiap orang berbedabeda, maka disamping ada nafs yang dipanggil untuk kembali kepada Tuthan dengan ridha dan diridhoi, ada yang ditegur Tuhan karena tidak bisa mempertahankan kesucian nafsnya. Dalam surat alInfithar Allah berfirman y71q|s y7s)n=yz %!$# Ox69$# y7n/t/ x8x $tB `|RM}$# $pkr't Ntzr&ur MtBs% $B tR MyJ=t y7s9yys Setiap nafs mengetahui apa yang Telah dikerjakan dan yang dilalaikannya. Hai manusia, apakah yang Telah memperdayakan kamu (berbuat durhaka) terhadap Tuhanmu yang Maha Pemurah. Yang Telah menciptakan kamu lalu menyempurnakan kejadianmu dan menjadikan (susunan tubuh)mu seimbang, (Q.s alInfithar/ 82: 57) Menurut alMaraghi, kalimat artinya membuatmu seimbang 28 Sedangkan menurut Abdullah Yusuf Ali dalam the Meaning of the badannya. Glorious Quran, kalimat tersebut artinya membuatmu berprasangka adil, adil sepanjang argument rasional dan perasaan spiritual.29 Jadi pada dasarnya, meskipun nafs memiliki kemerdekaan, tetapi Tuhan memberikan kecenderungan kepada kebaikan dan keadilan. Dalam surat al

Surat alImran/ 3:25 lihat pula Q.s alImran/ 3:161 dan Q.s alIsra/ 17:15 Surat alAn'am/ 6:164 lihat Pula Q.s alBaqarah/ 2:281 28 Ahmad Mushthafa alMaraghi, op.cit Juz X, h. 66 29 Abdullah Yusuf Ali, op.cit h. 1701
26 27

25

Dihadapan Tuhan manusia bertanggung jawab secara perorangan. Sebagai khalifah Allah, setiap manusia telah dilengkapi perangkat untuk melaksanakan tugastugas kekhalifahannya. Perbuatan baik atau buruk kekecil apapun yang dilakukan manusia tidak ada yang tercecer dalam administrasi Tuhan (Q.S. alZilzalah/ 98: 87).25 Perbuatan baik yang dilakukan oleh setiap orang akan tercatat sebagai amal yang pahalanya diberikan kepada yang 26 Orang yang berdosa pun juga hanya bersangkutan. menanggung akibat dari dosa yang dia lakukan. Tidak seorang pun yang teraniaya, yakni harus menanggung perbuatan dosa orang lain. )27 Dihadapan Tuhan, nafs adalah otonom. Setiap nafs diberi peluang untuk berhubungan langsung dengan Allah swt. Jika badan manusia yang bersifat materi musnah bersama dengan kematian manusia, maka nafs manusia yang immateri dipanggil untuk kembali kepada Tuhannya, seperti yang dijabarkan dalam surat alFajr/ 89: 27:
)

14

Baqarah/ 2: 286, disebutkan bahwa nafs akan memperoleh ganjaran sesuai dengan perbuatannya: 3 Mt6|tF.$# $tB $pkn=tur Mt6|x. $tB $ygs9 4 Nafs memperoleh pahala (dari kebajikan) yang diusahakannya dan ia mendapat siksa (dari kejahatan) yang dikerjakannya (Q.s. alBaqarah/ 2:286) Dalam bahasa Arab, term menunjuk pada usaha yang dilakukan secara mudah, sedangkan term menunjuk pada usaha yang susah dan 30 Jadi pada dasarnya nafs diciptakan Tuhan dalam system manusia berikut berat. dengan segala fitrahnya, sebagai fasilitas untuk berbuat baik. Dengan kata lain pada dasarnyanya manusia diciptakan Tuhan untuk menjalankan kebaikan, yang kemudian diberi fasilitas dengan nafs yang memiliki kecenderungan kepada kebaikan. Akan tetapi kemerdekaan manusia memungkinkan ada orang yang mengabaikan perbuatan baik, sebaliknya malah melakukan keburukan, meskipun untuk itu harus bersusah payah melakukannya (iktasabat), yakni harus memenangkan konflik batin, karena batin atau nafsnya tidak mendukung perbuatan buruk itu. Ayat ini sebenarnya juga menegaskan apresiasi alQuran terhadap manusia, yakni memandang manusia sebagai makhluk yang mulia (positif) sejak lahir, berbeda dengan agama Kristen yang menganggap manusia secara negatif, yakni manusia dipandang telah membawa dosa warisan sejak lahir.31 Sejalan dengan pandangan positif alQuran, nafs diperlakukan Tuhan secara adil dan tidak akan teraniaya, oleh karena itu Allah tidak membebani suatu kewajiban kepada seseorang kecuali pasti sesuai dengan kapasitas kesanggupannya, seperti yang dipaparkan dalam surat alBaqarah/ 2286:

C. Tingkatan Kualitas Nafs Seperti telah dijelaskan dalam surat alSyams/ 91: 910 bahwa nafs itu diciptakan Tuhan secara sempurna, tetapi ia harus tetap dijaga kesuciannya, sebab ia bisa rusak jika dikotori dengan perbuatan maksiat. Kualitas nafs tiap orang berbedabeda berkaitan dengan bagaimana usaha masing menjaganya dari hawa (Q.s. AlNaziat/ 79: 40), yakni dari kecenderungannya kepada syahwat, karena menuruti dorongan syahwat itu, seperti yang dikatakan oleh alMaraghi, merupakan tingkah laku hewan yang dengan itu manusia telah menyianyiakan potensi akal yang menandai keistimewaannya.32 Dalam bahasa Indonesia, syahwat yang menggoda manusia sering disebut dengan istilah hawa nafsu, yakni dorongan nafsu yang cenderung bersifat rendah.
Ibn Manzhur, op.cit jilid V, h. 38703871 Gereja mengenal tiga macam dosa, yaitu dosa asal yang diwaris dari kesalahan Adam, dosa berat dan dosa ringan, masingmasing mengandung aspek Kristosentris, berhubungan dengan Tuhan, aspek social dan aspek eklesiologis, berhubungan dengan kegerejaan, lihat Vand den End, Dr. Th, Harta dalam Bejana (Jakarta: Badan Penerbit Kristen, tth) 32 Ahmad Mushthafa alMaraghi, op.cit , vol. X Juz xxx, h. 168169
30 31

15

AlQuran membagi tingkatan nafs pada dua kelompok besar, yaitu nafs martabat tinggi dan nafs martabat rendah. Nafs martabat tinggi dimiliki oleh orangorang yang takwa, yang takut kepada Allah dan berpegang teguh kepada petunjukNya serta menjauhi laranganNya. Sedangkan nafs martabat rendah dimiliki oleh orangorang yang yang menentang perintah Allah dan yang menbaikan ketentuanketentuanNya, serta orangorang yang sesat, yang cenderung berperilaku menyimpang dan melakukan kekejian serta kemungkaran. Secara ekplisit alQuran menyebut tiga jenis nafs, yaitu: 1. (alnafs almuthmainnah) 2. (alnafs allawwamah), dan 3. ) (alnafs alammarah bi alsu) Ketiga jenis nafs tersebut merupakan tingkatan kualitas, dari yang terendah hingga yang tertinggi. Ayatayat yang secara eksplisit menyebut ketiga jenis nafs itu adalah sebagai berikut: ?{$#ur t6 ?{$$s ZpD Zpu#u 7n/u 4n<) _$# pZyJJ9$# Z9$# $pkJ-r't LZy_ Hai jiwa yang tenang. Kembalilah kepada Tuhanmu dengan hati yang puas lagi diridhaiNya. Maka masuklah ke dalam jama'ah hambahambaKu, Masuklah ke dalam syurgaKu. (Q.s alFajr/ 89: 2730) ptB#q=9$# Z9$$/ N%& Iwur pyJu)9$# Qqu/ N%& Iw Aku bersumpah demi hari kiamat, Dan Aku bersumpah dengan jiwa yang amat menyesali (dirinya sendiri) (Q.s alQiyamah/ 75:12) Lm qx n1u b) 4 n1u zOmu $tB w) q9$$/ 8ou$BV{ }Z9$# b) 4 tR ht/& !$tBur * Dan Aku tidak membebaskan diriku (dari kesalahan), Karena Sesungguhnya nafsu itu selalu menyuruh kepada kejahatan, kecuali nafsu yang diberi rahmat oleh Tuhanku. Sesungguhnya Tuhanku Maha Pengampun lagi Maha penyanyang. (Q.s. Yusuf 12:53)

Disamping tiga penggolongan tersebut, alQuran juga menyebut term pada anak yang belum dewasa, seperti tersebut dalam surat alKhaf / 18: 73: #[3R $\x |M_ s)9 <tR t/ Op.y $TtR |M=tGs%r& tA$s% &s#tGs)s $VJn= $u)s9 #s) #Lym $s)n=sR$$s Maka berjalanlah keduanya hingga tatkala keduanya berjumpa dengan seorang anak, Maka Khidhr membunuhnya. Musa berkata: "Mengapa kamu membunuh jiwa yang bersih, bukan Karena dia membunuh orang lain? Sesungguhnya kamu Telah melakukan suatu yang mungkar". (Q.s. AlKahf/ 18:74

16

Dari keempat tingkatan itu dapat digambarkan bahwa pada mulanya, yakni ketika seorang manusia belum mukallaf, jiwanya masih suci (zakiyah). Ketika sudah mencapai mukallaf dan berinteraksi dengan lingkungan kehidupan yang menggoda, jika ia merespons secara positif terhadap lingkungan hidupnya maka nafs itu dapat meningkat menjadi nafs muthmainnah setelah terlebih dahulu berproses di dalam tingkatan nafs lawwamah. Setiap nafs yang telah mencapai tingkat muthmainnah pastilah ia menyandang predikat zakiyah pula. Akan tetapi jika nafs itu merespon lingkungan secara negatif, maka ia dapat menurun menjadi nafs ammarah dengan segala karakteristik buruknya. a. Nafs Zakiyah dan Tazkiyah alNafs Term zakiyah disebut dalam alQuran sebanyak 25 kali dalam berbagai kata bentukan, dua kai dalam bentuk ism sebagai sifat dan, am
33 dua belas kali dalam bentuk kata kerja 34 satu kali bentuk afal tafdil dalam bentuk kata kerja empat kali dalam bentuk kata kerja dua kali dalam bentuk kata kerja disamping 32 kali dalam bentuk kalimat . Menurut Isfahani, kalimat pada dasarnya mengandung arti tumbuh karena berkat dari Tuhan, seperti yang terkandung dalam dalam arti zakat. Jika dihubungkan denganmakanan, mengandung arti halal, tetapi jika dihubungan dengan nafs makadi dalamnya terkandung arti sifatsifat terpuji.35 Terjemahan al Qur'an terbitan Departemen Agama RepublikIndonesia menggunakan istilah "jiwa yang suci" ketika menterjemahkan kalimat dengan demikian maka pengertian menyucikan jiwa atau tazkiyah alnafs adalah membersihkan jiwa dari sifat tercela dan mengisinya dengan sifatsifat terpuji. Dari ayatayat yang berbicara tentang gagasan nafs zakiyah dapat disimpulkan bahwa konsep nafs zakiyah dalam alQur'an adalah sebagai berikut: a. Bahwa ada nafs yang suci secara fitri, yakni suci sejak mula kejadiannya, yaitu nafs dari anakanak yang belum mukallaf dan belum pernah melakukan perbuatan dosa seperti yang disebut dalam surat alKahf / 18: 74 dan surat Maryam/ 19: 19:

#[3R $\x |M_ s)9 <tR t/ Op.y $TtR |M=tGs%r& tA$s% &s#tGs)s $VJn= $u)s9 #s) #Lym $s)n=sR$$s Maka berjalanlah keduanya hingga tatkala keduanya berjumpa dengan seorang anak, Maka Khidhr membunuhnya. Musa berkata: "Mengapa kamu membunuh jiwa yang bersih, bukan Karena dia membunuh orang lain? Sesungguhnya kamu Telah melakukan suatu yang mungkar". (Q.s. AlKahf/ 18:74 $|2y $VJn= 7s9 |=ydL{ 7n/u Aqu O$tRr& !$yJR) tA$s%

Lihat Q.s. alKahf/ 18:74 dan Q.s. Maryam /19:19 lihat Q.s alBaqarah/ 2:232 dan Q.s alNur/ 24:28, 30 dan Q.s. alKahf/ 18:19 35 Lihat misalnya Q.s AlSyams/ 91:9 dan Q.s. alNajm/ 53:32
33 34

17

Ia (Jibril) berkata: "Sesungguhnya Aku Ini hanyalah seorang utusan Tuhanmu, untuk memberimu seorang anak lakilaki yang suci". (Q.s. Maryam/ 91:10 b. Bahwa nafs yang suci jika tidak dipelihara kesuciannya bisa berubah menjadi kotor seperti yang terdapat dalam surat alSyams/ 91:10) $yg9y `tB z>%s{ s%ur Dan Sesungguhnya merugilah orang yang mengotorinya.(Q.s. Syams/ 91:10) c. Bahwa manusia bisa melakukan usaha penyucian jiwa seperti yang disebut dalam surat alNazi'at / 79: 18, al Fathir/ 35: 18 dan surat alA'la/ 87: 14: yJ9$# !$# n<)ur 4 muZ9 41utIt $yJR*s 41ts? `tBur 4 dan barangsiapa yang mensucikan dirinya, Sesungguhnya ia mensucikan diri untuk kebaikan dirinya sendiri. dan kepada Allahlah kembali(mu). (Q.s. Fathir/ 35:18) d. Proses penyucian jiwa itu bisa melalui usaha, yakni dengan mengeluarkan zakat seperti yang tertera dalam surat alTaubah/ 9:103, dan menjalankan pergaulan hidup secara terhormat seperti yang disyaratkan dalam surat al Nur/ 24:28 dan 30. $pk5 Nkj.t?ur Nddgs? Zps%y| Nl;uqBr& `B { Ambillah zakat dari sebagian harta mereka, dengan zakat itu kamu membersihkan (hati dari kekikiran dan cinta harta) dan mensucikan mereka (dengan tumbuhnya sifatsifat terpuji dalam jiwa meraka) (Q.s. al Taubah/9:103) uqd ( (#q_$$s (#q_$# N3s9 @% b)ur ( /3s9 css 4Lym $ydq=zs? xs #Yymr& !$yg (#rgrB O9 b*s O=t cq=yJs? $yJ/ !$#ur 4 N3s9 4s1r& Jika kamu tidak menemui seorangpun didalamnya, Maka janganlah kamu masuk sebelum kamu mendapat izin. dan jika dikatakan kepadamu: "Kembali (saja)lah, Maka hendaklah kamu kembali. itu bersih bagimu dan Allah Maha mengetahui apa yang kamu kerjakan. (Q.s. alNur/ 24:28) $yJ/ 77yz !$# b) 3 Nlm; 4s1r& y79s 4 Ogy_r (#qxtsur Md|/r& `B (#qt ZBsJ=j9 @% tbqoYt Katakanlah kepada orang lakilaki yang beriman: "Hendaklah mereka menahan pandanganya, dan memelihara kemaluannya yang demikian itu adalah lebih Suci bagi mereka, Sesungguhnya Allah Maha mengetahui apa yang mereka perbuat". (Q.s alNur/ 24:30)
)(

18

e. Penyucian nafs juga bisa dilakukan dengan proses pendidikan seperti yang dilakukan para Nabi kepada umatnya. Hal ini ditegaskan alQur'an dalam surat alBaqarah/ 2: 129, 151, surat AluImran 164 dan surat Jumu'ah /62:2 spyJ3t:$#ur |=tG39$# NgJk=yur Nkj.tur mGt#u Nkn=t (#q=Ft Nk]iB Zwqu z`hiBW{$# y]yt/ %!$# uqd &7B 9@n=| "s9 @6s% `B (#qR%x. b)ur Dialah yang mengutus kepada kaum yang buta huruf seorang Rasul di antara mereka, yang membacakan ayatayatNya kepada mereka, mensucikan mereka dan mengajarkan mereka Kitab dan hikmah (As Sunnah). dan Sesungguhnya mereka sebelumnya benarbenar dalam kesesatan yang nyata, (Q.s. alJumuah/ 62:2) f. Disamping melalui usaha dan pendidikan, penyucian jiwa juga bisa terjadi karena manusia dan rahmat Allah yang diberikan kepada orang yang dikehendaki olehNya, seperti yang dijelaskan dalam surat alNur/ 24:21 dan surat alNisa/ 4:49 D't mR*s `s9$# Nuqz 7Kt `tBur 4 `s9$# Nuqz (#q6-Gs? w (#qZtB#u t%!$# $pkr't * j1t !$# `3s9ur #Yt/r& >tnr& `iB N3ZB 4s1y $tB mGuHquur /3n=t !$# @s wqs9ur 4 s3ZJ9$#ur !$tsx9$$/ O=t x !$#ur 3 !$to `tB Hai orangorang yang beriman, janganlah kamu mengikuti langkah langkah syaitan. barangsiapa yang mengikuti langkahlangkah syaitan, Maka Sesungguhnya syaitan itu menyuruh mengerjakan perbuatan yang keji dan yang mungkar. sekiranya tidaklah Karena kurnia Allah dan rahmatNya kepada kamu sekalian, niscaya tidak seorangpun dari kamu bersih (dari perbuatanperbuatan keji dan mungkar itu) selamalamanya, tetapi Allah membersihkan siapa yang dikehendakiNya. dan Allah Maha mendengar lagi Maha Mengetahui. (Q.s. alNur/ 24:21)

g. Perbuatan mensucikan jiwa (tazkiyah alnafs) merupakan perbuatan terpuji dan dihargai Tuhan seperti yang disebut dalam surat Thaha/ 20: 7576, Q.S AlSyams/ 91:9 Q.s alA'la/ 87: 14, dan Q.S alLayl/ 92: 18 41ts? `tB !#ty_ y79sur 4 $pk t$#yz pkXF{$# $pkJtrB `B grB 5bt MZy_ (yaitu) syurga 'Adn yang mengalir sungaisungai di bawahnya, mereka kekal di dalamnya. dan itu adalah balasan bagi orang yang bersih (dari kekafiran dan kemaksiatan). (Q.s. Thaha/ 20:76)

h. Bahwa perbuatan mengaku jiwanya telah suci itu merupakan hal yang tercela, seperti terdapat dalam surat alNajm/ 53: 32, dan Q.s. AlNisa/ 4:49

19

#s+?$# `yJ/ On=r& uqd ( N3|Rr& (#q.t? xs ( ...maka janganlah kamu mengatakan dirimu suci. dialah yang paling mengetahui tentang orang yang bertakwa. (Q. AlNajm/ 53:32) 1) Fitrah Kesucian Nafs Pada dasarnya nafs itu diciptakan Tuhan dalam keadaan sempurna (Q.s. alSyams/91: 78), tapi ia dapat tercemar menjadi kotor jika tidak dijaga (Q.s. 91: 910). Tentang nafs yang masih suci disebutkan dalam surat alKahfi/ 18: 74, dalam rangkaian kisah Nabi Musa dengan Nabi Khidir yang teks ayatnya telah ditulis pada bagian depan. Kalimat zakiyah pada ayat tersebut di atas ( ) merupakan sifat dari nafs, sehingga nafs zakiyah artinya jiwa yang suci. Dalam konteks ayat tersebut, pemilik nafs yang suci itu adalah seorang anak kecil, seperti yang juga disebut dalam surat Maryam/ 19:19 . Jadi nafs yang secara fitri masih suci adalah nafs dari anak yang belum mukallaf, yang oleh karena itu belum berdosa. Fakhr alRazi mengutip perbedaan makna dari kalimat dan sebagian mufasir memandang sama arti dari dua kalimat itu, tetapi sebagian membedakannya, antara lain Abu Amr ibn alA'la yang membedakan arti dari dua kalimat itu. Menurutnya, nafs zakiyah (dengan alif) adalah jiwa yang suci secara fitri, yakni belum pernah melakukan dosa, sedang nafs zakiyah adalahjiwa yang suci setelah melalui proses tazkiyah alnafs dengan bertaubat dari perbuatan dosa.36 Kesucian nafs bersifat maknawi, maka kotornyapunjuga bersifat maknawi. Seseorang dapat memelihara kesucian nafsnya manakala ia konsisten dalam jalan takwa, sebaliknya nafs berubah menjadi kotor jika pemiliknya menempuh jalan dosa atau fujur surat alSyams/ 91: 710 menyebutkan bahwa sungguh rugi orang yang telah mengotori jiwanya ( ). Kata dassa
( -

berasal dari kata yang arti lughawinya menyembunyikan sesuatu di dalam sesuatu.37Dalam kontek ayat ini, artinya orang mengotori jiwanya dengan perbuatan dosa yang dilakukan secara sumbunyisembunyi. Oleh karena itu sebagian mufasir berpendapat bahwa ayat Qur'an ini (Q.s. alSyams/ 91:10) berkenaan dengan nafsnya orang soleh yang melakukan kefasikan, bukan jiwa orang kafir, karena orang saleh , meski ia melakukan perbuatan dosa, tetapi ia malu dengan perbuatannya itu sehingga ia lakukan dengan cara sembunyi sembunyi, berbeda dengan orang kafir yang melakukannya dengan terang terangan.38 2) Usaha Penyucian Nafs (tazkiyah alnafs) AlQur'an mengisyaratkan bahwa jia yang tercemar masih dapat diusahakan untuk menjadi suci kembali, baik dengan usaha sendiri, melalui
Imam Fakhr alRazi, alTafsir alKabir (Beirut dar Ihya alTurats al Arabi, tth), cet III, juz XXI, h. 155 37 Ibn Manzhur, op.cit, jilid II, h. 13721373 38 Imam Fakhr alRazi, op.cit, juz xxxi, h. 193194
36

20

pendidikan atau karena anugerah dan rahmat Allah seperti yang diisyaratkan oleh surat Q.s. alTaubah/ 9: 103, Q.s Al Imran/ 3: 164. NgJk=yur Nke2tur mGt#u Nkn=t (#q=Gt MgRr& `iB Zwqu Nk y]yt/ ) tZBsJ9$# n?t !$# `tB s)s9 A7B 9@n=| "s9 @6s% `B (#qR%x. b)ur spyJ6t:$#ur |=tG39$# Sungguh Allah Telah memberi karunia kepada orangorang yang beriman ketika Allah mengutus diantara mereka seorang Rasul dari golongan mereka sendiri, yang membacakan kepada mereka ayatayat Allah, membersihkan (jiwa) mereka, dan mengajarkan kepada mereka Al Kitab dan Al hikmah. dan Sesungguhnya sebelum (kedatangan Nabi) itu, mereka adalah benarbenar dalam kesesatan yang nyata. (Q.s. alImran/3: 164 Ayat alQur'an tersebut mengisyaratkan bahwa orang yang sesat masih dimungkinkan untuk dibersihkan jwianya. Usaha atau proses penyucian jiwa itu disebut tazkiyah alnafs.39 Tazkiyah bisa dilakukan karena dorongan sendiri, atau didorong oleh orang lain, melalui dakwah, pendidikan atau bahkan paksaan. Menurut al Qur'an surat Fathir/ 35: 18 manusia dapat secara sadar melakukan suatu perbuatan yang dimaksud untuk mensyucikan jiwanya, . Perbuatan yang dapat menyucikan jiwa seseorang menurut alQur'an adalah a). pengeluaran infak harta benda, surat Q.s alLayl/ 92: 18 41utIt &s!$tB As %!$# b). takut terhadap azab Allah dan menjalankan ibadah salat, surat Q.s Fathir/ 35: 18 muZ9 41utIt $yJR*s 41ts? `tBur 4 no4qn=9$# (#qB$s%r&ur =t9$$/ Nk5u cqts t%!$# Z? $yJR) 3 c) menjaga kesucian kehidupan seksual, surat Q.s. al Nur/ 2430 Nlm; 4s1r& y79s 4 Ogy_r (#qxtsur Md|/r& `B (#qt ZBsJ=j9 @% d) menjaga etika pergaulan, surat alNur/ 24: 28 N3s9 4s1r& uqd ( (#q_$$s (#q_$# N3s9 @% b)ur (

Imam alGhazali lebih suka menyebut tazkiyah alnafs sebagai riyadlah al Nafs diman apusat perhatian riyadlah ini pada mengobati penyakit hati dan membangun akhlak mulia. Dalam hal ini alGhazali menempatkan bahasan ini pada bagian dua dari rub alMuhlikat. (lihat alGhazali, Ihya Ulum alDin (Kairo, dar Ihya al Kutub alArabiyah, tth), jilid iv, h. 1426
39

21

AlQur'an juga mengisyaratkan bahwa proses tazkiyah itu bisa terjadi melalui ajakan orang lain. Ada empat ayat yang menyebutkan bahwa apa yang dilakukan oleh para Rasul kepada umatnya dengan mengajarkan alkitab dan al hikmah merupakan pekerjaan yang membuat umatnya tersucikan jiwanya, yakni surat alBaqarah /2:129, 151, Q.s Al Imran/3:164, dan Q.s alJumuah/62:2 NgJk=yur Nke2tur mGt#u Nkn=t (#q=Gt MgRr& `iB Zwqu Nk y]yt/ ) tZBsJ9$# n?t !$# `tB s)s9 A7B 9@n=| "s9 @6s% `B (#qR%x. b)ur spyJ6t:$#ur |=tG39$# Sungguh Allah Telah memberi karunia kepada orangorang yang beriman ketika Allah mengutus diantara mereka seorang Rasul dari golongan mereka sendiri, yang membacakan kepada mereka ayatayat Allah, membersihkan (jiwa) mereka, dan mengajarkan kepada mereka Al Kitab dan Al hikmah. dan Sesungguhnya sebelum (kedatangan Nabi) itu, mereka adalah benarbenar dalam kesesatan yang nyata. (Q.s. alImran/ 3:164) Tentang makna tazkiyah alnafs, para mufassir mempunyai pandangan yang berbedabeda: 1. Tazkiyah dalam arti para Rasul mengajarkan kepada manusia sesuatu yang jika dipatuhi, akan menyebabkan jiwa mereka tersucikan dengannya.40 2. Tazkiyah dalam arti mensucikan manusia dari syirik, karena syirik itu oleh alQur'an dipandang sebagai sesuatu yang bersifat najis.41 3. Tazkiyah dalam arti mensucikan manusia dari syirik dan sifat rendah lainnya.42 4. Tazkiyah dalam arti mensucikan jiwa dari dosa.43 5. Tazkiyah dalam arti mengangkat manusia dari amrtabat orang munafik ke martabat mukhlisin.44 Disamping tazkiyah sebagai usaha, alQur'an juga mengisyaratkan adanya anugerah Allah kepada manusia berupa tazkiyah. Dalam surat alNur/ 24:21 disebutkan bahwa seandainya bukan karena anugerah Allah maka seseorang selamanya tidak bisa mensucikan jiwanya, dan Allah memberikan anugerah itu kepada orang yang dikehendakinya ). Dalam surat alNisa/ 4: 49, ketika alQur'an mencela tingkah laku manusia yangmerasa dirinya telah suci, juga ditegaskan bahwa Allahlah yang membersihkan jia dari orangorang yang dikehendakiNya.

Imam Fakhr alRazi, op.cit, jilid Iv. H. 67 Ibid, dan Ahmad Mushthfa alMaraghi, op.cit, jilid II, h. 123 42 Ahmad Mushthafa alMaraghi, ibid, jilid VIII, h. 121 danjilid X h. 95 43 Imam Fakhr alRazi, op.cit, jilid IX, h. 80 44 Ibid, jilid IV, h. 143
40 41

22

xGs tbqJn= wur !$to `tB j1t !$# @t/ 4 Nk|Rr& tbq.t t%!$# n<) ts? Ns9r& Apakah kamu tidak memperhatikan orang yang menganggap dirinya bersih? Sebenarnya Allah membersihkan siapa yang dikehendakiNya dan mereka tidak aniaya sedikitpun.

5).KeutamaanTazkiyahalNafs Sebagaimana telah disebutkan pada uraian terdahulu bahwa nafs diciptakan Tuhan dalam keadaan sempurna, diilhami dengan kebaikan dan keburukan supaya menjadi dorongan untuk melakukan kebaikan dan menjauhi keburukan. Perbuatan baik akan menjaga kesucian nafs dan dan perbuatan dosa akanmengotorinya,danperbuatanmelakukankebaikandanmenjauhikeburukan, keduanyamerupakanaktivitastazkiyahyangdipandangsebagaiibadah. Dalam Q.s alSyams/ 91:9 dan Q.s alA'la/ 87:14 orang yang melakukan perbuatantazkiyahalnafsdisebutsebagaiorang yang beruntungdan bahagia , dan dalam surat Q.sThaha/ 20:6 kepadanya diberikan pahala berupa derajatyangtinggidankeabadiansorgawi sebagaimana halnya ibadah yang lain di man akualitas dari ibadah itu hanya diketahui oleh Tuhan, maka alQur'an (Q.s al Najm/ 53: 32, Q.s AlNisa/ 4:49) juga mencela orang yang seakanakan telah mengetahui tingkat kesucian jiwanya,karenakesucianjiwaituhanyadiketahuiolehAllahsaja

b.AlNafsalLawwamah (NafsyangAmatMenyesaliDirinya) Termallawwamahhanya satukalidisebutdalamalQur'an,yaitupada suratalQiyamah/75:12

ptB#q=9$# Z9$$/ N%& Iwur pyJu)9$# Qqu/ N%& w


Aku bersumpah demi hari kiamat, Aku bersumpah dengan jiwa yang amat menyesali (dirinya sendiri)(Q.s.alQiyamah/75:12)

Lawwamah adalah kata bentukan dari yang artinya mencela. Secara lughawi, terma al lawwamah mangandung arti amat mencela. 45 Jadi secara lughawi nafs lawwamah adalah nafs yang banyak mencela. Nafs lawwamahtermasukkelompoknafsmartabattinggi,karenayangdicelaolehnafs iniadalahdirinyasendiri. MenurutriwayatIbn'Abbas,setiapnafskelakdiharikiamatakanmencela dirinya, baik nafs yang berbaktikepadaTuhan maupunnafspendosa.Nafs yang taat kepada Tuhan mencela dirinya karena menyesal tidak memperbanyak amal

45

AlRaghib alIsfahani, Mu'jam Mufradat Alfazah alQur'an (Beirut Dar al Fikr, tth) h.

476477

23

baiknya, sedangkan nafs pendosa mencela dirinya karena menyesal tidak 46 melakukanperbuatantakwa. Jadi cirri nafs al lawwamah adalah selalu mengeluh, kecewa dan menyalahkan dirinya. Dalam Surat alZumar/ 39:56 dan juga surat alMa'arij/ 70:1921disebutkan bahwanafs menyesalidirinyaatashilangnyapeluanguntuk berbuatamalbaik.

t9$# z`Js9 MZ. b)ur !$# =/Zy_ Ms $tB 4n?t 4tAuyst tR tAq)s? br&
Supaya jangan ada orang yang mengatakan: "Amat besar penyesalanku atas kelalaianku dalam (menunaikan kewajiban) terhadap Allah, sedang Aku Sesungguhnya termasuk orangorang yang memperolokolokkan(agamaAllah),(Q.s.alZumar/39:56)

$qZtB s:$# mtB #s)ur $Yry_ 9$# mtB #s) %q=yd t,=z z`|SM}$# b) *
Sesungguhnyamanusiadiciptakanbersifatkeluhkesahlagikikir.Apabilaiaditimpakesusahania berkeluhkesah,Danapabilaiamendapatkebaikaniaamatkikir,(Q.s.alMaarij/70:1921)

Menurut Imam Fakhr alRazi dalam Tafsir alKabirnya, prototype nafs al lawwamah dapat dicontohkan pada penyesalan Nabi Adam a.s.ketika harus meninggalkan sorga sebagai akibat kesalahannya melanggar larangan 47 Tuhan. Nafslawwamahtermasuknafsyangmulia,karenahanyaorangmukmin yang bisa menyesalidan menyalahkandirinya. Adapunorang bodoh biasanya ia sudah merasa puas atau sekurangkurangnya tidak merasa terganggu oleh perbuatanbodohnya. Makna lawwamah, dapat pula dicari pada munasabah ayat tersebut. Satu hal yang menarik ialah bahwa nafs ini disebut alQur'an dalam uslub qasam (kalimatsumpah)dandisebutsejalandenganharikiamat. UslubqasamdalamalQur'anselalumenunjukbesarnyamaknadariyang disumpahkan, misalnya Demi matahari ( ), demi masa ( ), demi mala ( ) dan lainlainnya. Bahwa hari kiamat layak disebut dengan uslub qasam, para mufasir menyepakati bahwa hari kiamat memang besar dan dahsyat maknanya.Sedangkannafslawwamah,apakah iasesuatu yangdahsyatsehingga disebutkandalamuslubqasamdanbahkandisejajarkandenganharikiamat,para mufasirberbedapendapat. Kebanyakan mufasir menilai bahwa kedua haruf dalam pada surat alQiyamah/ 75: 12 ini adalah bermakna sumpah, sehingga arti dari ayat itu adalah Aku bersumpah dengan hari kiamat, dan Aku bersumpah dengan nafs lawwamah. Dua hal itu, hari kiamat dan nafs lawwamah dipandang sebagai hal besaryangperluditonjolkandenganuslubqasam.Dengandemikianmakaantara nafs lawwamah dengan hari kiamat memang ada munasabah makna. Nafs lawwamah dipandang sebagai sesuatu yang besar oleh sebagian mufasir karena
46 47

ImamFakhralRazi,op.cit, j.XXXI,h.215 Ibid, h.216

24

nafs itu memiliki keunikan dan keajaiban. Nafs selamanya menarik dan memperdaya manusia ketika ia harus melaksanakan amanat yang diembannya, sepertiyangtersiratdalamsuratalAhzab/33:72 Hanya sebagian mufasir yang memandang nafs tidak layak di sebut dengan uslub qasam karena terlalu kecil sehingga mereka berpendapat bahwa pertamasebagai lamqasamdan keduasebagai lamnafi.Dengandemikianmaka ayatituditerjemahkanmenjadiAkubersumpahdenganharikiamatdanakutidak bersumpah dengannafs lawwamah. Dikalangan ahli tafsir, penafsiran dalam arti 48 terakhirinidipandangsebagai syadz,yaknimenyimpangdantidaklazim. Menurut Imam Fakhr alRazi, munasabah yamw alqiyamah dengan al nafsallawwamahsehinggakeduanyaperludisebutserempakadalahkarenahari kiamat itu sangat ajaib, dan salah satu maksud adanya hari kiamat adalah untuk menunjukkankeadaannafslawwamahitu,yaknikeberuntunganataukerugiannya pada hari itu. Sedangkan uslub qasam atas nafs lawwamah menunjuk pada 49 keajaiban nafsitudalammeresponperintahTuhan. Jadinafs lawwamah menurut alQur'an adalahnafs yang amat menyesali hilangnya peluang baik, dan untuk itu ia mencela dirinya sendiri. Nafs dalam tingkat ini merupakan keadaan batin yang bekerja mengawasi secara internal terhadap tingkah laku, satu kondisi di mana orangorang mukmin yang berada pada tingkat ini selalu mempertanyakan dirinya, mengkalkulasi amalnya serta mencela kesalahan yang terlanjur dilakukannya, baik perkataan maupun perbuatan.AbdullahYusufAlimembandingkantingkatannafslawwamahdengan 50 tingkatankatahati(conscience). c.AlNafsalMuthma'innah(JiwayangTenang) Ayat alQur'an yang secara tegas menyebut alNafs alMuthma'innah adalahsuratalFajr/89:2730:
...

?{$$s ZpD Zpu#u 7n/u 4n<) _$# pZyJJ9$# Z9$# $pkJ-r't LZy_ ?{$#ur t6
Hai jiwa yang tenang. Kembalilah kepada Tuhanmu dengan hati yang puas lagi diridhaiNya. Maka masuklah ke dalam jama'ah hambahambaKu, Masuklah ke dalam syurgaKu. (Q.s. al Fajr/89:2730)

Pengungkapan peringkat nafs al muthma'innah dalam alQur'an mengisyaratkan tentang adanya hubungan langsung antara pencapaian martabat muthma'innahdengantingkatkeimanankepada Allahdankarakteristikdarinafs tersebut.DariayatsuratalFajrdiatasdapatditarikpermasalahan(1)siapanafs

Ibid, Ibid 50 AbdullahYusufAli, TheMeaningofGloriuosQur'an,(Beirut:DaralKutubalLubnani, tth),h.1649


49

48

25

yang menjadi mukhathab dalam ayat tersebut, dan (2) kapan panggilan itu disampaikan. 1).NafsyangMenjadiMukhatab Surat alFajr/ 89: 2730 secara jelas menyebutkan bahwa yang dipanggil supaya kembali kepada Tuhannya, berkumpul bersamahambahambaNya danmasuk ke dalam sorgaNya adalah nafs, yaitu alnafs al muthma'innah. SebagaimanatelahdiuraikandibagiandepanbahwaalQur'anmenggunakannafs terkadang untuk menyebut totalitas manusia, dan terkadang hanya untuk menyebutsisidalamnyasaja. Menjawab tentang siapa nafs yang menjadi mukhatab, alZamakhsyari dalamTafsir alKasysyaf menyebutkan bahwa nafsdalam bukanlah sebagai substansi, tetapi nafs dalam arti orang mukmin yang jiwanya telah 51 mencapai martabat muthma'innah. AlMaraghi menafsirkan bahwa nafs dimaksudadalahnafssebagaisubstansi,yakninafsyangsudahmencapaitingkat yakin kepada kebenaran, yang sduah tidak tergoyahkan lagi oleh syahwat dan 52 kesenangan. Sedangkan Ibn Katsir mengutip pendapat para sahabat yang juga berbedabeda. Ibn 'Abbas misalnya berkata bahwa ayat itu berkenaan dengan 'Utsman ibn Affan, tetapi menurut Buraydah ibn alHasib ayat itu berkenaan denganpamanNabiHamzahibn'AbdalMuthalib,dandarisanadlainibnAbbas mengatakan bahwa panggilan alnafs al muthma'innah itu ditujukan kepada 53 semuaarwahyangmuthma'innahdiharikiamat. AlQur'an memang secara konsisten sering menyebut nafs secara mutlak seperti yangterdapatdalamayat (Q.s.alSyams/91:7),tapiditempat yang lain alQur'an menyebutkan sekaligus dengan sifatsifatnya seperti sifat ammarah, (Q.s. Yusuf/ 12:53), sifat lawwamah (Q.s. alQiyamah/ 75:2) dan Zakiyah(Q.salKahf/18:74)dan muthma'innah(Q.s.alFajr/89:27) Meskipun kata nafs juga mengandung arti sosok manusia, tetapi sebagaimana pandapat Fakhr alRazi, nafs dalam ayat ini jelas bukan dalam arti sosok manusia, karena sosok manusia itu bernama, sedangkan nafs itu anonym, sosokmanusia itubersifatfisik,padahalkeberdaan fisikterbatashanyadidunia, 54 tidak sampai masuk ke sorgaKu seperti yang terdapat dalam alFajr/ 89:30. Dengan demikian maka alnafs yang dipanggil dalam surat alFajr/ 89:27 ini bukan nafs dalam pengertian totalitas manusia jiwa dan raga, tetapi nafs dalam pengertiansubstansiyangbersifatrohani. 2).SaatDisampaikanPanggilan AlQur'an tidak memberikan isyarat tentang kapan panggilan ini disampaikan kepada manusia, apakah disampaikan ketika manusia menghembuskannafasnyayangterakhir(saatberpindahnyanafsdaribadan),atau pada hari kiamat nanti secara missal, ketika manusia bangkit dari "kuburnya",
Mahmud ibn Umar alZamakhsyari, alKasysyaf an Haqiqah alTanzil wa Uyun al QaqawilfiWujudalTa'wil,(tt:DaralFikr,tth),jilidIV,h.254 52 AhmatMushthafaalMaraghi,Op.cit,v.x.,h.154 53 Ismail Ibn Katsir alQurasyi al Dimasyqi, Tafsir alQur'an alAzbim (Beirut: dar al Ma'rifah,1987),volumeIV,h.545 54 ImamFkahralRazi,op.cit, h.177
51

26

akan tetapi. Fakhr alRazi dalam Tafsir alKabir nya mengutip pendapat ulama yangberpendapatbahwapanggilaninisebagaimanajugapendapatIbn"Abbasdi sampaikanTuhanketikaharikiamatnanti,sehinggaayat ,masuklahke dalam kelompok hambahambaKu, ditafsirkan dengan yangartinya,masuklahkamu(wahainafs)kembalikedalamtubuhyangengkau 55 telahkeluardaripadanya. Ibn Katsir mengutip hadits riwayat Ibn Jarir yang menyatakan bahwa ketika Sa'id ibn Jabir di dekat Rasul membaca ayat tersebut ( ) dan ketikaAbuBakarmemujinya,tibatibaRasulberkata (sesungguhnya malaikat akan mengucapkan kepadamu kalimat ini 56 ketikamautmenjemputmu). 3).KriteriaMuthma'innah Menurut kaidah tafsir, kandungan suatu ayat dalam alQur'an bisa diketahuidenganbeberapametode,antaralain: (1).Denganmencariketeranganpadaayatayatlain,sehinggakemudianalQur'an ditafsirolehalQur'an (2). Dengan mencari keterangan pada sunnah Rasul, sehingga kemudian Sunnah RasulituberfungsisebagaitafsirdarialQur'an (3).Disampinglangkahno.1danno.2diatas,jugadiusahakanmencaripendapat para sahabat nabi tentang maksud ayat tersebut. Metode ketiga ini lazim di sebuttafsirbialmatsur, (4)denganmenggunakankaidahkaidahkebahasaan,dan (5) dengan menggunakan analisis logika. Dua metode terakhir ini lazim disebut tafsirbialray Mthma'innah berasal dari kata yang artinya tenang setelah mengeluh dan gelisah, .Nafs muthma'innah dalam hal ini artinya 57 adalah jiwa yang tenang, karena ia mantap dan kuat ( ), setelah mengalamiproses interaksi dengan lingkungan yang membuatnya mengeluhdan gelisah.Maknamuthma'innahdalamkonteksalnafsalmuthma'innahdalamal Qur'an dapat diketahui maknanya dari keterangan yang ada pada ayatayat yang lain.JadidalamhaliniberlakutafsiralQur'anbialQur'an. Menurut alQur'an, jiwa yang tenang ditandai dengan halhal sebagai berikut: (1) memilikikeyakinanyangtidaktergoyahkanterhadapkebenaran sepertitersebutdalam Q.s.alNahl/16:106,karenatelah menyaksikan bukti buktikebenaranitu,sepertiyangdialamiolehpengikutpengikutNabiIsaa.s.

55 56

Ibid IsmailIbnKatsiralQurasyialDimasyqi,Op.cit. 57 AlRaghibalIsfahani, op.cit, h.317.lihatpulaImamFakhralRazi, Op.cit,h.176

27

$uhn=t tbq3tRur $uZtF%y| s% br& zNn=tRur $oY/q=% uKs?ur $pk]B @2'R br& R (#q9$s% tg9$# z`B
Merekaberkata:"Kamiinginmemakanhidanganitudansupayatenteramhati kamidansupayakami yakinbahwakamuTelahBerkatabenarkepadakami, dan kami menjadi orangorang yang menyaksikan hidangan itu". (Q.s. al Maidah/5:113) (2) Memilikirasaaman,terbesasdarirasatakutdansedihdidunia (Q.s.alNisa/4:103)danterutamanantidi akhirat(Q.s.Fushshilat/41: 30) (3) HatinyatentramkarenaselaluingatkepadaAllah (Q.s.alRad/13:28). Jadisifatorangyangjiwanyatelahmencapaitingkatmuthma'innahadalah hatinyaselalutentramkarenaingatkepadaAllah,yakinseyakinyakinnyaterdapat apa yang diyakininya sebagai kebenaran, dan oleh karena itu ia tidak mengalmi konflik batin,tidak merasacemasdantidakpula takut.Sifatataukondisi seperti inilah yangolehAbdullahYusuf AlidalamTheMeaningoftheGloriousQuran disebut sebagai puncak kebahagiaan bagi seorang mukmin (the final stage of 58 blessI. Term tuma'ninahdigunakanalQur'anbukanhanyadalamkonotasipositif, tetapi juga yang mengandung konotasi negative. Dalam surat Yusuf/ 10:7 misalnya disebutkan bahwa orang kafir yang tidak percaya akan adanya akhirat dan berpuas diri dengan kehidupan dunia juga disebut tuma'ninah, yakni tuma'ninah terhadapkehidupandunia( ). 4).HubunganDzikirdenganKetentramanJiwa Surat alRad/ 13:28, menyebutkan bahwa dengan mengingat (dzikir) kepadaAllahmakahatimenjaditentram( ).Dikalanganpenganut tarekat tasawuf, dzikir sebagai metode mencapai ketenangan hati dilakukan dengan tata cara tertentu. Di kalangan tarekat Naqsyabandiyah, dzikir dipahami dan diajarkan dengan mengucapkan kalimatkalimat thayyibah secara keras (dzikir jahr), dan dengan kalimatkalimat yang memfokus, dari kalimat syahdat LailahaillaAllahkelafzhAllahdansampaikelafazhhu.Tarekatlainadayang mengajarkan bukan hanya lafazh dzikir yang diucapkan tetapi juga disertai 59 dengangerakantertentu.
AbdullahYusufAli, op.cit, h.1735 DiTurkiterdapatseniyangberasaldaritarianparasufi,demikianjugasebagianTarikat Sufi di Mesir, melakukan tarian ringan disertai musik ringan dalam dzikirnya. Di Amerika Seraikat,anggotatarekatKhalwatiJarahijugamelaksanakandzikirdengannuansaseni.Menurut S.H.Nasr,parasufiadalahpengolahsenidalamkerangkamemancarkankeindahanTuhansebagai SenimanAgung.LihatS.HNasr,livingSufisme, danIsmailR.AlFaruqi,TheCulturalAtlasof Islam (NewYork,MMC,1986),h.298
59 58

28

Sebenarnya hubungan dzikir dengan ketentraman jiwa dapat dianalisis secara ilmiah. Dzikir secara lughawi artinya ingat atau menyebut. Jika diartikan menyebut maka peranan lisan lebih dominant, tetapi jika diartikan ingat, maka kegiatanberpikirdanmerasa(kegiatanpsikologis)yanglebihdominant.Darisegi inimakaadaduaalurpikiryangdapatdiikuti: (a).Manusiamemilikipotensiintelektual.Potensiitukecenderunganaktifbekerja mencari jawabatassemua hal yang belumdiketahuinya.Salahsatuhal yang merangsang berfikir adalah adanya hokum kausalitas di muka bumi ini. Jika seseorang melharikan suatu penemuan baru, bahwa A disebabkan B, maka berikutnya manusia tertantang untuk mencari apa yang menyebkan B. Begitulah seterusnya sehinggasetiapkebenaran yangditemukanolehpotensi intelektual manusia akan diikuti oleh penyelidikan berikutnya sampai menemukan kebenaran baru yang mengoreksi kebenaran yang lama, dan selanjutnyakebenaranyanglebihbaruakanditemukanmengoreksikebenaran yanglebihlama.Sebagaimakhlukberpikirmanusiatidakpernahmerasapuas 60 terhadap "kebenaran ilmiah" sampai ia menemukan kebenaran perennial. Melalui jalan supra rasionalnya. Jika orang telah sampai kepada kebenaran ilahiah atau terpadunya pikir dan dzikir, maka ia tidak lagi tergoda untuk mencarikebenaranyanglain,danketikaitujiwamenjaditenang,tidakgelisah dantidakadakonflikbatin.SelamamanusiamasihmemikirkanciptaanTuhan dengan segala hokumhukumnya, maka hati tidak mungkin tenteram dalam artitenteramyangsebenarnya,tetapijikaiatelahsampaikepadamemikirkan Sang Pencipta dengan segala KeagunganNya, maka manusia tidak sempat lagi memikirkan yang lain, danketika itulah puncak ketenangan dan puncak kebahagiaan tercapai, dan ketika itulah tingkatan jiwa orang tersebut telahmencapai alnafsalmuthma'innah. (b). Manusia memiliki kebutuhan dan keinginan yang tidak terbatas, tidak ada habishabisnya, padahal apa yang dibutuhkan itu tidak pernah benarbenar dapat memuaskannya (terbatas) Oleh karena itu selama manusia masih memburu yang terbatas, maka tidak mungkin ia memperoleh ketentraman, karena yang terbatas (duniawi) tidak dapat memuaskan yang tidak terbatas (nafsudankeinginan).Akantetapi,jikayangdikejarmanusiaituTuhanyang tidakterbataskesempurnaanNya,makadahaganyadapatterpuaskan.Jadijika orang telah dapat selalu ingat (dzikir) kepada Allah maka jiwanya akan tentram, karena "dunia" manusia yang terbatas telah terpuaskan oleh rahmat
Isitilah filsafat perennial (philosophia perennis) yang artinya filsafat keabadian sudah dikenalpadatahun1540,olehAgustinusSteuchus,tetapirealitasfilsfatpenenial,masihtertutup oleh alifan filsfat keduniawian di Barat. Bgi mereka yang menggeluti telaahtelaah tradisional, filsfat perennialmengandungarti sebagai kebenaran kekaldi pusat semua tradisi yang berkiatan dengan sanatana dharma, dalam agama hindu, dan alhikmah alkhalidah ata alhikmah al laduniyah dalam agama Islam. Filsafat perennial dimakud untuk menuntun manusia masa kini keluar dari kungkungan ketidakpedulian tempat dunia modern menemukan dirinya. Ia juga merupakansaluranbagisuatuberkahsesungguhnyayangmengungkapkansuatukerohanianyang hidupdibalikpemikiranpemikirandankatakatayangdiucapkansuatukerohanianyanghidupdi balik pemikiranpemikiran dan katakata yang diucapkan. Bagi mereka yang telah mendalami literature tasawuf. Pemikiran dalam filsafat perennial tidak terlalu asing. Lihat frithjof Schuon, IslamandthePerennialPhilosophy,(Teheran:WIFPUlishingCompanyLtd,1976)
60

29

Alah yang tidak terbatas. Hanya manusia pada tingkat inilah yang layak menerima panggilanNya untuk kembali kepadaNya, dan untuk mencapai tingkattersebut menurutalRazi hanya memungkinkan bagiorang yangkuat potensinya dalam berpikir ketuhanan atua kuat dalamuzlah dan kontemplasi 61 (tafakkur)nya. Jadialnafsalmuthma'innahadalahnafsyangtakutkepadaAllah,yakin akanberjumpadenganNya,ridhaterhadapqadlaNya,puasterhadappemberian Nya,perasaannyatenteram,tidaktakutdansedihkarenapercayakepadaNya,dan emosinyastabilsertakokoh. d.NafsAmmarah danKarakteristiknya Ketinggian dan kerendahan kualitas nafs diukur dengan tingkat hubungannyadenganTuhan.Nafskualitastinggi adalahnafs yangsudahsampai padatingkatdipanggilolehTuhanuntukkembalikepadaNyadengansenangdan diridhai, atau sekurangkurangnya menyesali diri karena kurang menggunakan peluang.Sedangkannafskualitasrendahditandaidengansifatsifat yangtercela. Ciriumumdari nafskualitasrendahmenurutalQur'anadaempat,yaitu(a)secara mudahmelanggarapaapayangdilarangAllah,(b)menurutdoronganhawanafsu, (c) menjalankan maksiat dan (d) tidak mau memenuhi panggilan kebenaran. SecaraeksplisitalQur'anmenyebutalNafsalAmmarahbialSu( ) sebagai nafs yang rendah kualitasnya. AlQur'an juga menyebut karakteristik karakteristikyangmenjadiindicatordari nafsammarahitu. Termnafsammarah secara implicitdisebutdalamalQur'ansuratYusuf/ 12:53denganungkapan alnafsalammarahbialsu.

n1u b) 4 n1u zOmu $tB w) q9$$/ 8ou$BV{ }Z9$# b) 4 tR ht/& !$tBur * Lm qx


Dan Aku tidak membebaskan diriku (dari kesalahan), Karena Sesungguhnya nafsu ituselalu menyuruhkepada kejahatan,kecuali nafsu yang diberi rahmat oleh Tuhanku. Sesungguhnya Tuhanku Maha PengampunlagiMahapenyanyang.(Q.s.Yusuf/12:53) Ayat ini turun dalam rangkaian kisah Nabi Yusuf a.s. khususnya dalam konteks Zulaykha, ibu angkatnya, yakni istri seorang menteri di negeri Mesir. Para mufasir berbeda pendapat tentang siapa yang mengeluarkan pernyataan itu, apakah Yusuf, atau Zulaykha. Perbedaan pendapat itu berakibat juga pada bagaimanamenafsirkanayatsebelumnya. JikakalimatitudiucapkanolehYusuf,makamaknaungkapandariayatitu adalah dapat dipahami sebagai berikut: Yusuf berkata "aku tidak mengingkari bahwa aku juga mencintai Zulaykha, karena sesungguhnya nafsu itu memang cenderung menyuruh perbuatan yang buruk, yakni zina. Untuk Tuhan
61

ImamFakhralRazi,op.cit, h. 177

30

menghindarkanakudarimelayanigodaanZulaykha,danTuhankumemangmaha PengampunlagiPenyayang. Tetapi jika kalimat itu diyakini sebagai katakata yang diucapkan oleh Zulaykha, maka ungkapan dari ayat tersebut adalah sebagai berikut: Zulaikha mengaku,"danakutidakmengingkaribahwaakumemangmerayuYusuf(seperti yang dikatakan oleh Yusuf), karena sesungguhnya nafs (saya, perempuan muda yang bersuamikan orang tua) itu meledakledak menuntut hubungan biologis, tetapiuntunglahTuhanmasihmenghindarkanakudariperbuatandosaitu,karena TuhanmemangMahaPengampunlagiMahaPenyayang. Jikadilihatsusunankisahdanmaknakalimat,makalebihlogiskalimatitu diucapkan oleh Zulaykha, tetapi penulis tidak bermaksud membahas perbedaan pendapat tersebut. Dari ayat tersebut yang penting dikaji sehubungan dengan tulisaniniialahapayangdimaksuddengannafsammarah,bagaimanakonsepal susertakarakteristikdari nafs tersebutdankapanrahmatTuhanitudiberikan. 1).Karakteristik NafsAmmarah Karenakonotasinegativeyangterbayangmakapenyebutannafsammarah dalam bahasa Indonesia menjadi nafsu amarah. Ada tiga kata yang harus diterjemahkandalampembahasanini,yaitu (nafs), (ammarah)dan (su). Secara lughawi, nafs artinya jiwa, ammarah artinya yang banyak menyuruh dan suartinyakeburukan,ataukejahatan.Jadi alnafsalammarahbialsuataudalam bahasa Indonesia sering disingkat menjadi nafsu amarah, adalahjiwa yang memilikikecenderungankepadakeburukan.DalambahasaArab,kalimatsuyang berasal dari kata dan mempunyai banyak arti, antara lain su bermakna (1) keburukan sebagai lawan dari hasan atau kebaikan, (2) penyakit belang,(3)segalamacambencanadanpenyakit,dan(4)sesuatuyangdipandang 62 buruk jika terjadi atau buruk akibatnya. Dalam konteks surat Yusuf/12:53, su dimaksudkan untuk menyebut dorongan hubungan kelamin. Jadi nafsu amarah dalam ayat ini dimaksudnya ialah nafs yang memiliki gejolak seksual, baik gejolak lelaki maupun perempuan secara alamiah memiliki keinginan yang kuat untuk menyalurkan tuntutan biologisnya berupa hubungan seksual. Dorongan kepadahubunganseksdalamperspektifinidipandangsebagaisesuatuyangalami menjadifitrahmanusia.Yusufyangmasih mudadipandangwajarjikaiatertarik kepada Zulaikha yang cantik danmenggoda, dan ZUlaykha yang masih muda 63 tetapisuaminya sudahtua,dan menurutsebagian mufasir menderita impotensi, adalah wajar jikan nafsnya bergelora setiap hari melihat yusuf, anak muda tampanyangtinggalserumah. Meskipun demikian, alsu sebagai suatu keburukan, walau merupakan fitrahmanusia,iatetapdilarang,danmanusiaharusmenghindarinya.Dalamayat tersebutdisyaratkanbahwadorongannafsuyangrendahinimemangsangatkuat, dan hanya orang yang menerima rahmat Tuhan yang dapat menghindari godaan itu.

62 63

IbnMunzhur, Op.cit,vol.III,h.21382140 ImamFakhrRazi,op.cit, juzXVIII,h.112

31

a.RahmatTuhankepadaNafs Hurufmadalamkalimat padasuratYusuf/12:53diatasadalah bermakna man, artinya orang. Jadi ada orang tertentu yang diberi rahmat Allah sehingga terhindar perangkap nafs ammarah. Kalimat itu dipahami oleh para mufasir dengan dua pemikiran. Pertama bahwa ada makhluk Tuhan yang dianugerahirahmatNyasehinggaselamanyaiatidakdapatdigodaolehdorongan nafsu seks karena diberi penjagaan secara abadi. Mereka adalah para malaikat, yakni mereka yang dibebaskan dari godaan syahwat. Kedua, yang memahami bahwayangdimaksuddenganseseorangyangterhindardarijebakannafsukarena rahmat Allah adalah orang mukmin yang setiap kali dilanda godaan, ia segera ingat kepada Tuhan, dan Tuhan kemudian menurunkan rahmaNya kepadanya 64 sehinggaiabisamenghindarkandiridarigodaanyangsedangmenggebugebu. b.KonsepalSu'(Keburukan) Pengertian nafsammarahbialsu'jikamerujukkepadasuratYusuf/12:53 mengandungartidorongannafsuseksual,tetapialQur'anmenggunakantermsu' juga untuk menyebut keburukan yang lain. Sekurangkurangnya alQur'an menggunakan predikat buruk atau alsu' pada limabelas hal di luar pengertian doronganseksual,yaitujalanyangburuk, (Q.s.alNisa/4:22),temanyang buruk (Q.s.alNisa/4:38),keputusanyangburuk, (Q.s.alAn'am/ 6:126), beban yang buruk (Q.S. Thaha/20: 101), tempat kembali yang buruk, (Q.s. alNisa/ 4:94), tempat tinggal yang buruk, (Q.s. alFurqon/ 25:66), giliran yang buruk, (Q.s. alFath/ 48:6), siksaan yang buruk, (Q.s.Ibrahim/14:6),rumahataukampung yangburuk, (Q.s alRad/ 13:25), perhitungan yang buruk, (Q.s. alRad/ 13:18) amalyangburuk, (Q.s.alMukmin/40:37),perbuatanserong (Q.s.Yusuf/12:25)rekayasajahat, (Q.s.Fathir/35:45)danperlindungan yangburuk (Q.salNisa/4:85) AlQur'an juga menggunakan kata su dalam berbagai kata bentukannya untuk menyebut penyakit (Q.s. alQashahshsh/ 28: 22), dosa, (Q.s. Hud/ 11:10), dan hukuman, (Q.s. alZumar/ 39:51) Daripenggunaankatasu'yangmengandungbanyakarti,makapengertian nafs ammarah dapat dirumuskan sebagai nafs yang memiliki kecenderungan kepadasegalahalyangburuk. c.KecenderunganNafsAmmarah Secara tersirat alQur'an menyebut banyak karakteristik buruk dari nafs yang dapat digolongkan dalam rumpun nafs ammarah. Secara umum nafs ammarah itu memiliki kecenderungan kepada semua halhal yang buruk. Secara

64

ibid

32

terperinci alQur'an menyebut jenis kecenderungan buruk itu, yaitu hasad, kecenderunganberbuatdosa,zalim,culas,mesum,sombongdankikir. 1).Dengki(alhHasad) TermhasaddisebutdalamalQur'ansebanyaklimakalidalamempatayat masingmasing surat Q.s. alBaqarah/ 2:109, Q.s. alFath/ 48:15, Q.s. alNisa/ 4:54 dan Q.s. alFalaq/ 113:5). Dalam bahasa Arab hasad artinya seseorang menginginkan hilangnya kesenangan yang dimiliki orang lain dan berusaha memindahkannyakepadadirinya,sebagaimanayangtersebutdalamlisanalArab 65 ( ). BahasaIndonesiamenggunakankatadengkidanriihati untuk menyebut hasad. Hasad atau dengki banyak sekali dibahas dalam hadits Nabimaupunliteratureakhlaktasawuf. SuratalBaqarah/2:109mengisyaratkanadanyakedengkianorangYahudi madinah terhadap orang Islam setelah mereka tahu bahwa Muhammad secara menyakinkanmemilikibuktibuktikenabian( ). Surat alnias/ 4:54, menyebutkan kedengkian orangYahuditerhadapNabiMuhammad( ),suratal Fath / 48: 15, mengisyaratkan adanya tuduhan dengki orang munafik Madinah terhadapNabidankaummusliminyangikutdalamperangKhaibar( ). Tingkatkeburukan hasad jugadisebutdalam haditsNabi yang mengumpamakan sifat hasad sebagai kekuatan perusah, seperti merusaknya api terhadap kayu 66 bakar, dan seperti gunting yang dapat mencukur amal, dan sebagai penyakit 67 umat. AlQur'an mengidentifikasi karakter hasad dengan ungkapan yang sama mengena.

$yg/ (#qmtt pthy N37? b)ur Ndss? puZ|ym N3|sC b)


Jikakamumemperolehkebaikan,niscayamerekabersedihhati,tetapijika kamu mendapat bencana, mereka bergembira karenanya. (Q.s. AlImran/ 3:120) DalamrangkaiankisahNabiYusuf,alQur'anjugamengisyaratkanadanya hasad pada saudarasaudara Nabi Yusuf karena ia lebih diperhatikan oleh ayahnya,sepertiyangdikisahkandalamsuratYusuf/12:817 DariayatayatalQur'anmaupundarihaditsNabidapatdirumuskanbahwa hasad atau dengki adalah perasaan iri pada seseorang terhadap keberuntungan yang dimiliki oleh orang lain disertai keinginan untuk menghilangkan keberuntunganitudanmemindahkannyakepadadirinya. PerasaandanperbuatansepertiitusecarajelasdicelaolehalQur'ansurat alNisa/4:32 (Danjanganlahkamuirihatiterhadap

IbnMunzhur, op.cit, jilidI,h.868 ) 67 ) (


66

65

33

apa yang dikaruniakan Allah kepada sebagian kau lebih banyak dari sebagian yanglain.) Sedangkaniri hatiterhadap hal yangdimilikiorang lain,tidaklahtercela, bahkan alQur'an menganjurkan manusia untuk berlomba memperoleh sesuatu yang diinginkan, seperti yang tersebut dalam suratalMuthaffifin/ 83: 26 dansuratalBaqarah/2:148 (1)Penyebab hasad MenurutalQur'an,adahalhalyangmenyebabkantimbulnyarasadengki pada manusia, yaitu (a) rasa permusuhan dan kebencian seperti yang disebutkan dalamsuratAliImran/3:118,(b)kagumdiridanmerendahkanoranglainseperti yangdisebutdalamsuratalZukhruf/43:31dansuratalMu'minun/23:33. (a)RasaPermusuhandanKebencian Surat alImran/ 3:118 secara tegas menyebutkan bahwa sebabsebab kedengkian orang Yahudi terhadap Nabi dan kaum Muslimin adalah rasa permusuhan dan kebencian. Dijelaskan dalam ayat itu bahwa kaum muslimin dilarang mengambil teman kepercayaan dari kalangan orang Yahudi Madinah ketika itu, karena mereka sudah menampakkan secara jelas kebencian mereka kepadakaummuslimin. (b).KagumdiridanMerendahkanOrangLain AlQur'an mengisyaratkan bahwa rasa dengki yang dimiliki oleh orang kafirQuraysyMakkahkepadaNabiMuhammaddanolehKaumAdkepadanabi Hudadalahdisebabkanoleh factorini, yakni merekakagumkepadadiri mereka sendiri sebagai orang kaya dan terhormat secara social sehingga mereka merasa lebih pantas menjadi pemimpin, sementara Muhammad hanyalah seorang yatim dan Miskin, yang menurut mereka tidak layak menduduki jabatan pemimpin. Dalam perasaan seperti inilah mereka berandaiandai sekiranya wahyu itu diturunkan kepada salah satu tokoh dari dua negeri Makkah atau Tha'if, bukan kepadaMuhammad,satuhalyangdinafikanolehkewenanganAllah.

tGts)9$# z`iB 9@_u 4n?t b#u)9$# #xyd tAhR wqs9 (#q9$s%ur


Dan mereka berkata: "Mengapa Al Quran Ini tidak diturunkan kepada seorangbesardarisalahsatuduanegeri(MekahdanThaif)ini......(Q.s.al Zuhruf/43:31)

o4qupt:$# NgoYt?r&ur otzFy$# !$s)=/ (#q/x.ur (#rxx. t%!$# mBqs% `B _|yJ9$# tA$s%ur tbq/un@ $JB Utour mZB tbq=.'s? $JB @.'t /3=WiB |o0 w) !#xyd $tB $uR9$#
Dan berkatalah pemukapemuka yang kafir di antara kaumnya dan yang mendustakan akan menemui hari akhirat (kelak) dan yang Telah kami mewahkan mereka dalam kehidupan di dunia: "(Orang) Ini tidak lain hanyalah manusia seperti kamu, dia makan

34

dari apa yang kamu makan, dan meminum dari apa yang kamu minum. (Q.s. al Muminun/23:33)

AlQur'an surat alHijr/15: 7 juga mengisahkan bagaimana orang kafir merendahkanparaNabi Muhammad,karenastatussocial Nabi yangtidaksetara denganstatussocialmerekasehinggamerekamenuntutagarrasulitubukanorang miskintetapimalaikat( ) (2).LogikaHasad Sebab mendasar dari timbulnya hasad atau dengki adalah perasaan bermusuhan, dan permusuhan itu timbul karena ada persaingan untuk memperebutkan obyek yang sama. Karena obyeknya satu dan berada dalam ruangan yang sempit, maka para pesaing yang memperebutkan obyek tersebut berkumpul berdesakan di dalam ruangan yang sama. Akibat dari ruang yang sempititumerekaharusberebut,bergesekandansalingmenjegal. Penyebab sebenarnya dari persaingan ini adalah karena pada dasarnya manusia menyukai kesempurnaan, dan lawan dari kesempurnaan (kalah) pasti tidak disukai. Puncak dari kesempurnaan yang didambakan ialah apabila seseorangmenjadisatusatunyapemilikkesempurnaanitu(menjadiorangnomor satu). Oleh karena itu, orang yang merasa telah menjadi satusatunya pemilik kesempurnaan itu memandang semua pesaing sebagai ancaman dan lawan. Demikian juga orang lain yang berkeinginan meraih kedudukan itu memandang orang yang telah mencapai tingkat itu sebagai lawan yang harus dimusnahkan, karenaiamenghalangikeinginannya. Tumbuhsuburnyaperasaandengkidiantaramanusiaadalahkarenaobyek yangdiperebutkanterlalusempitsehinggamerekaharusberdesakandidalamnya. Dalam perspektif ini, dunia dengan segala isinya adalah sempit, tidak mampu menampung keinginan semua orang. Oleh karena itu sifat dengki hanya muncul padaurusankeduaan,denganfokushartadankekuasaan( ). Adapun jika obyek yang diperebutkan itu luas, maka dengki tidak akan muncul, karena arena persaingan tidak ketat. Kehidupan akhirat dengan segala nilainilainyamerupakanlapanganyangluastidakterbatas,olehkarenaitutidak adaorangyangdengkidalammemperebutkankesempurnaanbidangini.Diantara orang yang ingin mencapai tingkat arif dan dekat (muqarrabin) dengan Tuhan, pasti tidak ada permusuhan dan dengki, karena ruangan untuk ma'rifat dan taqarrub kepadaNya tidaklah sempit. Meskipun obyek yang ingin dituju itu hanyasatu,yaituridhaAllah,tetapikarenaridhaAllahsangatluastidakterbatas, makabetapapunbanyakmanusiayangdapatmencapaitingkatitumerasacukup puas(radliyatanmardliyah)tanpatergangguolehjumlahpesaing,bahkansesama orang yang dekat dengan Tuhan terdapat rasa kemesraan yang luar biasa. Oleh karenaitudiantaraparaulamaarifintidakadapersainganuntukmenjadipemilik satusatunyakesempurnaan,karenahanyaAllahlahsatusatunyayangsempurna. Akan tetapi jika para ulama itu mengejar harta atau kekuasaan meski dengan bendera agama, maka persaingan dan benturan tidak bisa dihindari, dan tidak

35

mustahilhasadberkembangdiantaramereka,karenamedanhartadankekuasaan itusangatsempit. Dalam perspektifinidapatdipahamiketikaNabimenggunakanterm hasad yang tidak berkonotasi negatif, tetapi positif. Kata Nabi, iri dibolehkan kepada dua orang, yaitu (1) kepada orang yang dikaruniai banyak rizki tapi ia menggunakannya secara bertanggungjawab, dan (2) orang laim yang mengamalkanilmunyadanmengajarkannyakepadaoranglain.

Hasadtidakdiperbolehkankecualidalamduahalpertamairihatikepada seseorang yang dianugerahi Allah rizki banyak harta benda tetapi ia menggunakannya untuk kepentingan kebenaran, kedua iri hati kepada orangyangdianugerahiAllahbanyakilmu,daniamengamalkanilmunya danmengajarkannya(kepadaoranglain)(H.R.Bukhari). Harta atau pangkat, jika telah dimiliki oleh seseorang maka orang lain kehilangan peluang, dan selama hati orang itu dipenuhi oleh kesenangannya kepada harta itu maka ia tidak sanggup menampung keinginan orang lain. Akan tetapi jika hati seseorang dipenuhi oleh kegembiraan bermakrifat kepada Allah, maka hatinya tetap terbuka untuk menerima hati orang yang menginginkan hal yang sama. Terhadap mereka yang tidak lagi memiliki sifat hasad, alQur'an menyebutkan:

t,#7s)tGB 9 4n?t $Ruqz) @e@ `iB Ndr $tB $oYttRur


Dankamilenyapkansegalarasadendam yangberadadalamhatimereka, sedangmerekamerasabersaudaradudukberhadaphadapandiatasdipan dipan.(Q.s.alMaidah/5:30) b.MudahBerbuatDosa Diantara karakteristik nafs ammarah adalah mudah berbuat dosa. Al Qur'ansecaraimplisitmengisyaratkanadanyakarakternafsyangtidakraguragu dalammelakukandosabesar,dantidakmauberhentidarimelakukanhalhalyang dilarangTuhan.

s:$# z`B yxt6r's &s#tGs)s mzr& @Fs% mtR ms9 Mtqss


Maka hawa nafsu Qabil menjadikannya menganggap mudah membunuh saudaranya, sebab itu dibunuhnyalah, Maka jadilah ia seorang diantara orangorangyangmerugi.(Q.s.alMaidah/5:30)

36

AyatinidisebutdalamrangkaiankisahduaputraNabiAdam,yaituQabil danHabi.Dalamayat itudikisahkan bahwakurbanHabilditerimaTuhan,tetapi kurbanQabiltidak.Qabil merasa iri dandengki ataskeberuntungansaudaranya, dan didorong oleh rasa dengkinya ia mengancam akan membunuh Habil. Dari rangkaian ayatayat Q.s. alMaidah/ 5:2729 dapat dipahami bahwa ketika itu belumpernahadaperistiwakematian,apalagipembunuhan,sehinggamembunuh adalah satu hal yang belum terbayangkan. Habil yang diancam akan dibunuh, menurut ayatayat itu mengingatkan kepada Qabil bahwa membunuh itu perbuatandosa yangdilarangTuhan,tetapiQabil lebih mematuhinafsnya yang iri dan dengki sehingga ia memandang perbuatan membunuh itu sebagai perbuatanyangmudah,dandengantanparaguraguiamelakukannya. Rangkaian ayat itu mengisyaratkan adanya dua tipe kejiwaan yang kontras,jiwaQabildanjiwaHabil.Qabilmemilikitemperamenyangsangatlabil sehingga dengan cepat ia dapat mengambil keputusan untuk membunuh tanpa memikirkan dosa yang dilarang Tuhan, dan bahkan tanpa membayangkan apa yang harus dilakukan setelahitu. Sedangkan Habil justru sebaliknya. Ketika diancamakandibunuh, ia mengingatkankepadaQabilpangkalpersoalan,bahwa penerimaan kurban yang membuatnya iri dan dengki itu terpulang kepada keikhlasan orang yang berkurban, dan bahwa keberhasilan itu merupakan buah dari usaha masingmasing orang. Jiwanya yang halus menyebabkan ia tidak terpancing oleh ancaman, sebaliknya ia justru menyatakan tidak akan merespon perbuatan dosa (membunuh) itu dengan membalas atau melayani, sematamata karenaiatahubahwamembunuhituperbuatandosayangdilarangTuhan,dania merasatakutuntukmelanggarlaranganNya. Sosok kejiwaan Habil adalah orang yang berusaha mengendalikan nafs nyadengan memperhatikanpetunjukTuhan, sementaraQabil adalahorang yang tundukkepadadoronganhawanafsunyatanpamemperdulikanlaranganNya,dan bahkantanpasempatmembayangkanakibatlangsungdariperbuatandosanya. (1).KonsepDosa DalambahasaArab,dosadisebutdenganungkapan . Keempat term tersebut secara lughawi mengandung arti mengerjakan sesuatu 68 yangtidakdibolehkan( ). Dankeempattermtersebutdigunakan 69 semuanyadalamalQur'an. Selainitu,alQur'anmenyebutjenisperbuatandosa dengantermlain,yaitu sepertiyangdisebutdalamQ.s.alSyura/42:37, Q.salAraf/7:33)yang mengandungartiperbuatankeji, (Q.s.alNisa/4:112) yangberartikebohongan,dan yangartinyaperbuatanmenyembunyikan kesaksian(Q.s.alBaqarah/2:283). Term sendiri disebut dalam alQur'an sebanyak 48 kali dalam berbagai katabentukannya.Paramufasirberbedapendapattentangperbedaanmakna dan
IbnManzhur,Op.cit,jilidI,h.28 Term jirm dalam berbagai kata bentuknya disebut 66 kali,, misalnya pada Q.s. Thaha/ 20:73, Q.s. alAn'am/ 6:55, 147, term dzanbdzunub disebut 37 kali seperti pada Q.s. alAraf/ 7:100,Q.s.AlAnfal/8:5254,dantermmas'hiyahdisebut32kali,misalnyapadaQ.s.alTahrim/ 66:6,Q.s.alAhzab/33:36
69 68
--

37

Dalam konteks ayat 15 15 surat alNisa , fakhisyah dapat dipahami sebagai perbuatan keji yang berhubungan dengan penyimpangan seksualsepertiyangtersebutdalamsuratQ.s.alNisa/4:22,25,Q.s.alIsra/17:32, Q.salNaml/27:54danQ.s.alAnkabut/29:28,sementaraismdipahami sebagai perbuatan dosa yang berhubungan dengan minuman keras seperti yang terdapat surat alBaqarah/ 2:219 ( ) dan syirik seperti dalam surat alNisa /4:48 ( ). AlQur'an juga memberi sifat kepada dosa, seperti dosa besar, dalam surat Q.s. alBaqarah/2:219, Q.s. alSyuraa/42:37,Q.s.alNajm/53:32,dandosayangnyata dalamsuratQ.s alNisa/4:48,dosayangnyata dalamsuratQ.s.alNisa/4:20,50,112,dan Q.s alAhzab/ 33:58), dosa luar dan dosa dalam dalam surat Q.s al An'am/6:120. Jaditerm dalamalQur'andigunakanuntukmenyebutsemua jenisdosa besar,yangtampakmaupunyangdisembunyikan,yangberkaitandenganmanusia maupun dosa yang berkaitan dengan Tuhan. Sedangkan dosa kecil, alQur'an menyebutnyadengan istilahallamam( )seperti yangtersebutdalam suratal Najm/53:32. MenunjukkepadacontohkarakterQabil, makaorang yang memilikinafs ammarah dengan karakter ini ia tidak raguragu dalam melakukan dosa besar, tidak pula (apalagi) melakukan dosadosa kecil. Secara lebih rinci cirriciri nafs yangmudahmelakukanperbuatandosaitudiisyaratkanalQur'andengansebelas cirriyaitu: 1. Tidakmaumendengarkannasihat(Q.salmaidah/5:2729) 2. Patuhkepadabisikanhawanafsu( )(Q.salMaidah/5:30). 3. Tidak memperdulikan larangan Tuhan ( ) Q.s. al Jatsiyah/45:7) 4. Sukaberdusta( )Q.s.alNisa/4:20,112Q.sAlAhzab/33:58) 5. Sukabermusuhan( )Q.s.alMujadalah/58:8) 6. Sukamelakukanberbagiaperbuatandosa(Q.s.alFurqan/25:68) 7. Sukamelampaubatas( )(Q.s.alQalam/68:12) 8. Engganberbuatbaik( )(Q.salQalam/68:12) 9. Sukaberkhianat( )Q.s.alNisa/4:107). 10. Sukamenyembunyikankesaksian( )(Q.s.alBaqarah/2:283, Q.salMaidah/5:106) 11. Buruksangka( )(Q.salHujurat/49:12) d.BerbuatZalim Karakteristik keempat dari nafs ammarah adalah zalim. Dalam bahasa Indonesia, zalim digunakan untuk menyebut perbuatan aniaya atau sewenang

38

70 wenang. Dalam bahasa Arab, kalimat zhalim mengandung arti meletakkan sesuatu tidak pada tempatnya, .71 Penggunaan kata zalim pada manusia mengandung konotasi negative, yaitu melakukan sesuatu yang tidak seharusnya dilakukan. Pengertian yang mendasar dari kata zalim adalah menyimpang dan melampau batas. Dalam pengertian inilah maka orang Arab menyebut perbuatan melenceng ke kiri dank e kanan dari jalan yang sedang ditempuhjugadengankatazalim.Demikianjugaperbuatanmemeliharabinatang 72 buas(yangmembahayakanmanusia)jugadisebutdengankatazalim. Dalam alQur'an term yang menyebutkan kalimat zalim pada nafs hanya satuayat,yaitusuratYunus/10:54( )selebihnyabanyakayatyang menyebutbentukbentukkezaliman. Ayat itu diturunkan dalam rangkaian pernyataan Tuhan bahwa meskipun Rasul itu jelasjelas membawa kebenaran dari Tuhan tetapi orangorang zalim tetap saja tidak eprcaya, sampai mereka menyesali diri ketika mereka melihat siksaatdialamakhirat. SelanjutnyaalQur'anlebihbanyakmenyebutkonsepkonsepdanbentuk bentukkezaliman,antaralain: 1. Bahwa manusia suka berbuat zalim kepada diri sendiri (Q.s. alBaqarah/ 2:231,Q.salNaml/27:44,Q.salQashahsh/28:16) 2. Bahwa Allah tidak menzalimi manusia (Q.s. Hu/ii:101, Q.s AlZukhruf/ 43:26,Q.sAlImran/3:117,Q.salNahl/16:32) 3. Bahwadilarangpercayadancondongkepadaorangzalim(Q.sHud/11:113) 4. Bahwa orang yang dizalimi boleh membuka kezaliman orang yang menzaliminya(Q.s.alNisa/4:148) 5. Orang yang dizalimi boleh membela diri dengan angkat senjata melawan si zalim(Q.salHajj/22:39) Adapun bentukbentuk kezaliman yang disebut dalam alQur'an adalah sebagaiberikut: a. Perbuatan yang melampau batasbatas yang ditetapkan Allah (Q.s. al Thalaq/65:1) b. Syirik atau menyembah kepada selain Allah (Q.s alBaqarah/2:54, Q.s al An'am/6:82) c. Kufur(Q.salNisa/4:168) d. Melecehkan mu'jizat Nabi dan ayatayat Allah (Q.s alIsra/ 17:59, Q.s al Furqon/25:4) e. Mengikutihawanafsu tanpapijakanilmu(Q.salRum/30:29) f. Merugikanoranglainsecaramaterial(Q.salBaqarah/2:279) g. MengingkariayatAllah(Q.salA'raf/7:9) h. Melakukankejahatan(Q.salHajj/22:25) i. Curangdalamurusanharta(Q.salNisa/4:10) j. Perlakuantidakadil(Q.s.Thaha/20:112) k. BerdustadenganmengatasnamakanAllah(Q.salImran/3:94)

70 71

Depdikbud, KamusBesarBahasaIndonesia(Jakarta:BalaiPustaka,1994),cet.Ke3 IbnManzhur, op.cit, jilidIV,h.2756 72 Ibid,

39

l. TidakmenjalankanhokumAllah(Q.s.alMaidah/5:45) m. Mengangkatorangkafirsebagaipemimpin(Q.salTawbah/9:23) n. Engganbertaubat(Q.salHujurat/49:11) o. MelanggarperintahTuhan(Q.2:35) p. Mengusirorangdaritempattinggalnya(Q.salan'am/6:52) q. Nifaq(Q.alTaubah/9:47) r. Mencuri(Q.sYusuf/12:75) s. Menghalangiorangmenggunakanmasjiduntukzikir t. BerpurapuratidaktahuterhadapayatAllah(Q.salanbiya/21:140) u. Mendustakankebenaran(Q.salAnkabut/29:68) v. Tidakmensyukurinikmat(Q.sIbrahim/14:34 w. Tidakjujur/tidakamanah(Q.s.alAhzab/33:72). Disampingkatazhalimdalam berbagaikatabentuknya,alQur'an juga menyebut kalimat yang artinya kegelapan. Dalam bahasa Arab, antara kalimat zhulm (dalam arti menyimpang jalan) dengan zhulumat (dalam arti gelap) mempunyai hubungan arti, yaitu bahwa orang zalim itu seperti orang yang berjalan dalam kegelapan, sehingga ia menyimpang dari jalan yang seharusnya, atau menempatkansesuatutidakpadatempatnya. f.AlKhi'ah(culas) Karakter nafs ammarah berikutnya adalahalkhd'ah. Dalam bahasa Arab , artinya menempatkan orang lain pada posisi yang dikatakan, yang 73 sebenarnya berbeda dengan maksud yang disembunyikan. Menurut al Qadzdzafi,tandatandakhd'ah ituadatiga(1)tidaksegan melakukanperbuatan yangrenda,(2)mudahmemusuhiorang,(3)jikainginmenggapaisuatutujuan,ia menempuh dengan cara yang melingkarlingkar, yang merupakan perbuatan 74 makardantipuan. Katakhid'ahdapatditerjemahkankedalamBahasaIndonesia menjadi tipu daya, memperdayakan atau culas. Menurut Kamus Besar Bahasa Indonesia, culas itu mengandung pengertian curang, tidak jujur, tidak lurus hati. 75 Keculasanmengandungartipenuhkepalsuandanketidakjujuran. Isyaratadanyakeculasan nafsdapatdilihatpadasuratYusuf:18

#\Br& N3Rr& N3s9 Ms9qy @t/ tA$s% >4


Ya'qub berkata: "Sebenarnya dirimu sendirilah yang memandang baik perbuatan(yangburuk)itu(Q.s.Yusuf/12:18) Ayat ini disebut dalam rangkaian kisah Nabi Yusuf a.s. yaitu ketika saudarasaudaraYusufmerasairikepadanyakarenalebihdisayangolehayahnya (Nabi Ya'qub) mereka secara culas bersekongkol mengyingkirkan Yusuf dan melaporkan kepada ayahnya bahwa Yusuf meninggal dimakan serigala. Kisah keculasansaudarasaudaraYusuftelahdisebutkanterdahulupadauraiankarakter

AlRaghibalIsfahani, op.cit,h.144 RamadlanMuhammadalQadzdzafi,IlmalnafsalIslami(Tripoli:mansyurahShahifah alda'wahalIslamiyah,1990),cet.Ke1h.13 75 Depdikbud, op.cit h.198


74

73

40

hasad. Karakter khid'ah memang berada pada orang yang memiliki karakter munafikdan hasad. Karakteristik keculasan (alkhid'ah) diuraikan alQur'an dalam kaitannya dengan tingkah laku orang munafik yang menipu Nabi dan kaum muslimin dengan purapura beriman. Surat alBaqarah/ 2:13 secara berturutturut memaparkankarakteristikorangmunafiksecaraberturutturut: 1. Mereka mengaku berimana kepada Allah dan hari akhir, padahal sebenarnyatidak(Q.s.alBaqarah/2:8) 2. Padahakekatnyamerekamenipudirisendiri,bukanmenipuNabi(Q.s.Al Baqarah/2:9) 3. Penyebab kemunafikan mereka disebabkan adanya "penyakit" di dalam hatimereka(Q.salBaqarah/2:10) 4. Mereka selalu mengklaim bahwa mereka berbuat konstruktip, padahal yangsebenarnyamerekadestruktif(Q.salBaqarah/2:1112) 5. Mereka menilah bahwa iman kepada Allah tiu merupakan bentuk kebodohan (Q.s.alBaqarah/2:13) 6. Merekabermukadua(Q.s.alBaqarah/2:14) 7. Merekaterombangambingolehkeculasannya(Q.s.alBaqarah/2:15) 8. Mereka menjual barang berharga dengan bayaran yang tidak berharga (Q.s.alBaqarah/2:16) 9. Mereka mengalami kegelapan rohaniah sehingga mereka kebingungan (Q.s.alBaqarah/2:1720) Menurut Fakhr alRazi, orangorang munafik itu menipu Nabi dan kaum muslimindenganpurapuraberiman,dengantargettargetsebagaiberikut 1. Mengharapkan penghargaan sosial dari Nabi seperti yang diterima oleh kaummusliminlainnya 2. Dengan berdekatandenganNabidankaum muslimin, mereka mengharap menemukan kelemahankelemahan Islam, untuk disampaikan kepada musuhmusuhNabi 3. Menghindarkan diri dari ancaman serangan, karena adanya perintah al Qur'anuntukmemerangiorangyangbelumberiman 76 4. Mengharapmemperolehbagiandarirampasanperang(ghanimah) Karakteristik munafik itu oleh Nabi disebut dengan tiga tanda, seperti yang tersebutdalamhaditsriwayatBukhara:
-

Tandatanda orang munafik itu ada tiga yaitu (a) jika berbicara berdusta, (b)jikaberjanjiingkardan(c)jikadipercayakhianat.(H.R.Bukhari) f.Mesum MesumdalambahasaIndonesiasepertiyangtersebutdalamKamusBesar Bahasa Indonesia mengandung pengertian perbuatan tidak senonoh, tidak patut
76

ImamFakhralRazi,op.cit, jilidII,h.63

41

77 dancabul. Lazimnyaungkapantersebutdigunakanberhubungandengantingkah laku seks menyimpang. AlQur'an mengisyaratkan adanyamanusia yang tunduk kepada dorongan untuk hubungan seks dengan cara menyimpang, baik menyimpang dari norma hokum maupun menyimpang dari tatacara yang lazim. Dorongankepadatingkahlakumesuminimerupakansalahsatukarakteristikdari nafs ammarah. Kalimat dalam surat Yusuf/ 12:53 jika dilihat munasabahnyadenganayatayatlainyangmenyebutkanhubunganYusufdengan Zulaykha adalah hubungan dengan dorongan kepada perbuatan mesum. Surat Yusuf/12:23 misalnya mengambarkan betapa kuatnya dorongan untuk berbuat mesumhinggamengalahkankejernihanakalseseorang.

|Myd Ms9$s%ur Uuq/F{$# Ms)=yur mR `t $ygFt/ uqd L9$# m?yuruur cqJ=9$# x= w mR) ( y#uqWtB z`|mr& n1u mR) ( !$# s$ytB tA$s% 4 s9
Danwanita(Zulaikha) yangYusuftinggaldirumahnya menggodaYusuf untuk menundukkan dirinya (kepadanya) dan dia menutup pintupintu, serayaberkata:"Marilahkesini."Yusufberkata:"Akuberlindungkepada Allah, sungguh tuanku Telah memperlakukan Aku dengan baik." Sesungguhnya orangorang yang zalim tiada akan beruntung. (Q.s. Yusuf/12:23) Dalam bahasa Arab, kalimat mengandung arti usaha berulang ulang dan lemah lembut kepada orang untuk melakukan sesuatu yang tidak 78 dikehendakiolehorangitu,dengancaracaratipuandankecurangan. Sedangkan kalimat dalam bahasa Arab bermakna yang merupakan bentuk kata 79 ajakanyangdipenuhidengannuansaperasaanmalu. RangkaiankisahYusufpadaayatayattersebutmenceritakanbahwaYusuf yang memiliki kejujuran dan kesetiaan kepada tuannya (alAziz) tidak membayangkan dalam dirinya untuk membalas kebaikan tuannya dengan melayani godaan Zulaykha, istri tuannya Zulaikha merayu yusuf bukan hanya dengan ajakan, tetapi juga dengan meniupkan logika bahwa Yusuf yang hanya seorang anak angkat yang berasal dari budak yang dibeli harus mematuhi kemauantuanputrinya. TentanghubungancintaYusufZulaykha,Q.s.Yusuf/12:24menyebutkan.

77 78

Depdikbud, op.cit,h.651 AlRaghibalIsfahani,Op.cit,h.212 79 IbnManzhur,op.cit,jilidVI,h.4731

42

mZt t$uZ9 y79x2 4 mn/u z`yd/ #u br& Iwqs9 $pk5 Nydur ( m/ MJyd s)s9ur n=J9$# $tR$t6 `B mR) 4 u!$tsx9$#ur uq9$#
SesungguhnyawanitaituTelahbermaksud(melakukanperbuatanitu)denganYusuf,dan Yusufpun bermaksud (melakukan pula) dengan wanita itu Andaikata dia tidak melihat tanda(dari)Tuhannya.Demikianlah,agarkamimemalingkandaripadanyakemungkaran dankekejian.SesungguhnyaYusufitutermasukhambahambakamiyangterpilih.(Q.s. Yusuf/12:24)

Kebanyakan mufasir membedakan makna dan pada surat Yusuf/12:24. Kalimat pertama dipahami bahwa Zulaykha memang memendam cintabirahikepadaYusuf,yangolehkarenaituiamerasasangatkesaldanmerasa terhina ketika Yusuf menolak rayuannya. Sedangkan kalimat yang kedua ( ) dipahami bahwa Yusuf merasa kesulitan menghindar dari jeratan godaan Zulaykha.Hanyasedikitmufasiryangmengartikansamakalimathammatbihi dan hamma biha, yakni bahwa baik Yusuf maupun Zulaykha keduanya dilanda asmara,hanyasajaYusufdijagaTuhan,sedangkanZulaykha,karenaiamemiliki 80 jiwamesumjustrumenurutidoronganpenyimpangannya. Tingkah laku seks menyimpang bukan hanya penyimpangan dari kelaziman norma hokum (perzinahan), tetapi juga dari kelaziman teknis. Jika sekarangmasyarakatmengenaltingkahlakuseksmenyimpangberupasekssejenis atau homo/lesbi, sodomi dan seks sadis, alQur'an juga telah mengisyaratkan bahwa masyarakat pada zaman Nabi Luth juga telah melakukan penyimpangan kehidupan seksual seperti yang disebut dalam surat alAraf/ 7:8081. Pandangan bahwa penyimpangan kehidupan seksual itu bersumber dari nafs atau jiwa, diperkuat oleh pendapat para ahli ilmu jiwa modern. Pada zaman modern sekarang, kehidupan seksual menyimpang terungkap secara jelas dan sangat beragam, sebagian orang memandangnya sebagai kewajaran, tetapi para ahli memandangnya sebagai penyakit dan gangguan kejiwaan. Zakiah Daradjat, misalnya mengkategorikan tingkah laku seks menyimpang sebagai gangguan 81 jiwa. i.Sombong(Takabbur) Diantara karakter nafs ammarah adalah sombong atau takabbur. Konsep takabbur dalam alQur'an berpusat pada konsep hubungan manusia sebagai makhluk (yang kecil) dengan Tuhan sebagai Sang Pencipta (Yang Maha Besar). Sifat takabbur jika dihubungkan dengan Tuhan maka hal itu tidak berkonotasi negative, karena takabbur bagi Tuhan memang sesuai dengan kebenaran dan kenyataan, oleh karena itu dalam alQur'an juga disebutkan bahwa salah satu namadari adalah sepertiyangtersebutdalamsuratalHaysr/59:23 ( ). Dalam konteks Tuhan, almutakabbir
Imam Fakhr alRazi, op.cit, juz XVIII, h. 114120. lihat pula Ahmad Mushthafa al Maraghi, op.cit jilidIV,h.131 81 ZakiahDaradjat,KesehatanMental (Jakarta:CV.Masagung,1980),cetke20
80

43

82 mengandung arti yang memiliki keagungan dan kekuasaan ). Adapun manusiayang memiliki status sebagai hama Allah pastilah tidak besar, oleh karena itu, sombong, membesarkan diri atau takabbur yang ada pada manusiamerupakansifatterceladantidaksesuaidengankenyataan. Dalam bahasa Arab, kalimat mempunyai arti yang berdekatan, dan alQur'an menggunakan ketiga kalimat itu. Dalam surat al Mu'min/40:56disebutkanbahwadidalam"dada"manusiaadakibr( ). Kibr dalamayatinidihubungkandenganmanusiayangmemilikisifat (ujub), kagum diri, sehingga mereka memandang rendah orang lain (Nabi) yang membawakebenaran,danolehkarenaitumerekaberanimenentangdakwahNabi 83 (ayatayat Allah), meskipun mereka tidak memiliki argument yang memadai. PUncak takabbur adalah takabbur kepada Tuhan, yakni menolak menerima kebenaran dari Alah dan menolak perintahnya seperti yang dilakukan Iblis, 84 tersebutdalamsuratalBaqarah/2:34( ). Kesombongan manusiapadaumumnya berhubungandengan statussocial tinggi, yang dimiliki oleh mereka, satu sikap yang menyebabkan mereka memandang rendah orang lain yang status sosialnya lebih rendah, termasuk kepada nabi dan Rasul yang berasal dari kalangan status social rendah. 85 86 Kesombongan jenis inilah yang dimiliki Fir'aun dan kaumnya Nabi Shalih 87 sertakaum'AddanTsamud. Kesombongantingkahlakubersumberdari nafsyangsombong.Padasurat alFurqon/25:21diungkapkan karakteristikkejiwaandariorangyangsombong.

3 $oY-/u 3ttR rr& ps3n=yJ9$# $uZn=t tAR& Iwqs9 $tRu!$s)9 cq_t w t%!$# tA$s%ur * #Z7x. #vqG qtGtur NgRr& (#ry93tG$# s)s9
Berkatalah orangorang yang tidak menantinanti pertemuan(nya) dengan Kami: "Mengapakah tidak diturunkan kepada kita malaikat atau (mengapa) kita (tidak) melihat Tuhan kita?" Sesungguhnya mereka memandang besar tentang diri mereka dan mereka benarbenar Telah melampauibatas(dalammelakukan)kezaliman".(Q.s.alFurqon/25:21) j.Kikir Kikir merupakan salah satu karakter dari nafs ammarah. AlQur'an menggunakantermdalammenyebutsifatkikir,yaitu .Dalambahasa Arab, term bukhlbakhil dan syuhhsyahih menunjuk pada perbedaan tingkat
IbnManzhur,Op.citjilid5,h.3807.lihatpulaIsmai'ilIbnKatsiralQurasyialDimasyqi, op.cit jilidIV,h.367 83 Isma'ilIbnKatsiralQurasyialDimasyqi,op.cit.h.91 84 LihatpulaQ.s.alBaqarah/2:76,Q.salAraf/7:40danQ.salJatsiyat/45:31 85 LIhat.Q.salAnkabut/29:39dansuratQ.s.AlMu'minun/23:46 86 LIhatQ.s.alA'raf/7:75dan77 87 LihatQ.s.Fushshilat/41:15dan17
82
--

--

44

kekikiran. Bakhil adalah lawan dari yang artinya pemurah. Orang bakhil adalah orang yang menggenggam eraterat hartamiliknya dan sama sekali tidak maumemberikankepadaoranglainsampaipadabarangbarangyangsudahtidak dibutuhkannya.Sedangkankikirpadatermsyuhhsyahihmengandungkadaryang 88 lebihtinggi,yaitukikiryangdisertaiketamakan. disampingalbukhldansyuhh, alQur'an dalam surat alIsra/ 17:100 juga menggunakan term qatur ( ). Term qatur dalam Bahasa Arab mengandung arti kikir dalam pengertian 89 berat mengeluarkan uang untuk keperluan sebagai lawan dari boros. Dalam perspektifalQur'an,kikiradadua macam,pertama,kikir atas milik sendiri,dan kedua kikir atau milik sendiri dan milik orang lain. Orang bakhil tipe kedua tersebut menurut surat alNisa/ 4:3637 memiliki kecenderungan sombong, membanggakan diri dan menyebarluaskan kekikiran. Ia bukan hanya tidak malu memilikisifatkikir,tetapimalahmengajakoranglainuntukkikir( ).Iamerasasenangjikaorang lainkikir,dantidak sukakepadaorang yang memilikisifatpemurah meski iatidakdirugikan sedikit pun. Dalam perspektif alQur'an, kekikiranmerupakan tabiat manusia, dan bahkan sifat itu melekat di dalam jiwanya, seperti yang tersebut dalam suratal Nisa/4:128 (bahwa manusia itu menurut tabiatnya kikir). Sebagaimanahalnyanafsitubisadisucikan,demikianjugasifatkikirbisaditekan danbahkanbisadiubah.HaditsRasulullahmengisyaratkanbahwasifatkikirtidak membahayakan sepanjang tidak dipatuhi. Kekikiran yang merusak adalah kikir 90 yang dipatuhi . AlQur'an surat alNisa/17:100 mengingatkan bahwa seandainya seluruh perbendaharaan bumi ini telah dikuasai, terasa belum mencukupi,karenapadadasarnyamanusiaitubertabiatamatkikir:

tb%x.ur 4 -$xRM}$# spuyz L3|B`{ #]) n1u pyJmu t!#tyz tbq3=Js? NFRr& q9 @% #YqGs% `|RM}$#
Katakanlah: "Kalau seandainya kamu menguasai perbendaharaan perbendaharaanrahmatTuhanku,niscayaperbendaharaanitukamutahan, Karena takut membelanjakannya". dan adalah manusia itu sangat kikir. (Q.s.alIsra/17:100)

88 89

AlRaghibalIsfahani, op.cit,h.35dan262 Ibid, h.407 90 Lihattekshaditspadacatatankakino.40daribabini

)(

45

NAFS(JIWA)MENURUTKONSEPALQURAN( BABII)
OLEHJAMRIDAFRIZAL,S.Ag.,M.HUM

PENGGERAKTINGKAHLAKUDALAMSISTEMNAFS A.MaknaPenggerakTingkahlaku Setiap manusia yang normal, setiap kali melakukan perbuatan memilikitujuanyangingindicapai.Tidakadaorangyangmelakukansuatu pekerjaan jika tidak ada tujuan yang ingin dicapai dengan perbuatan itu. Pekerjaan sama yang dikerjakan oleh banyak orang belum tentu memiliki tujuan sama. Orang bisa berbedabeda dalam sebagian tujuan yang ingin dicapai, tetapi mereka mungkin sepakat pada tujuan yang lain. Tujuan tujuanituseringkalihanyasepakatpadatujuanyanglain.Tujuantujuanitu seringkali hanya bersifat permuasan kebutuhan biologis, dan seringkali pemuasankebutuhanpsikologis,ataubisajugauntukpencapaiannilainilai tertentusesuaidenganpekerjaanyangdilakukannya. Tingkahlaku manusiatidak mudahdipahami tanpa mengetahuiapa yangmendorongnyamelakukanperbuatantersebut.Manusiabukanboneka yang digerakkan dari luar dirinya, tetapi di dalam dirinya ada kekuatan yang menggerakkan sehingga seseorang mengerjakan suatu perbuatan tertentu. Faktorfaktor yang menggerakkan tingkah laku manusia itulah yang dalam ilmu jiwa disebut sebagai motif. Motif (motive) yang berasal dari kata motion, memiliki arti gerakan atua sesuatu yang bergerak. Menurut istilah psikologi mengandung pengertian penyebab yang diduga untuk suatu tindakan suatu aktivitas yang sedang berkembang, dan suatu 1 kebutuhan. Dalam bahasa Arab, faktorfaktor penggerak tingkah laku itu disebut yang artinya dorongandorongan yang bersifat 2 psikologis. Bukubukupsikologipenuhdenganpembicaraantentangpembagian motif. Sebagian pakar psikologi berbicara tentang motif utama yang tersembunyi di balik ativitas seseorang, sebagaian berbicara tentang motif untuk aktualisasi diri, sebagian lagi berbicara tentang motif pemeliharaan diri dan yang lain menyebut motif penghargaan diri. Ada juga pakar

Philip R. Harriman, Handbook of Psychological Term, terjemahan bahasa IndonesiaolehM.W.Husodo,denganjudulPanduanUntukMemahamiIstilahPsikologi, (Jakarta:RestuAgung,1995),h.147 2 RamadlanMuhammadalQadzdzaf,IlmalNafsalIslami(Tripoli:Mansyuratal ShahifahalDawahalIslamiyah,1990),cet.Ke1h.39

psikologi yang membagi motif menjadi dua kelompok, yaitu motif primer 3 danmotifsekunder. Yang dimaksud dengan motif primer adalah motif yang berkaitan denganstrukturorganictubuhmanusia,sepertimotifkepadaudara,kepada gerakan, kepada makanan minumandi manaterdapatsejumlah motifyang mendorong seseorang untuk mencari jenisjenis makanan. Para ahli juga menempatkanmotifseksualdalamkelompokmotifprimer.Motifprimerini bersifatnaluriah,tidakdipelajariataudiperolehseseorang,tetapidiciptakan bersama dengan penciptaan awal (fitrah) manusia, sehingga motif primer 4 jugadisebutmotiffitri. Sedangkan motif sekunder adalah motif yang sampai sekarang belum dipastikan hubungannya dengan struktur organik,tetapi ia dibatasi olehjenisaktivitasseseorang.Berbedadenganmotifprimeryanguniversal, motifmotifsekunder manusiaberbedabedasesuaidenganbudayadimana merekahidupdanjenisjeniskegiatanapayangdilakukanseseorangdalam hidupnya. Di Antara motif sekunder antara lain motif persaingan, motif kejayaan, motif kebebasan, motif kerjasama, motif untuk masuk ke dalam suatu golongan dan sebagainya. Dimsaping pembagian dikotomis primer sekunder,adapakarpsikologiyangmembagimotifmenjaditigakelompok, 5 yaitumotifbiologis,emosidannilainilai. 1.HubunganPenggerakTingkahLakudenganTujuan Motif dapat disimpulkan sebagai kedaan psikologis yang merangsang dan memberi arah terhadap aktivitas manusia. Motif inilah kekuatan yang menggerakkan dan mendorong (faktor penggerak) aktivitas seseorang, yang membimbingnya ke arah tujuantujuannya. Tujuan dan aktivitas seseorang selalu berkaitan dengan motifmotif yang menggerakkannya. Sedangkan tujuan adalah apa yang terdapat pada alam sekitaryangmengelilingiseseorang,yangpencapaiannyamembawakepada pemuasan motif tertentu. Air adalah tujuan orang haus, makanan adalah tujuan orang lapar. Gengsi adalah tujuan dari orang yang membutuhkan harga diri. Jadi motif bekerja seringkali untuk pemuasan kebutuhan fisik seperti lapar, haus, lelah atau pemuasan seksual, oleh para ahli psikologi disebutmotifprimer,danseringkaliuntukmemenuhipemuasankebutuhan sosialyangmunculdalambentukkecenderunganataukesenangantertentu, seperti cinta diri atau ingin memiliki supremasi dan dominasi atau untuk
3

Malnda Jo Levin, Psychology A.Biographical Approach(NewYork:Mc.Graw HillbookCompany,1985),h.159197.lihatpulaSarlitoW.Sarwono,PengantarUmum Psikologi(Jakarta:BulanBintang,1991),h.5669 4 Hasan Langgulung , Teoriteori Kesehatan Mental, Perbandingan Psikologi ModerndanPendekatanPakarpakarPendidikanIslam (Selangor:PustakaHuda,1983), cet.Ke1,h.4146 5 Ibid

mempertahankan kedudukan sosialnya dan sebagainya, disebut motif sekunder.Darisinijelaslahbahwatujuanberkaitaneratdenganmotif. Di samping istilah motif, dikenal pula istilah motivasi. Motivasi merupakanistilahyanglebihumum,yangmenunjukkepadaseluruhproses gerakan yang melahirkan tingkah laku, termasuk situasi yang mendorong, dorongan yang timbul dalam diri individu, tingkah laku yang ditimbulkan oleh situasi tersebut dan tujuan atau akhir dari perbuatan yang dilakukan. Dalam Kamus Psikologi dijelaskan bahwa motivasi (motivation) adalah perangsang, baik intrinsik maupun ekstrinsik yang memprakarsai dan mendukungsikapaktivitasyangadasuatukonsepyangkompleksdandwi fungsi untuk menunjukkan (biasanya) tingkah laku yang didorong kearah 6 tujuan. Pengetahuan tentang motif dari perbuatan manusia sangat penting untuk memahami tingkah laku mereka, karena satu perbuatan yang dilakukanolehduaorangbelumtentusatumakna. 2.FungsiPenggerakTingkahLaku Manusia ketika melakukan perbuatan, disadari atau tidak oleh yang bersangkutan, sebenarnya apa yang dilakukannya itu digerakkan suatu sistem di dalam dirinya, yakni oleh sistem nafs. Di samping mampu memahami dan merasa, sistem nafs juga mendorong manusia untuk melakukan sesuatu yang dibutuhkan. Jika penggerak tingkah laku atau motif kepada sesuatu itu telah mulai bekerja secara kuat pada seseorang, maka ia mendominasi orang itu dan mendorongnya melakukan suatu perbuatan.Ketikamotifkepadasesuatuitubekerjapadapuncaknya,ketika ituorangtidaklagibebasuntuk mengarahkanataumengendalikantingkah lakunya, karena ia harus memenuhi tuntutan motif itu dalam memperoleh pemuasannya. Dalam keadaan seperti ini seseorang seperti didesak untuk secepatnya mencapai tujuannya tanpa memperdulikan risiko atau akibat samping dari perbuatannya. Dalam merespon dorongan dari dalam dirinya itu manusia ada yang sanggup mengendalikannya secara proporsional sehingga motifnya memperoleh pemuasan tetapi tingkah lakunya tetap dapat dipertanggungjawabkan. Di sisi lain ada orang yang tidak mampu mengendalikan dorongandorongan itu sehingga hal itu dapat menghilangkan keseimbangan kepribadian, atau menimbulkan keguncangan dan juga membuat seseorang tidak mampu melihat masalah secarateliti. Isyaratisyarat tentang adanya faktor penggerak tingkah laku dalam alQuranakandibahasdalamuraianselanjutnya. 3.PersonivikasiPenggerakTingkahLaku
6

PhilipL.Harriman.Loc.cit

Dalamsystemnafs,motifitubersifatfitri,dalamartibahwamanusia memiliki kecenderungankecenderungan dan potensipotensi yang berlaku secara unvirsal, meski setiap orang memiliki keunikan pada dirinya. Di dalam system nafs juga terdapat naluri instink yang memiliki kecenderungankecenderungan tertentu, yang dalam bahasa Arab disebut . Secara lugawai, gharizah artinya sesuatu yang masuk. Orang Arab menggunakan kata ghazirah ini untuk menyebut tabiat, tabiat buruk maupun tabiat baik. Umar ibn Khattab misalnya pernah mengutip sabda Nabi yang mengatakan bahwa sifat pengecut dan sifat pemberani itu 7 sebagai ghazirah ( ). Dorongandorongan nafs itu ada yang disadari. Dorongan akan kebutuhan yang ada dalam instink tidak tampak dalam bentukyanglangusnddapat dilihatolehmata, karenaia merupakan integrasi dari faktorfaktor yang ada dalam system yang saling berkaitan, yang baru tampak jika ada stimulus tertentu. Jika manusia menjumpai stimulustertentumakamotifmendorongnyauntukmerespondenganrespon tertentu pula, dan kapasitas responitu sesuai dengan besar kecilnya tataran motif. Jika tujuan tercapai maka motif mengendor, tetapi jika agar maka motif tidak hentihentinya bekerja mendorong manusia untuk melakukan perbuatanyangdiperlukan.Padaorangtertentusemakinsulittujuandicapai mak asemakin besar pula motif mendorong untuk melakukannya. Kesungguhan seseorang dalam mencapai tujuan adakalanya justru meningkatketikatantangannyabesar. Isyarat tentang adanya penggerak tingkah laku manusia dalam system nafs dipaparkan alQuran dalam surat Yusuf/ 12: 53, surat al Baqarah/2:30dansuratalNisa/114:45 !$tBur ht/& tR 4 b) }Z9$# 8ou$BV{ q9$$/ w) $tB zOmu n1u 4 b) n1u qx

Lm
Dan Aku tidak membebaskan diriku (dari kesalahan), Karena Sesungguhnya nafs itu selalu menyuruh kepada kejahatan, kecuali nafsu yang diberi rahmat oleh Tuhanku. SesungguhnyaTuhankuMahaPengampunlagiMahapenyanyang.(Q.s.Yusuf/12:53)

Surat Yusuf/ 12:53 diatas, secara jelas mengisyaratkan adanya sesuatu di dalam system nafs yang menggerakkan tingkah laku, dalam konteksayatinipenggeraktingkahlakukejahatan( ).Secara rinci,ayattersebutdiatasmengisyaratkanadanyatigahal. 1). Bahwa di dalam system nafs manusia ada potensi yang menggerakkannya pada tingkah laku tertentu. Dalam ayat ini tingkah
7

IbnManzhur,LisanalArab,(tt:DairahalMaarif,tth),jilidV,h.32393240

laku yang dicontohkan adalah tingkah laku keburukan atau pada selera rendah, yakni bisikanbisikan yang datangnnya dari dalam diri sendiri untuk melakukan perbuatan yang memberi kepuasan tetapi buruk nilainya. 2).Meskipunmanusiamemilikikecenderungankepadakeburukantetapidi sisinya dibuka pintu rahmat yang mengisyaratkan bahwa manusia jika mau, bisa mengendalikan kecenderungankecenderungannya, menekan dorongandorongannya dan bisa juga tidak memenuhi dorongan buruk itu. Meskipun manusia memiliki dorongandorongan negatif, tetapi ia tidak harus memenuhinya, sebaliknya dengan akalnya ia bisa memilih manayangbaikdanbergunauntukdirinyadanuntukoranglain. 3) Pengertian rahmat Allah pada ayat ini harus dipahami bahwa Tuhan menciptakan manusiadengan keseimbanganpotensipotensipositifdan potensi negatif sekaligus di mana manusia diberi peluang untuk memilih. Manusia bisa menunda tuntutan selera rendahnya dengan kegiatan yang bia melemahkannya, yaitu kegiatan pada bidangbidang kebaikan, atau mengalahkannya sekaligus dengan kegiatan yang konstruktif.
)ur tA$s% /u ps3n=yJ=9 oT) @%y` F{$# Zpx=yz ( (#q9$s% @ygrBr& $pk `tB $pk
.....

7our u!$tBe$!$# `twUur xm7|R x8Jpt2 ds)Rur y7s9 (

Artinya: Ingatlah ketika Tuhanmu berfirman kepada para malaikat: "Sesungguhnya Aku hendak menjadikan seorang khalifah di muka bumi." mereka berkata: "Mengapa Engkau hendak menjadikan (khalifah) di bumi itu orang yang akan membuat kerusakan padanya dan menumpahkan darah, padahal kami senantiasa bertasbih denganmemujiEngkaudanmensucikanEngkau......(Q.salBaqarah/2:30)

Dalam ayat ini malaikat mengisyaratkan bahwa pada dasarnya manusiamemilikiinstinkataunalurimerusak,meskipunmanusiamemiliki predikat khalifah di bumi. Sebagian mufasir memahami makhluk yang disebut karakteristiknya oleh malaikat itu bukan Adam, tetpaimakhluk sebelumnya dari bangsa jin, sebagaimana mufasir lain menunjuk pada anak cucu Adam, tetapi alMaraghi mengutip penafsiran mutakhir yang menyebutkan bahwa dialog malaikat dengan Tuhan itu lebih bermakna isyarat, bukan pada makna lahir, karena malaikat tidak memiliki tabiat 8 menentangkepadTuhan. Pertanyaan malaikat yang terkesan kurang sopan, menurut al Maraghi,bukansebagaiinformasi,tetapidialogitumerupakanmetodedan danmodelpenyampaianpetunjukalQuran kepada manusia.Kesimpulan
8

AhmadMushthafaalMaraghi,TafsiralMaraghi,(tt:DaralFikr,tth),jilidI,h.

7779

dari pesan dialog itu dijawab dengan pembuktian bahwa Adam ternyata berbeda dengan yang diduga oleh para malaikat seperti yang dapat 9 dipahamidarimunasabahnyadenganayatselanjutnya(ayat3133). Kesan tidak sopan pada pertanyaan malaikat itu sebenarnya berangkat dari penafsiran kalimat . Terjemah alQuran terbitan Departemen Agama R.I. menerjemahkan kalimat tersebut dengan mengapa engkau hendak menjadikan khalifah dan seterusnya. Padahal arti sebagai kalimat istifham itu artinya apakah, bukan mengapa. Jadi malaikatbukanmempertanyakankebijaksanaanTuhan,tetapibertanya. Meskidemikian,karenasebagaimanayangdiyakiniolehparaulama bahwa alQuran adalah firman Allah yang di dalamnya tidak ada 10 sedikitpun yang tidak bermakna, maka betapa pun, pertanyaan para malaikatitu mengandunginformasitentang karakter manusia,yaitubahwa sebagaimanajugadapatdijumpaipadarealitakehidupanmanusia,manusia memangmemilikitabiatdestruktif,tebalataupuntipis. Jadi ayat ini mengisyaratkan bahwa manusia memang memiliki dorongan jahat yang dapat menggerakannya pada perbuatan merusak dan pertumpahandarah. Selanjutnya surat alNas mengisyaratkan adanya penggerak tingkah lakupadamanusia,yangdisebutwaswas.

`B hx #uquq9$# $Ys:$# %!$# quq r Z$Y9$#


Darikejahatan(bisikan)syaitanyangbiasabersembunyi,Yangmembisikkan(kejahatan) kedalamdadamanusia,dari(golongan)jindanmanusia.(Q.s.alNas/114:45)

Sebagian mufasir mengartikan waswas sebagai setan, atau bisikan halus setan kepada manusia, baik setan yang berwujud jin maupun yang berwujudmanusia,sepertiyangdapatdipahamidariayatselanjutnya( ).Terlepasdariperbedaanpendapatparamufasir,jikadilihatdengan pespektif nafs, waswas bekerja sebagai stimulus yang dating dari Dallam untuk menggerakkan motif fitri yang dimiliki manusia guna melepaskan diridariikatannyaatausebagaikekuatanpenggerakyangmendorongorang melakukankegiatannegatifdanmelakukandosa. Jadiayatinidapatdisebutmengandungpenjelasantentanghubungan stimulus dan respons. Dalam hal ini stimulus pertama berupa waswas, yaitu bisikan halus dan jahat yang ditiupkan oleh setan. Ia bekerja menggelitik naluri instink (motif fitri) yang memiliki kekuatan penggerak agar ia melepaskan diri dari ikatannya agar memperoleh pemuasan.
Ibid ImamFakhralRazi,alTafsiralKabir,(BeirutDarIhyaalTuratsalArabi,tth), jilidI,h.159
10 9

Stimulusbisikanyangberhasilmenggelitikinstrinsikitulahyangmembuat orang merespons dengan perbuatan maksiat, yang memberikan kepuasan kepadamotifyangmendorongkepadakejahatan( ) Respons menjadi positif jika orang dalam memenuhi pemuasan motif fitrinya tetap ingat kepada Allah, berpegang teguh kepada tuntunan agama(syariat)dantuntutanakhlak,danjikahalitudikerjakanmakaorang dapat mengendalikan motif jahatnya dengan respons yang seimbang. Kemampuanseseorangmengalahkanstimulusnegatif,secarabertahapakan melemahkan kekuatan negatif motif fitri itu sendiri. Tingkah laku yang secara lahir tampak positif menjadi negatif jika hal itu dilakukan sekadar merespons motif kepada kejahatan dan mengikuti bisikan waswasnya atua menempuh jalan yang tidak benar. Motif sebagai penggerak tingkah laku berada dalam systemnafs manusia, sedangkan manusia bersifat unik, oleh karena itu manusia berbedabeda pula motif yang mendominasi dirinya. Lingkup kerja faktorfaktor penggerak tingkah laku dalam nafs seseorang sangatluasdanrumit. Isyarattentangluasdanrumitnyasystemkerja nafs denganwaswanyatergambarpadasuratQaf/./50:16

s)s9ur $uZ)n=yz z`|SM}$# On=tRur $tB quq? m/ mtR ( `twUur >t%r& ms9) `B @7ym uq9$#
Dan Sesungguhnya kami Telah menciptakan manusia dan mengetahui apa yang dibisikkan oleh hatinya, dan kami lebih dekat kepadanya daripada urat leher mereka. (Q.s.Qaf/50:16)

Ayat di atas mengisyaratkan bahwa manusia yang telah diciptakan Tuna itu memiliki sisi dalam yang rumit, di mana manusia memiliki aktivitasyangtersembunyidaripengamatanlahir,sepertibisikanhati.Ayat itu juga menyebutkan bahwa meskipun manusia memiliki aktivitas batin yang tersembunyi tetapi Allah mengetahuinya. Dalam perspektif nafs, pengertian bisikan nafs dari kalimat bisa dipahami sebagai ragamdaridorongandoronganpsikologisyangsangatluasyangadadalam system nafs dari manusia yang memiliki keunikan. Tentang pengetahuan Allah atas bisikan nafs manusia dapat dipahami bahwa Allah Maha Mengetahui, apakah bisikan itu diorientasikan kepada kebaikan atau keburukan. Dari ayat ini juga dapat disimpulkan bahwa waswas atau bisikan halus merupakan tabiat dari motif kepada kejahatan, dan ia merupakan system yang bersifat fitrah yang bekerja tidak secara langsung tetapi melalui mekanisme dalam system nafs, yang tidak mudah dianalisis jikahanyamelihattingkahlakulahirmanusia.

Kedudukan waswas sebagai faktor penggerak tingkah laku dalam perspektif manusia sebagai khalifah Allah yang memiliki akal, qalb dan bashirah adalah sebagai berikut. Manusia diberi peluang untuk memilih salahsatudariduajalan(alnajdayn)yangdisediakanTuhan,sepertiyang dipaparkan surat alBalad/ 90:10 ( ). Untuk mengantar sampai kepadakeputusanuntukmenentukanpilihannya,manusiadipengaruhioleh dua kekuatan, yakni personifikasi kebaikan dan kekuatan kebaikan dan kekuatan kejahatan. Kekuatan kebaikan di personifikasi dengan malaikat, yaknimalaikatyangmembantumanusiamenempuhjalankebenaranseperti terteradalamQ.s.alAhzab/33:43danQ.sAlAnfal/8:9

uqd %!$# j?| N3n=t mGs3n=tBur /3y_9 z`iB MyJ=9$# n<) qY9$# 4 tb%2ur tZBsJ9$$/ $VJmu
Dialah yang memberi rahmat kepadamu dan malaikatNya (memohonkan ampunan untukmu),supayadiamengeluarkankamu darikegelapankepadacahaya(yangterang). dan adalah dia Maha Penyayang kepada orangorang yang beriman. (Q.s. al Ahzab/33:43)

Sedangkan kekuatan kejahatan dipersonifikasi dengan setan, yakni untuk mengiring manusia pada jalan kesesatan seperti dijelaskan surat al Baqarah/2:268

`s9$# N.t t)x9$# N2B'tur !$tsx9$$/ ( !$#ur N.t ZotB mZiB


....

Wxsur

Syaitan menjanjikan (menakutnakuti) kamu dengan kemiskinan dan menyuruh kamu berbuatkejahatan(kikir)sedangAllahmenjadikanuntukmuampunandaripadaNyadan karunia....(Q.s.alBaqarah/2:268)

Karena alQuran selalu mempersonifikasi kekuatan kebaikan dan keburukan dengan malaikat dan setan, maka waswas sebagai faktor penggerak tingkah laku manusia juga dihubungkan dengan seta. Faktor penggerak tingkah laku yang tidak dipersonifikasi dalam alQuran adalah fitrah,hawadansyahwat. B.Fitrah,Hawadan SyahwahdalamSistemNafs Dalamnafs manusia ada potensi yang dicipta secara fitri, berfungsi sebagai penggerak tingkah laku manusia. Penggerak tingkah laku

mempunyai peranan penting dalam kegiatan manusia sekurangkurangnya dalam dua hal. (1) mewarnai corak tingkah laku manusia, dan (2) menentukan makna atau nilai dari perbuatan yang dilakukan orang dalam hidupnya. Penggerak tingkah laku seseorang tidak dapat diketahui secara langsungmelaluiperbuatanyangdilakukan,karenaiabekerjadalamsystem nafs pada sisi dalam manusia. Di dalam diri manusia terdapat dorongan dorongan yang menuntut memperoleh pemuasan, dan dorongandorongan ituakantampakjikabertemudenganstimulusyangsesuai,danselanjutnya dorongandorongan itu bersama dengan tabiat nafs lainnya menentukan bagaimana merespons atas stimulus tersebut. Nafs yang sehat dimungkinkan untuk bisa mengendalikan dorongandorongan itu sehingga berwujud pada tingkah laku yang terkendali. Dalam keadaan motif mendorong pada tingkah laku yang terkendali. Dalam keadaan motif mendorong pada tingkah laku negatif, ia berpotensi untuk mempengaruhi seseorang hingga berwujud pada tingkah laku yang tidak terkendali. Pertentangan antara keinginan untuk memuaskan dorongan buruk dengan dorongan untuk bertindak adil bisa menyebabkan seseorang kehilangan integritas dirinya sedemikian rupa. Dalam keadaan demikian orang dapat terbalik pikirannya sehingga apa yang mustahil sebagai suatu hal yang mungkin, masalah yang bernilai buruk dapat diterima oleh logika dan system nilai jiwanya, dan apa yang tidak wajar tampak menjadi sesuatu yangwajar. Dalam alQuran, gagasan tentang faktorfaktor penggerak tingkah laku (motif) berhubungan dengan apa yang disebut syahwah, hawa dan fithrah.MotifdalamalQurantidakdisebutsecaralangsungdengganterm tetapidenganterm syahwah,hawa,fitrahdanuslublainnya.
-

a.FitrahManusia Dalam bahasa Arab, fitrah ( ) mempunyai arti belaah, muncul, kejadiandanpenciptaan.Jikafitrah dihubungkandengan manusia maka yang dimaksud dengan fitrah ialah apa yang menjadi kejaian atau 11 bawaannya sejak lahir atau keadaan semula jadi. Dalam alQuran kata fitrah dengan berbagai kata bentukannya disebut 28 kali, 14 kali disebut dalam konteks uraian tentang bumi atau langit, sisanya disebut dalam konteks pembicaraan tentang manusia, baik yang berhubungan dengan fitrahpenciptaanmaupunfitrahkeagamaanyangdimiliknya.
-

11

IbnManzhur,op.citjilidV,h.34323435

10

O%r's y7yg_ur e$#9 $ZZym 4 |Nt !$# L9$# tss }$Z9$# $pkn=t 4 w @7s? ,=y9 !$# 4 9s e$!$# Ohs)9$# 3s9ur usY2r& $Z9$# w tbqJn=t
Maka hadapkanlah wajahmu dengan lurus kepada agama Allah (tetaplah atas) fitrah AllahyangTelahmenciptakanmanusiamenurutfitrahitu.tidakadapeubahanpadafitrah Allah.(Itulah)agama yanglurustetapikebanyakan manusiatidak mengetahui(Q.s.al Rum/30:30)

Ayat di atas memperlihatkan bahwa manusia diciptakan dengan membawafitrah(potensi)keagamaanyanghanif,yangbenar,dantidakbisa menghindar meskipun boleh jadi ia mengabaikan atau tidak mengakuinya. BerbedadenganteologiKristenyangmemandangmanusiaberfitrahnegatif 12 denganmenyandangdosawarisanAdam, alQuranmemandangmanusia mempunyai potensi positif lebih besar dibanding potensi negatifnya. Surat alBaqarah/2:226, seperti yang telah dibahas pada bab II mengisyaratkan bahwamanusialebihmudahuntukberbuatbaikdaripadaberbuatjahat,( ). Nafs manusia memperoleh ganjaran dari apa yang diusahakannyadanmemperolehsiksadariapayangdiusahakannya.Dalam bahasaArab katakasabatdigunakanuntuk mengambarkanpekerjaanyang dilakukandenganmudah,sedangkankataiktasabatmenunjukpadahalhal yang lebih sulit dan berat. Jadi ayat ini mengisyaratkan bahwa fitrah manusia itu cendrung kepada kebaikan. Jika ada orang yang melakukan keburukan, sebenarnya ia harus bersusah payah melawan fitrah dirinya, Melawan bashirahnya. Meskipun demikian, karena daya tarik keburukan 13 lebih kuat dibanding daya kebaikan, maka dorongan kepada keburukan ( )lebihcepatmeresponsstimulusnegatifyangdijumpainya. b.Syahwah Kalimat syahwah disebut alQuran dalam berbagai kata bentuknya sebanyaktigabelaskali,limakalidiantaranyadalambentukmasdar,yakni duakalidalambentukmufrohdantigakalidalambentukjama.AlQuran menggunakantermsyahwatuntukbeberapaarti.Pertama,dalamkaitannya dengan pikiranpikiran tertentu, yakni mengikuti pikiran orang karena mengikuti hawa nafsu (Q.s. alNisa/4:27).Kedua, dihubungkan dengan keinginanmanusiaterhadapkelezatandankesenangan(Q.s.alImran//3:14,

VanddeEnd,HartadalamBejana,(Jakarta:BadanPenerbitKristen,tth) Haditsriwayat Thabranimenyebutkanbahwakemuliaanukhrawidikelilingioleh halhal yang tidak menarik, sementara kesenangan duniawi justru dikelilingi oleh halhal yangmenarik()
13

12

11

Q.s Maryam/19:59). Ketiga berhubungan dengan perilaku seks menyimpang(Q.s.alAraf/7:81,Q.s.alNaml/27:55).

ur %!$# tbq7-Gt Nuqpk9$# br& (#q=sC xtB $VJt


sedangkan orangorang yang mengikuti hawa nafsunya bermaksud supaya kamu berpalingsejauhjauhnya(darikebenaran).(Q.s.alNisa/4:27)

z`i $Z=9 =m Nuqyg9$# B !$|iY9$# tZt69$#ur oYs)9$#ur otsZs)J9$# B =yd%!$# p9$#ur @y9$#ur ptBq|J9$# OyRF{$#ur ^ys9$#ur 3 9s tFtB o4quys9$# $uR9$# ( !$#ur nyY m >$tyJ9$#
Dijadikan indah pada (pandangan) manusia kecintaan kepada apaapa yang diingini, yaitu:wanitawanita,anakanak,hartayangbanyakdarijenis emas,perak,kudapilihan, binatangbinatangternakdansawahladang.Itulahkesenanganhidupdidunia,dandisisi Allahlahtempatkembaliyangbaik(surga).(Q.s.alImran/3:14)

N6R) tbq?'tGs9 tA$y_h9$# Zouqky- `iB cr !$|iY9$# 4 @t/ OFRr& Pqs% cqB
Sesungguhnya kamu mendatangi lelaki untuk melepaskan nafsumu (kepada mereka), bukankepadawanita,malahkamuIniadalahkaumyangmelampauibatas.(Q.s.alAraf/ 7:81

Dalam bahasa Arab, syahwah yang berasal dari kata mengandungartimenyukaiataumenyenangi.Jikadihubungkandengan manusia, maka syahwah artinya kerindungan nafs terhadap apa yang 14 dikehendakinya . dalam alQuran, maksud syahwah adalah obyek yang diinginkan seperti yang termaktub dalam surat al Imran/3:14 di atas, dan juga syahwat seringkali untuk menyebut potensi keinginanmanusiasepertidijelaskansuratMaryam/19:59danQ.s.alNisa/ 4:27
--

AlRaghibalIsfahani,MujamMufradatAlfazhalQuran,(Beirut:DaralFikr, tth),h.227

14

12

* y#n=sm .`B Ndt/ #=yz (#q$|r& no4qn=9$# (#qt7?$#ur Nuqpk9$# ( t$q|s tbqs)=t $x
Makadatanglahsesudahmereka,pengganti(yangjelek)yangmenyianyiakanshalatdan memperturutkan hawa nafsunya, Maka mereka kelak akan menemui kesesatan, (Q.s. Maryam/19:59)

Surat Maryam/19:59 di atas menyebutkan bahwa ada satu generasi sesudah Nabi yang bertingkah laku salat dan mengikuti syahwatnya. Para mufasir memahami syahwat dalam ayat ini sebagai potensi manusia untuk mengikuti dorongan syahwatnya, yakni mendahulukan dorongan syahwat 15 daripada mematuhi perintah Tuhan. Sedangkan surat alImran/3:14 menyebutkan obyek syahwat manusia berupa wanita (seksual), anakanak (kebanggaan),hartakekayaan,bendaberharga(kebanggaan,kesombongan, kemanfaatan),kendaraan yang bagus (kebanggaan, kenyamanan, kemanfaatan),binatangternak(kesenangan,kemanfaatan)dansawahlading (kesenangan, kemanfaatan). Sementara itu surat al Arraf/7:81mengisyaratkan adanya dorongan untuk melakukan pemuasan seksual secara menyimpang dari kelaziman. Dari ayatayat tersebut dapat disimpulkan bahwa menurut alQuran, di dalam diri manusia terkandung dorongandoronganyangmendesakmanusiauntukmelakukanhalhalyang memberikan kepada kepuasan seksual, kepuasan kepemilikan, kepuasan kenyamanandankepuasanhargadiri. c.Hawa DalambahasaArab,hawa( )adalahkecenderungannafskepada syahwat,( )katahawadalambahasaArabjugamengandung artiturundariataskebawah,tetapilebihmengandungkonotasinegatif,dan menurut alIsfahani, penyebutan term hawa mengandung arti bahwa pemiliknyaakanjatuhkedalamkeruwetanbesarketikahidupdidunia,dan 16 diakhiratdimasukkankedalamnerakaHawiyah. AlQuran menyebut hawa dalam berbagai kata bentukan sebanyak 36kali,sebagianbesaruntukmenyebutcirritingkahlaku,negatif,seperti: 1. Perbuatanorangzalimmengikutihawanafsu (Q.s.alRum/30:29) 2. Perbuatan orang sesat mengikuti hawa nafsu (Q.salMaidah/5:77)
15 16

AhmadMushthafaalMaraghi,Op.cit,juzXVI,h.6667 AlRaghibalIsfahani,op.cit,h.545

13

sepertiyangtersebutdalamsurat(Q.s.alAnam/6:150),dan 4. Perbuatan orang yang tidak berilmu (Q.s. al Jatsiyah/45:18 Pada surat alNaziat/ 79:4041 disebutkan hubungan hawa dengan nafs:

$Br&ur `tB t$%s{ tP$s)tB mn/u ygtRur }Z9$# `t 3uqol;$# b*s spYpg:$# }d 3ur'yJ9$#
Danadapun orangorang yangtakut kepada kebesaranTuhannyadan menahan diri dari keinginan hawa nafsunya, Maka Sesungguhnya syurgalah tempat tinggal(nya).(Q.s. al Naziat79:4041)

Ayatdiatasmenunjukkanbahwaadanafsdanadakomponenhawa. MenurutalMaraghihawamerupakankeadaankejatuhannafskedalamhal 17 halyangdilarangolehTuhan( ) .Jikahawaitumerupakan kecenderungan kepada syahwat, maka kalau dibandingkan dengan motif, hawa adalah motif kepada halhal yang rendah dan batil. Dalam surat al Muminun/23:71 diisyaratkan, jika kebenaran tunduk kepada desakan hawa,makatatakehidupanmanusiaakanrusakbinasa( ).AlQuranbanyaksekalimengingatkanmanusiaagar janganmengikutihawasendiriataupunhawaoranglain,karenamengikuti doronganhawadapatmenyesatkan,sepertiyangdijelaskandalamsuratal Anam/6:119( )danQ.s.Shad//38:26),dandapat mendorong bertindak menyimpang dari kebenaran ( )[Q.s. alNisa//4:135]. Hawa yang selalu diikuti, menurut alQuran menjadi sangat dominant pada seseorang hingga orang itu menjadikan hawanya sebagaituhan,sepertiyangdipaparkansuratalFurqon/29:43( ) Sikap mental orang yang mampu menekan hawa nafsunya seperti yangtermaktubdalamsuratalNazi'at/79:4041adalahmentalorangyang takut kepada Tuhan, dan perasaan takut kepada Tuhan itu didahului oleh ilmu sehingga menurut alQur'an surat Fathir/35:28, hanya orang yang berilmu(ulama)lahyangmemilikirasatakutkepadaTuhan( ). Jika melihat munasabah dengan ayat sebelumnya (Q.s. alNaziat/ 79:3738), maka sikap mental ini merupakan kebalikan dari sikap mental
17

AhmadMushthafaalMaraghi,op.cit,juzXXX,h.34

3. PerbuatanorangyangmendustakanayatayatTuhan

14

orang yang melampaui batas, ( ), yaitu orang yang menurut Fakhr 18 alRazi,mengalamidistorsipemikiran, dankebalikandarimenekanhawa nafsu, orang yang melampaui batas itu, justru lebih mengutamakan kesenangandunia( ). C.KarakteristikPenggerakTinglahLaku Hubungan antara tingkah laku yang tampak dengan faktor penggeraknya yang tersembunyi sangat rumit. AlQur'an memberi contoh pada kisah Nabi Yusuf, yaitu perbuatan saudarasaudara Yusuf menipu ayah mereka dan menyingkirkan Yusuf itu sendiri. Mekanisme kerja penggerak hingga menjadi tingkah laku yang dilakukan oleh saudara saudara Yusuf seperti dkisahkan dalam surat Yusuf ayat 718 itu, dapat diilustrasikansebagaiberikut: 19 Anakanak Nabi Ya'qub berjumlah 12 orang, sebagian besar dari mereka terutama yang sudah dewasa merasa kesal karena merasa kurang mendapat perhatian dari ayahnya. Setan membisikkan waswasnya kepada merekabahwapenyebabkurangperhatianYa'qubkepadamerakaituadalah karena kasih sayang Ya'qub sudah bertumpah kepada Yusuf yang menjadi anak kesayangannya sejak kecil. Bisikan itu mengatakan bahwa selama masih ada Yusuf disisi ayahnya, jangan berharap ayah akan memperhatikanmereka.Bisikanitumengusikdorongandoronganyangada dalamnafsmereka,yaitumotifingindicintai,ingindiperhatikan,daningin memperoleh kesenangan dan juga motif benci. Didorong oleh rasa ingin memuaskanmotifnya,waswassetanmemberikanstimulusberupagagasan gagasan yang jitu, yaitu menyingkirkan Yusuf. Ketika nafsnya menjawab bahwa tidak mungkin menyingkirkan Yusuf karena selalu ada dalam pengawasan ayahnya, waswas mebisikkan gagasan yang tepat, yaitu merayu ayahnya agar diperbolehkan mengajak Yusuf bermainmain di obyek pariwisata. Gagasan itu juga sekaligus dilengkapi skenario bagaimanamembuangYusufdanbagaimanamenyusunalasanyangmasuk akaluntukdisampaikankepadaayahnya. Sebenarnyabashirahmerekamenafikangagasangilaitu,bagaimana mungkin membohongi ayah dan bagaimana mungkin membunuh atau menyingkirkan saudara kandung sendiri. Akan tetapi kuatnya motif benci danmotifingindiperhatikanmenyebabkanintegritasdirimerekaterganggu, hilang keseimbangan dan tidak mampu mendudukkan masalah secara proporsional. Demikianlah kondisi mental saudarasaudara Yusuf. Dominasi motif benci itu sedemikian rupa sampai mereka melakukan apa
ImamFakhralRazi,op.citjuzXXX Menurutkitabkejadian35,KeduabelasanakanakYaqubadalahRubin,Simeon, Lewi, Yehuda, Zebulon, Isachar, Yusuf, Benyamin, Dan, Naftali, Gad dan Asier. Lihat alkitab(Jakarta:LembagaAlkitabIndonesia,1970),h.48
19 18

15

yang menurut Utsman Najati disebut helat mental ( ) pengingkaran terhadap perasaan, dan sifatsifat buruk yang ada pada dirinya untuk kemudianmenimpakankesalahanitupadaoranglain,dansetelahitumerasa 20 terbebas dari kesalahan. Mereka menyusun rencana secara cermat dan memandang yangmustahil menjadi mungkin, yang tidak wajar menjadi wajar, yang buruk menjadi logis. Ketika Ya'qub tidak mengizinkan Yusuf diajakpergi,merekamelakukanhelahmentaldenganberkata:

(#q9$s% $tR$t/r't $tB y7s9 w $Z0B's? 4n?t y#q $R)ur &s! tbqsoYs9 &#r& $oYytB #Yx s?t =y=tur $R)ur ms9 tbqyss9
Mereka berkata: "Wahai ayah kami, apa sebabnya kamu tidak mempercayai kami terhadap Yusuf, padahal Sesungguhnya kami adalah orangorang yang mengingini kebaikan baginya. Biarkanlah dia pergi bersama kami besok pagi, agar dia (dapat) bersenangsenangdan(dapat)bermainmain,danSesungguhnyakamipastimenjaganya." (Q.s.Yusuf/12:1112)

Demikianlah kesepakatan persekongkolan yang diambil oleh saudarasaudara Yusuf. Perbuatan mereka dilatarbelakangi oleh motif permusuhan yang bersumber dari keinginan pemuasan sosial. Mereka menipu mentahmentah ayahnya dan dengan mudahnya mempermainkan nilainilai kepatutan. Jika dianalisis sebenarnya ada satu pertanyaan seberapa jauh jarak antara motif kepada permusuhan dan bashirah dalam sistem nafs manusia ketika tingkah laku manusia berada dalam dominasi motif kepada permusuhan atau ketika kebencian memenuhi sepenuhnya mengendalikan hawa nafsunya, sehingga qalb dan akal hanya digunakan sebagaialatpermainan.ApayangterjadipadaYusuf,terjadipulasekarang pada orang lain dan berulangulang, karena sesungguhnya motif kepada permusuhan dan bashirah berada dalam satuan sistem nafs. Contoh yang jelas dari hal itu ialah bahwa penipu akan menggunakan segala cara yang mungkin dalam memperdayakan korbannya, pencuri atau perampok juga suka menampilkan tingkah laku sopan dan hormat sebagai strategi untuk mengelabuikorbannya. AlQur'anmembericontohlaindaritingkahlakuhelahmental,pada tingkah laku orang munafik yang mengaku beriman seperti yang diisyaratkan surat alBaqarah/2:810. Mereka bermuka manis untuk menyembunyikankebencianmerekadanhelahmentalorangmunafiklebih rumitlagikarenadidalamhatimerekabersemayampenyakitnifaq. 1.PengaruhLingkunganterhadapPenggerakTingkahLaku
20

UtsmanNajati,AlQur'anwaIlmalNafs(Kairo:DaralSyuruq,1982(,h.19

16

$yJg9yr's `s9$# $pk]t $yJgy_tzr's $JB $tR%x. m ( $uZ=%ur (#q7d$# /3t/ Ct79 Art ( /3s9ur F{$# @s)tGB tFtBur 4n<) &m
Lalu keduanya digelincirkan oleh syaitan dari surga itu dan dikeluarkan dari keadaan semuladankamiberfirman:"Turunlahkamu!sebagiankamumenjadimusuhbagiyang lain,danbagikamuadatempatkediamandibumi,dankesenanganhidupsampaiwaktu yangditentukan."(Q.s.alBaqarah/2:36)

Surat alBaqarah/2:36 merupakan bagian dari rangkaian ayatayat (3038)yangmengisahkanpenciptaanAdamdanbagaimanaakhirnyaAdab dan Hawa terpedaya oleh godaan setan untuk memakan syajarah yang dilarangTuhansehingga merekadikeluarkan darisorgadanditurunkan ke mukabumiini.Dariayattersebuttimbulpertanyaan,mengapaAdamyang Nabi bisa tergoda oleh Iblis. Dari rangkaian ayat 3038 itu (dan tafsirnya) dapat diketahui jawabannya, bahwa Iblis bukan hanya sekali mendatangi Adam, dan bahkan jika gagal mempengaruhi Adam, ia akan segera mempengaruhi Hawa. Demikianlah usaha Iblis tidak hentihentinya mempengaruhi Adam dengan menawarkan logika bahwa di balik larangan Tuhanituadarahasia keabadian,dan melanggarperintahTuhan memakan syajarahjustruakanmenghasilkankeabadian. KehadiranIbliskepadaAdamdanHawasecaraterusmenerusdalam perspektif psikologi seperti yang dikatakan oleh Dr. Ramadhan al 21 Qadzdzafi adalah menempati posisi lingkungan. Iblis dalam hal ini menjadi faktor lingkungan. Lingkungan adalah ruang di mana seseorang hidup,baikruanganfisik, mental maupunspiritual.Lingkunganitusendiri sebenarnya netral, tidak mempengaruhi apaapa jika hanya dilalui sepintas kilas. Ia baru mempengaruhi manusia ketika menstimuli manusia secara berulangulang, terus menerus dalam waktu yang lama. Pengaruh lingkungan terhadap manusia bisa berupa membentuk atau mengubah tingkahlaku,bisapositifbisajuganegatifbergantungkepadafaktorfaktor apa yang relevan dengan kegiatan atau dengan perhatian manusia. Adam tergoda Iblis karena Iblis selalu menawarkan keabadian, satu hal yang dirindukanolehAdamdanHawasebagaimanusia. Manusia adalah makhluk sosial yang dapat dipengaruhi oleh lingkungan sosial dimanaia berada. Seringkali pengaruh lingkungan itu sangat besar sehingga bukan hanya mengubah atau meluruskan, tetapi sampai mengalahkan tabiat asal seseorang. Hadits Nabi yang berbicara tentangFitrahmanusiasejalahdenganpandangantersebut.KataRasul

21

RamadhanMuhammadalQadzdzafi,op.cit,h.45

17

Setiap manusia dilahirkan dalam keadaan fitrah, kedua orang tuanyalah yangmenyebabkananakitumenjadiYahudi,NasraniatauMajusi. Meskipundemikian,jikaseseorangdalammeresponslingkunganitu tetapberpegangteguhkepadatuntunanagamadantaatkepadaAllah,maka orientasinya itu akan mengarahkan tingkah lakunya ke arah kebaikan dirinya, baik kebaikan di dunia maupun di akhirat. Sebaliknya jika dalam merespons lingkungan itu ia mengikuti dorongan syahwat dan pikiran rendahnya,makaiaakanterbawa kepadatingkahlakuyang mencelakakan dirinya,terutamajika dilihatdariukuranorangberagama.Jadilingkungan tertentu mempersubur motif yang sudah ada dalam nafs manusia untuk memperoleh pemuasannya. Seseorang yang memiliki motif kepada kejahatan akan mudah terangsang untuk melakukan perbuatan jahat jika lingkungan dimana ia hidup memberikan situasi yang kondusif untuk melakukannya. Jika lingkungannya tidak kondusif untuk itu, maka motif kepadakejahatanitumengenduratautertekan.Selanjutnyamotifjahatyang sudah menguat mudah menggerakkan manusia untuk melaksanakan kejahatan. 2.KekuatanPenggerakTingkahLaku Motif bekerja mengarahkan tingkah laku manusia pada tujuan yang diinginkan. Motif kepada kejahatan bekerja mengarahkan manusia pada tingkah laku jahat, dan motif kepada pemilikan mengarahkan manusia untuk bekerja memperoleh apa yang ia inginkan. Tanpa motif manusia bagaikan perahu tanpa kompas, berlayar tidak tentu arah. Bagi manusia, motif bagaikan kompas hidup. AlQur'an surat Yunus/10:108 mengisyaratkan adanya hubungan erat antara motif dengan tingkat dan warnakegiatanmanusia.

@% $pkr't $Z9$# s% N2u!%y` ,ys9$# `B N3n/ ( `yJs 3ytFd$# $yJR*s tGku muZ9 ( `tBur @| $yJR*s @t $pkn=t ( !$tBur O$tRr& N3n=t 9@2uq/
Katakanlah:"Haimanusia,SesungguhnyateIahdatangkepadamukebenaran(AlQuran) dari Tuhanmu, sebab itu barangsiapa yang mendapat petunjuk Maka Sesungguhnya (petunjuk itu) untuk kebaikan dirinya sendiri. dan barangsiapa yang sesat, Maka Sesungguhnyakesesatannyaitumencelakakandirinyasendiri.danAkubukanlahseorang Penjagaterhadapdirimu".(Q.s.Yunus/10:108)

Ayat di atas mengisyaratkan bahwa barangsiapa telah memiliki kesiapanataumemilikidoronganuntukmenerimapetunjukalQur'an,maka

18

kecenderungannya tertuju pada melaksanakan kebaikan seperti yang diajarkan alQur'an, dan ia selalu merindukan datangnya kebaikan bagi dirinya.Sebaliknyabarangsiapadidalamdirinyatelahadadoronganuntuk menolak kebenaran alQur'an, maka ia tidak mampu menangkap kebaikan alQur'an, dan karena faktor penolakan tersebut, ia tidak tertarik untuk mengikutipetunjukpetunjukalQur'an.

$tBur 7-Gt OdsY.r& w) $Zs 4 b) `9$# w _ z`B d,pt:$# $x 4 b) !$# 7L=t $yJ/ tbq=yt
Dan kebanyakan mereka tidak mengikuti kecuali persangkaan saja. Sesungguhnya persangkaan itu tidak sedikitpun berguna untuk mencapai kebenaran. Sesungguhnya AllahMahamengetahuiapayangmerekakerjakan.(Q.sYunus/10:36)

......Sebenarnyaorangorangkafiritudijadikan(olehsyaitan)memandangbaiktipudaya merekadandihalanginyadarijalan(yangbenar).....(Q.s.alRad/13:33)

AlQur'an surat Yunus/10:36 di atas, mengisyaratkan adanya orang (musyrik) yang tunduk pada motif penentangannya kepada kebenaran (al Qur'an) sampai akalnya terdistorsi. Motif ingkarnya kepada Tuhan membuatnyatidakbisa memahamiargumenlogisataupun kebenaranyang berasal dari wahyu untuk memahami keesaan Tuhan. Ia merasa cukup dengan berpegang pada penolakan emosinya yang meperkuat pendapat pribadinya dan arahnya yang keliru yang kemudian membawanya pada sikapmenolakdansombong,padahalapayangmerekapegangteguhtidak lebih hanyalah dugaan atau persangkaan yang belum terjamin kebenarannya. Sedangkan surat alRad/ 13:33 di atas mengisyaratkan bahwa orang kafir yangmemang memiliki motif menentang, motif kufur, justru merasakan adanya keindahan dalam perbuatan mereka yang keliru. Perbuatan tipu daya mereka terasa indah dan benar, karena motif menentangkebenaranmendominasimerekasehinggamerekasalahpersepsi terhadap jalan kebenaran. Dorongandorongan dalam nafs yang mendesak untuk memperoleh pemuasannya itu di dalamnya terkandung tipuan yang menyesatkandanterkandungjugapotensiyangmenggerakkantingkahlaku ke arah memperoleh kelezatan dan kesenangan, atau ke arah mencapai kemanfaatan yang sifatnya individual, baik kemanfaatan materi maupun maknawi. MenunuuksuratYunus/10:36yangmenyebutkanbahwaorangkafir dikuasai oleh dugaan, persangkaan atau zhann yang tidak jelas dasarnya, sebenarnyaayatitusecaratidaklangsung mengisyaratkanbahwa motifitu

...

3 @t/ z`i t%#9 (#rxx. Nd3tB (#rur `t @69$# 3

....

19

merupakankeadaanemosiyangberhubungandengansusunanbiologitubuh manusia, atau sekurangkurangnya bahwa di dalam motif terdapat dimensi emosiyangsangatdominanbagikandindingyangmenghalangipandangan, sehinggaorangyangsedangdidorongoleh motif menolakyang kuattidak bisa menengok kebaikan yang berlawanan dengan tuntutan motifnya. Dominasi motif ingkar itu menyebabkan orang tidak bisa melihat dan menganalisasesuatusecarateliti. AlQur'an memberi contoh misalnya, apa yang dimohonkan orang kepada Tuhan ketika dalam keadaan terjepit terlupakan begitu saja ketika Tuhan telah membebaskan mereka dari keterjepitan itu. Kondisi yang demikiandiisyaratkanolehalQur'ansuratYunus/10:23dan12

#s)ur tB z`|RM}$# 9$# $tR%ty m7/Yyf9 rr& #$s% rr& $VJ!$s% $Jn=s $uZtx. mZt n tB br(2 O9 !$oYt 4n<) 9h mB 4 y79xx. z`i tJ=9 $tB (#qR%x. cq=yJt
Danapabilamanusiaditimpabahayadiaberdoakepadakami dalamkeadaanberbaring, dudukatauberdiri,tetapisetelah kami hilangkanbahayaitu daripadanya,dia(kembali) melalui (jalannya yang sesat), seolaholah dia tidak pernah berdoa kepada kami untuk (menghilangkan) bahaya yang Telah menimpanya. begitulah orangorang yang melampaui batas itu memandang baik apa yang selalu mereka kerjakan. (Q.s. Yunus/10:12)

Maka tatkala Allah menyelamatkan mereka, tibatiba mereka membuat kezaliman di mukabumitanpa(alasan)yangbenar(Q.s.Yunus/10:23)

Motif kepada halhal yang disukainya, besar sekali pengaruhnya kepada tingkah laku sampai banyak orang yang terbelenggu oleh persangkaannya, khayalannya dan anganangannya hanya sekadar memuaskan motifnya atua merespons desakannya terutama dalam kondisi emosi memuncak seperti marah, sedih, takut atau putus asa, satu keadaan yangmembuatkeputusannyatidaktepatdanpikirannyatidakcermat.Oleh karenaitumotifkepadakejahatanhanyabisadikendalikandenganakaldan latihan. 3.KekuatanMotifkepadaKeburukan Motifkepadakeburukansangatkuatpengaruhnyadalammendorong manusia melakukan perbuatan buruk yang dilakukan secara demonstratif, seperti tingkah laku sombong, melawan, tidak mau mengambil pelajaran

...

!$Jn=s Ng8pgUr& #s) Nd tbq7t F{$# t/ d,ys9$# 3

20

dari pengalaman dan dari kebiasaan masa lalu. Meskipun seseorang telah berkalikali mengalami kesulitan karena perbuatannya yang keliru, tapi karena motifnya kepada keburukan sangat kuat menyebabkan ia lebih mengutamakan memenuhi dorongan untuk memuaskan motif kepada keburukan itu dengan mengulangi kesalahan yang lalu, dibanding berpikir jernih memilih tindakan yang benar. Bagi orang yang memiliki motif kepada keburukan, kebenaran tidak memuaskan nafsnya, sebaliknya kejahatanlah yang membuatnya puas karena ia berada di bawah dominasi motif kepada kejahatan. Selama seseorang tidak bisa menolak desakan motif kepada keburukan yang ada di dalam nafsnya, maka akal sehatnya 22 ( )sepertiyangdimaksudolehFakhralRazi tidakberfungsi. AlQur'an surat alMu'minun/23:105106 mengisyaratkan kuatnya pengaruhmotifkepadakeburukanterhadaptingkahlaku.

Ns9r& `3s? Lt#u 4n?G? /3n=t OFZ3s $pk5 cq/js3? (#q9$s% $uZ-/u Mt7n=x $uZn=t $uZ?uq) $Z2ur $YBqs% j9!$|
Bukankah ayatayatKu Telah dibacakan kepadamu sekalian, tetapi kamu selalu mendustakannya?Merekaberkata:"YaTuhankami,kamiTelahdikuasaiolehkejahatan kami,danadalahkamiorangorangyangsesat.(Q.s.alMuminun/23:105106)

Ayat di atas menunjukkan bahwa orang kafir itu mengaku dikalahkanoleh kejahatan mereka( )sehingga mereka menjadi orangorang yang sesat. Dalam perspektif nafs, maka kejahatan yang dimaksud adalah dorongan jahat yang ada dalam diri mereka yang mendesak menuntut pemuasan. Pengingkaran orang kafir kepada Tuhan menyebabkangalbdanbashirah merekaterhalanguntukdapat memahami ayatayat Allah, sehingga desakan motif kepada kejahatan justru menjadi tidakterelakkan. KuatnyapengaruhmotifuntukmengingkariTuhanpadaorangkafir menyebabkan mereka tidak bisa mengambil pelajaran. Hal itu ditegaskan olehTuhandalamsuratalAn'am/6:2728:

qs9ur #ts? ) (#q%r n?t $Z9$# (#q9$s)s $uZoKn=t tR wur z>js3R Mt$t/ $oYn/u tbq3tRur z`B tZBsRQ$# @t/ #yt/ Mlm; $B (#qR%x. tbq `B @6s% ( qs9ur (#r (#r$ys9 $yJ9 (#qkX mYt NkX)ur tbq/s3s9
22

Lihatcatatankakino.padababIIdaritulisanini

21

Danjikakamu(Muhammad) melihat ketika mereka dihadapkanke neraka,lalu mereka berkata:"Kiranyakamidikembalikan(kedunia)dantidakmendustakanayatayatTuhan kami,sertamenjadi orangorang yangberiman",(tentulahkamu melihat suatuperistiwa yangmengharukan).Tetapi(sebenarnya)Telahnyatabagimerekakejahatanyangmereka dahulu selalu menyembunyikannya[466]. sekiranya mereka dikembalikan ke dunia, tentulah mereka kembali kepada apa yang mereka Telah dilarang mengerjakannya. dan Sesungguhnyamerekaituadalahpendustabelaka.(Q.s.alAnam/6:2728)

Ayat di atas, seakan Tuhan mengatakan, sesungguhnya kamu tidak mempunyai maksud baik, katakatamu itu diucapkan hanya karena takut kepada siksa neraka, tetapi jika kamu diberi kesempatan, kamu juga mengulangi kesalahanmu, karena kamu tidak bisa mengambil pelajaran (disebabkankuatnyamotifkufurmu). Kuatnya pengaruh motif kepada keburukan sama seperti pengaruh minumankerasdanobatterlarangkepadapecandunya.Orangyangsedang beradadibawahpengaruhminumankerasdanobatterlarang,akalnyatidak berfungsi dalam membimbing tingkah lakunya. Ketika itu ia juga tidak mampumenggunakanindradanpengamatannyasecaraakurat,satukeadaan mental yang dapat menjerumuskannya pada perbuatan sesat yang merusak dan khayalan yang menipu, dan ketika itu ia tidak bisa menolak dan melepaskan dari cengkeraman rasa percaya dirinya yang sedang kacau. Kekacauandayatangkaporang yangberadadalampengaruh motif kepada keburukandiungkapkanalQur'andalamsuratalHijr/15:1415:

qs9ur $oYstFs Nkn=t $\/$t/ z`iB !$yJ9$# (#q=ss m tbq_t (#q9$s)s9 $yJR) Ntj3 $tR|/r& @t/ `twU Pqs% tbrqsB
Dan jika seandainya kami membukakan kepada mereka salah satu dari (pintupintu) langit, lalu mereka terus menerus naik ke atasnya, Tentulah mereka berkata: "Sesungguhnya pandangan kamilah yang dikaburkan, bahkan kami adalah orang orang yangkenasihir".(Q.s.alHijr/15:1415)

Motifyangberasaldaristrukturorganiktubuhmanusia menurutal Qur'an dapat dikendalikan. AlQur'an mengakui bahwa motif untuk melakukan hubungan seks itu sangat kuat, tetapi ia bisa dilatih dan dikenalikan. Beratnya tekanan motif untuk melakukan hubungan seks diakuialQur'anpadakasusorangmenjalankanibadahpuasapadakaliyang pertama:
...

zN=t !$# N6Rr& OGY. cqR$tFrB N6|Rr& z>$tGs N3n=t $xtur N3Yt

...

..Allahmengetahuibahwasanyakamutidakdapatmenahannafsumu,KarenaituAllah mengampunikamudanmemberima'afkepadamu....(Q.s.alBaqarah/2:187)

22

Puasa termasuk tuntunan alQur'an untuk melatih motif, baik motif primermaupunmotifsekunder.Pelatihanmotifprimerdalampuasaberupa pengaturanwaktukapanbolehmenyalurkandankapandilarang,sedangkan efek dari pengendalian motif primer merupakan kekuatan untuk mengendalikan motif sekunder. Pada orang yang lemah, memuncaknya tekananmotifkepadakejahatandapatmendorongnyamelakukanperbuatan bodoh, seperti yang dilakukan oleh kaum Bani Israil ketika menerima stimulusdariRasulberupaajaranyangtidakberkenandihatinya.Menerima ajakan kebenaran, mereka bukan hanya tidak menerima, tetapi bahkan merespon dengan kesombongan, seperti yang diisyaratkan surat al Baqarah/2:87( ).Demikianjugaapayang dilakukanolehZulaykhasepertiyang dikisahkansurat Yusuf/12:32,yakni ketika ia gagal merayu Yusuf untuk melakukan perbuatan pengkhianatan yang dapat memuaskan motifnya kepada hubungan seks, ia menghinakannya dengan memasukkan ke dalam penjara ( ).

D.JenisjenisPenggerakTingkahLaku Manusiasebagaibasyarmemilikimotiffitriyangrelatifsama,tetapi sebagaiinsandansebagaimakhluksosialmanusiamemilikimotifsekunder yang berbedabeda dan banyak. Ragam motif sekunder manusia sebagai insan sesuai dengan kebutuhan manusia itu sendiri, baik kebutuhan materi maupun kebutuhan akan nilai, kebutuhan lahir maupun kebutuhan batin. Duniamanusiaitupenuhdengankesenangan,keinginandankeperluan.Di dalam diri manusia itu sendiri sudah terdapat dorongandorongan yang bersifatpsikologisyangmerupakanfaktorpenggerakdaritingkahlakunya. Faktorfaktor penggerak itu siap mendorong manusia untuk bertindak menggapai tujuan setiap kali menjumpai stimulus yang mampu mempengaruhinya untuk keluar dari sarangnya untuk melepaskan diri dari ikatannyadanmemperolehpemuasannya. Motif utama yang ada dibalik aktivitas manusia dapat diklasifikasi dengan motif untuk aktualisasi diri, motif pemeliharaan diri, motif penghargaandiridisampingpembagianmotifprimerdanmotifsekunder. AlQur'an mengisyaratkan bahwa manusia memiliki berbagai penggerak tingkah laku seperti penggerak kepada pemilikan, penggerak kepada kebaikan, penggerak untuk mengetahui, penggerak untuk menjaga diri, penggerak untuk mati syahid, penggerak kepada seks, penggerak kepadapermusuhandanpenggerakuntukmembantah. 1.PenggerakkepadaPemilikan

23

Surat alBaqarah/2:212, dan al Imran/3:14, mengisyaratkan bahwa manusia memiliki dorongan psikologis untuk memiliki sesuatu untuk kesenangandirinya.

ti t%#9 (#rxx. o4quys9$# $uR9$# tbryour z`B z`%!$# (#qZtB#u z`9$#ur (#qs)?$# Ogs%qs tPqt pyJu)9$# 3 !$#ur -t `tB !$to t/ 5>$|m
Kehidupan dunia dijadikan indah dalam pandangan orangorang kafir, dan mereka memandang hina orangorang yang beriman. padahal orangorang yang bertakwa itu lebihmuliadaripadamerekadiharikiamat.danAllahmemberirezkikepadaorangorang yangdikehendakiNyatanpabatas.(Q.s.alBaqarah/2:212)

z`i $Z=9 =m Nuqyg9$# B !$|iY9$# tZt69$#ur oYs)9$#ur otsZs)J9$# B =yd%!$# p9$#ur @y9$#ur ptBq|J9$# OyRF{$#ur ^ys9$#ur 3 9s tFtB o4quys9$# $uR9$# ( !$#ur nyY m >$tyJ9$#
Dijadikan indah pada (pandangan) manusia kecintaan kepada apaapa yang diingini, yaitu:wanitawanita,anakanak,hartayangbanyakdarijenis emas,perak,kudapilihan, binatangbinatangternakdansawahladang.Itulahkesenanganhidupdidunia,dandisisi Allahlahtempatkembaliyangbaik(surga).(Q.s.alImran/3:14)

Dalam bahasa Arab kata yang berasal dari kata menurut Isfahani mengandung arti keindahan hakiki, yakni sesuatu yang tidakmemilikicelapadamanusia,baikdiduniamaupundiakhirat.Secara global pengertian keindahan itu menurut Isfahani dapat ditinjau dari tiga sudut, yaitu keindahan psikologis, keindahan fisik dan keindahan faktor 23 luar. Dalam alQur'an term seringkali dinisbahkan dengan Tuhan seperti ayat dan adakalanya dinisbahkan dengan setan seperti terdapat dalam ayat dan juga seringkali tidak dinisbahkandenganfa'iltertentukarenadalambentukmabnimajhulseperti dalamsuratalBaqarah/2:212dansuratalImran/3:14diatas. Dua ayat di atas mengisyaratkan bahwa di mata manusia, dunia dengan simbolsimbol benda berharga adalah sesuatu yang indah secara hakiki, yang kemudian mereka menginginkannya dan memandang perlu untuk memilikinya. Dorongan untuk memiliki itulah yang menggerakkan
23

AlRaghibalIsfahani,op.cit,h.223

--

24

seseorang untuk melakukan sesuatu dalam upaya memiliki apa yang diinginkannya. Dorongan psikologis atau motif memiliki diperlukan oleh manusia untuk mendorongnya melakukan sesuatu yang diperlukan. Motif kepada pemilikan itulah yang menyebabkan manusia memenuhi kebutuhan hidup sementaranya, dan motif itu pula yang menyebabkan manusia berbuat bendabenda yang bersifat kesenangan duniawi yang tidak abadi. Dalam batasbatastertentu,apayangdilakukanmanusiatidakberbedadenganapa yangdilakukanolehhewan,yaknimencukupikebutuhanhidupnyasebagai makhlukhidupdimukabumi.Karenamanusiabukansekadarhewantetapi hewan yang berpikir, maka manusia dalam merespon dorongan untuk memilikidapatmenetapkantujuanyanglebihtinggidanlebihmulia,yakni untuk mencapai kebahagiaan dan kenikmatan abadi di akhirat, karena tujuan dapat mengendalikan tuntutan dari dorongan itu. Manusia memang bebas memilih, dan keputusan pilihannya itu akan berpengaruh pada arah hidupnya,danakibatdarikeputusanyangtidaktepatharusditanggungoleh manusia itu sendiri. AlQur'an menegaskan bahwa manusia diberi kebebasan untuk menentukan keinginannya tetapi dengan mengingatkan resikonya:

`tB tb%x. no4quys9$# $uR9$# $uhtFt^ur e$uqR Nks9) Ngn=yJr& $pk Odur $pk w tbqy7 y7s9'r& t%!$# }s9 Nlm; otzFy$# w) $Y9$# ( x7ymur $tB (#quZ| $pk @t/ur $B (#qR$2 tbq=yJt
Barangsiapayangmenghendakikehidupanduniadanperhiasannya,niscayakamiberikan kepadamerekabalasanpekerjaanmerekadiduniadenganSempurnadanmerekadidunia itu tidak akan dirugikan. Itulah orangorang yang tidak memperoleh di akhirat, kecuali neraka dan lenyaplah di akhirat itu apa yang Telah mereka usahakan di dunia dan sia sialahapayangTelahmerekakerjakan.(Q.s.Hud/11:1516)

Ayat di atas menyodorkan kepada manusia pilihan yang harus diambil, apakah kesenangan hidup duniawi seperti yang diinginkan oleh dorongan psikologisnya tetapi dengan resiko tidak memperoleh sesuatu di akhirat, atau menekan keinginan yang bersifat duniawiah dengan harapan memperoleh kebahagiaan di akhirat sesuai dengan kemuliaan martabatnya sebagai manusia. Tuhan telah menciptakan manusia dan melengkapinya dengan perangkat yang memungkinkannya memperoleh kemudahan dan kenyamanan dalam hidupnya. Orang bijak akan memilih menekan dan mengendalikandorongandorongan kepadahalyangbersifatrendah,untuk kemudian melakukan perbuatan yang dapat merangsang dorongan kepada kebaikan. Sedangkan orang yang celaka, ia bahkan bertekuk lutut kepada

25

dorongan kepada halhal yang bersifat kebendaan dan melayani seluruh keinginannya. Karakter dari motif memiliki ini adalah mendorong manusia untuk berusaha memperoleh halhal yang bersifat duniawi, dan dalam tingkatan tertentu untuk serakah terhadap harta benda. Jika tujuan yang ditetapkan oleh manusia sekadar untuk memenuhi tuntutan hidup atau memfasilitasi kehidupanyangmulia,makamotifmemilikiinimendorongnyamelakukan halhalyangbaikdanpantas.Akantetapijikamotifinidimilikiolehorang serakah yang bertujuan menumpuk harta dan menduduki kekuasaan didepanmanusia,makamotifinimendorongnyamelakukanperbuatanyang merugikan orang lain, mendorongnya untuk kikir dan bermusuhan dengan rivalnya, sementara halhal yang bermakna ridla Tuhan tidak menarik perhatiannya. Karakter motif memiliki itu temperamental dan sungguhsungguh, hingga ia ingin segera memperoleh pemuasan dan tidak mau menunda. Motifmemilikiyangsedangbekerjakuatsenantiasamendorongpemiliknya untuk berbuat maksimal bahkan melebihi kapasitas, dengan segala cara hanya demi memuaskan kebutuhan duniawiahnya. Ia memilih yang dekat daripada yang jauh, memilih yang fana daripada yang kekal. Sedangkan orang yang mampu menggunakan akalnya secara optimal, memilih yang kekaldibandingyangfana, menyibukkandiridenganhalhalyangpenting daripada mengejar "buih". Orang yang tunduk kepada motif memiliki hal halyangbersifatduniawi,iasepertiyangdiisyaratkansuratalA'la/87:16 17, selalu mengutamakan kehidupan duniawi meskipun sebenarnya kehidupan akhirat itu lebih baik dan lebih abadi ( ) Dalam kondisi yang menyimpang atua dalam kualitasnya yang rendah, motif memiliki dapat mendorong pemiliknya untuk bertindak serakah, melakukan kecurangan, menggunakan caracara yang kotor, atau bahkan merampas hakhak orang lain dalam praktikpraktik usahanya. Kecenderungan bertindak menyimpang dan zalim dalam memenuhi keinginan memiliki harta dengan segala cara itu dapat dipahami dari bimbingan alQur'an agar manusia tidak diperbudak oleh hawa nafsunya, seperti: (1). Larangan usaha menguasai harta yang bukan haknya melalui pengadilan yang direkayasa seperti yang dipaparkan dalam surat al Baqarah/2:1888

wur (#q=.'s? N3s9uqBr& N3oYt/ @t69$$/ (#q9?ur !$yg/ n<) Q$6t:$# (#q=2'tG9 $Z)s `iB AuqBr& $Y9$# OOM}$$/ OFRr&ur tbqJn=s?

26

Dan janganlah sebahagian kamu memakan harta sebahagian yang lain di antara kamudenganjalanyangbathildan(janganlah)kamumembawa(urusan)hartaitu kepada hakim, supaya kamu dapat memakan sebahagian daripada harta benda orang lain itu dengan (jalan berbuat) dosa, padahal kamu Mengetahui. (Q.s. al Baqarah/2:188)

(2). Bahwa mengambil keuntungan melalui jual beli yang tanpa paksaan itudibolehkan,sepertiyangdijelaskandalamsuratalNisa/4:29

$ygr't %!$# (#qYtB#u w (#q=2's? N3s9uqBr& M6oYt/ @t69$$/ Hw) br&


....

cq3s? otpgB `t <#ts? N3ZiB

Hai orangorang yang beriman, janganlah kamu saling memakan harta sesamamu denganjalanyangbatil,kecualidenganjalanperniagaanyangberlakudengansuka samasukadiantarakamu...(Q.s.alNisa/4:29)

(3) Bahwa harta anakyatim yang berada dalam pengawasan seseorang harus dijaga sebaikbaiknya sebelum diserahkan kepada pemiliknya setelahiadewasasepertiyangadadalamsuratalNisa/4:6 (4) AlQur'an mengancam keras orang yang berusaha memiliki harta orang lain dengan cara sewenangwenang dengan hukuman neraka (Q.s.alNisa/4:10)

b) t%!$# tbq=2't tAuqBr& 4yJtGu9$# $J= $yJR) tbq=2't NgRq/ #Y$tR ( cqn=uyur #Zy
Sesungguhnya orangorang yang memakan harta anak yatim secara zalim, Sebenarnya merekaitu menelanapisepenuhperutnyadan merekaakan masukke dalamapiyangmenyalanyala(neraka).(Q.s.alNisa/4:10)

2.PenggerakkepadaKebaikan Seperti yang dijelaskan dalam surat alSyams/91:8 ( ) bahwa manusia secara fitri diciptakan Tuhan dengan memiliki perangkat untukmengetahuikebaikandankeburukan,dansuratalBalad/90:10( ) menyebutkan bahwa kepada manusia diberi peluang untuk memilih satu di antara dua jalan hidup yang telah disediakan, jalan kebajikan dan jalan kejahatan. Untuk itu, pada setiap manusia terdapat faktorfaktor penggerakuntukmenujukeduajalanitu.Jikapenggerakataumotifkepada kejahatan bersumber dari hawa nafsu yang digelitik oleh waswas setan

27

untuksegeramencarijalanpemuasannya,makapenggerakkepadakebaikan sebenarnya merupakan gabungandariberbagaimotifyangdiorganisiroleh 'aqldanqalb Meskipun manusia telah memiliki potensi kebaikan, tetapi penggerak kepada kebaikan tidak muncul dari ruang kosong, melainkan daripengalamanperjalananhidupseseorang,daribudayadimanaorangitu hidup,dandarikegiatanyangdilakukanolehmasingmasingorang.Orang yang berada dalam lingkungan maksiat tanpa ada stimulus kebaikan yang mengimbanginya, maka penggerak kepada keburukan akan lebih subur pada orang itu. Sebaliknya orang yang hidup di tengah lingkungan yang sehatdanbaik,daniasendirimenempuhcarahidupyangbaiksepertiyang dilakukan oleh orang lain, maka penggerak kepada kebaikan akan muncul dan terpelihara. Dalam lingkungan yang kondusif pada kebaikan, akal dan qalb dapat mengorganisir tuntutan berbagai dorongan psikologis dalam dirinya untuk diarahkan sesuai dengan iklim psikologis dimana orang itu hidup. Orang yang mengalami penderitaan karena dizalimi oleh sistem sosial, jika dorongan kepada kejahatan (negatif)nya yang lebih dominan, maka dorongan psikologis yang berkembang pada orang itu adalah motif balas dendam. Sedangkan bagi orang yang potensi kebaikan (positif)nya lebihkuat,ketikamengalamipenderitaankarenadizalimiolehsistemsosial, maka dorongan psikologis yang tumbuh dalam dirinya adalah motif untuk membelasesamaorangtertindas.Orangyangmemilikimotifbalasdendam, tingkah lakunya destruktif dan tidak terkendali, dan kepuasannya tercapai jika melihat lawannya menderita. Sedang orang yang menuruti motif membela sesama kaum tertindas, tingkah lakunya tetap terkendali dan pemuasannya bukan pada melihat kekalahan lawan, tetapi pada kemenanganorangyangdibela. Muncul dan suburnya penggerak atau motif kepada kebaikan juga berhubungan dengan cara hidup. Jika seseorang menempuh jalan hidup yang sesat, jauh dari petunjuk agama, maka penggerak kepada kebenaran terhalang pertumbuhannya, tetapi jika jalan hidupnya mengikuti petunjuk agama,berimandanmelakukanamalsaleh,makasepertiyangdiisyaratkan surat Yunus/109, potensi iman yang ada di dalam hatinya mendesak dan mempengaruhinyauntukmelakukankebaikan.
....

b) %!$# (#qZtB#u (#q=Jtur Mys=9$# Ogku Nk5u Nk]yJ*/

Sesungguhnya orangorang yang beriman dan mengerjakan amalamal saleh, mereka diberipetunjukolehTuhanmerekaKarenakeimanannya....(Q.s.Yunus/10:9)

Dari ayat di atas dapat disimpulkan bahwa antara motif dan perbuatan terdapat hubungan saling isi mengisi. Motif kepada kebaikan

28

yang direspons dengan perbuatan baik, akan menyuburkan motif kepada kebaikan. Sebaliknya amal saleh yang dilakukan terus menerus juga akan menumbuhkan motifmotif baru kepada kebaikan. Seperti orang yang melakukan kemaksiatan dapat tenggelam dalam lumpur kemaksiatan, sehingga ia tidak bisa bangkit kembali, maka terbang melayanglayang di langit kebajikan akan memperluas wilayah dan memperkuat daya jelajah dorongankepadakebajikan. Sejalan dengan itu, Rasulullah pernah mengatakan bahwa menempuhjalanilmuakanmemudahkanseseorangmencapaisorga.
) (

Orang yang berbahagia adalah orang yang merespons secara positif dorongan psikologis kepada kebaikan yang ada dalam dirinya, selanjutnya ia merasa tenang dengan pilihannya, patuh kepada perintah Allah dan melakukan secara maksimal perbuatan kebajikan. Orangorang yang mencapai tingkatan ini diterangkan oleh alQur'an dalam surat al Taubah/9:112

cq6-F9$# cr7y9$# crJpt:$# cqs9$# cq29$# crf9$# tbrBFy$# $ryJ9$$/ cqd$Y9$#ur `t x6YJ9$# tbqys9$#ur rt: !$# 3 eo0ur ZBsJ9$#
Mereka itu adalah orangorang yang bertaubat, yang beribadat, yang memuji, yang melawat,yangruku', yangsujud, yang menyuruhberbuat ma'rufdan mencegahberbuat munkar dan yang memelihara hukumhukum Allah. dan gembirakanlah orangorang mukminitu.(Q.s.alTaubah/9:112)

3.PenggerakuntukMengetahui Manusia sebagai makhluk yang berpikir, jika melihat sebuah kejadian, maka dalam dirinya timbul pertanyaan tentang kejadian yang dilihatnya,apayangterjadi,apapenyebabnyadanapaakibatnya,dandalam dirinya muncul dorongandorongan psikologis untuk mengetahui hakikat darikejadianyangdilihatnyaitu.Doronganinilahyangdisebutmotifingin tahu. Motif ingin tahu yang merupakan tabiat manusia itu menggerakkan manusia untuk meneliti, mengungkap dan mencari sebab akibat dari apa saja fenomena yang menarik perhatiannya. Karena perhatian manusia berbedabeda. Ada orang yang berusaha mengetahui secara detail tentan

29

bendabendakecil,yanglaintertarikuntukmengetahuisecaradetailtentang sistemjagadrayasampaikepadahubungandengansangPencipta. Besar kecilnya motif ingin tahu ini berhubungan dengan kapasitas intelektualseseorang.Semakintinggi kapasitasintelektualseseorangmaka semakin kuat motivasinyauntuk mempelajaribidangbidangyang menjadi perhatiannya, dan pada akhirnya orang yang kuat kecerdasannya memungkinkannya untuk selalu menambah pengetahuannya dan menonjol dibandingoranglain. Motif ingin tahu manusia tampak dalam beberapa bentuk, antara lain,banyakbertanyatentangsuatuhalkarenaiainginmengatasikesulitan pemahamannya, atua ingin menjelaskan tentang hal itu. Wujud lain dari motif ingin tahu adalah keinginan untuk mengetahui realitas baru, atau untukmenghilangkankeraguantentanghalyangsudahdiketahuinya. ContohmotifingintahuyangdisebutkanalQur'anadalahapayang dilakukan oleh Nabi Ibrahim seperti yang dijelaskan surat al Baqarah/2:260.

)ur tA$s% Odt/) b>u Rr& y#2 s? 4tAqyJ9$# ( tA$s% Ns9urr& `Bs? ( tA$s% 4n?t/ `3s9ur `yJuj9 <=s% ( tA$s% s Zpyt/r& z`iB 9$# `ds y7s9) OO @y_$# 4n?t e@. 9@t6y_ `k]iB #[_ OO `g$# y7oY?'t $\y 4 Nn=$#ur br& !$# t L3ym
Dan(Ingatlah)ketikaIbrahimberkata:"YaTuhanku,perlihatkanlahkepadakubagaimana Engkau menghidupkan orangorang mati." Allah berfirman: "Belum yakinkah kamu ?" Ibrahim menjawab: "Aku Telah meyakinkannya, akan tetapi agar hatiku tetap mantap (dengan imanku) Allah berfirman: "(Kalau demikian) ambillah empat ekor burung, lalu cincanglah semuanya olehmu. (Allah berfirman): "Lalu letakkan diatas tiaptiap satu bukit satu bagian dari bagianbagian itu, Kemudian panggillah mereka, niscaya mereka datangkepadamudengansegera."danKetahuilahbahwaAllahMahaPerkasalagiMaha Bijaksana.(Q.s.alBaqarah/2:260)

Ayat di atas diisyaratkan bahwa sebenarnya Nabi Ibrahim sudah percayabahwaAllahMahaKuasa,hinggabisamematikanyanghidupdan menghidupkanyangmati.Akantetapiyangmengelitikdoronganingintahu Ibrahim adalah bagaimana proses penghidupan yang telah mati itu berlangsung.IbrahimmenanyakanhalitukepadaTuhanbukankarenatidak percaya kekuasaan Tuhan, tetapi dengan pengetahuan yang lebih detail ia berharaphatinyamenjaditenang,karenapengetahuannyabukanlagiilmal yaqin tetapi sudah ayn alyaqin. Tuhan mengabulkan permintaan Ibrahim untuk mendemontrasikan proses penghidupan burung yang mati seperti yangdisebutdalamsuratalBaqarah/2:260diatas.

30

Dorongan ingin tahu yang dimiliki Ibrahim memang sangat kuat, menyangkut hal yang sangat tinggi. Surat alAn'am /6:7579 berisi kisah Ibrahim ketika masih muda. Dalam usia muda, Ibrahim sudah sangat tergelitik hatinya untuk ingin tahu siapa Tuhan yang sebenarnya, yakni ketikamemperhatikanfenomenaalam,bintang,bulandanmatahari. Dorongan ingin tahu Ibrahim itu, akhirnya mengatarnya pada keyakinan adanya Tuhan Yang Maha Kuasa yang menciptakan alam yang semula menarik perhatiannya itu. Pertanyaan Ibrahim di seputar bintang, bulan dan matahari seperti yang dijelaskan dalam surat alAn'am/6:7579, sebenarnya bukan dialog yang berlangsung dalam satu hari munculnya bintang, bulan dan matahari, karena pertanyaan tersebut sebenarnya merupakanperenunganpanjangseorangpemikir. 4.PenggerakuntukTetapHidup Gerakan manusia yang secara konsisten menghindar dari sengatan panas, dari kebekuan dingin, dari kekurangan oksigen sebenarnya merupakanwujuddariadanyamotifingintetaphidup.Gerakanmenghindar itu berkembang menjadi usaha aktif mempesiapkan diri mengantisipasi kebutuhankebutuhan yang diperlukan di berbagai medan dan cuaca, dan kebutuhan itupun berkembang dari kebutuhan primer ke kebutuhan kebutuhan yang bersifat sekunder dan penunjang. Itu semua dilakukan karenaadanyadoronganuntuktetapeksis. Jadimotifuntuktetaphidupadalahdoronganpadadirimanusiayang menggerakkannya untuk selalu menjaga keberadaan dirinya dan menjauhi halhal atua tempattempat yang membahayakan dirinya serta mempersiapkan diri dengan latihanlatihan agar dapat mengatasi keadaan danmemenuhikebutuhankebutuhanyangdiperlukandalamhidupnya. Dalam keadaan normal, usaha manusia dalam mempertahankan hidupnya bersifat wajar dan positif, tetapi dalam keadaan kritis di man aterdapat konflik interest, maka motif ingin tetap hidup ini bisa bekerja secaranegatif.Dalamkeadaanperangmisalnya,dimananegaradanbangsa membutuhkan pengorbanan prajurit, usaha untuk tetap hidup bagi prajurit bisaberwujudkeberanianberperanghabishabisanmelawanmusuhsampai menang (positif), atau didorong oleh rasa takut kemudian lari dari medan perang(negatif). AlQur'an surat alTaubah/9:8687, memberikan contoh bentuk negatif dari perbuatan orang yang berusaha tetap hidup tetapi dengan cara yangbertentangandengankemaslahatanbersama,yaituapayangdilakukan olehorangmunafikMadinah.Merekatakutmatidaningintetaphidup,oleh karena itu mereka memilih dipersamakan dengan wanita, anakanak dan orangtuayangtidakmemilikikemampuanberperangmembelatanahair.

31

!#s)ur Ms9R& ouq br& (#qZB#u !$$/ (#rgy_ur ytB &!qu y7tRxtG$# (#q9'r& Aq9$# OgZB (#q9$s%ur $tRs `3tR yB ts)9$# (#qu br'/ (#qRq3t ytB #9#uqy9$# y7ur 4n?t Nk5q=% Ogs w cqgs)t
Dan apabila diturunkan suatu surat (yang memerintahkan kepada orang munafik itu): "Berimanlah kamu kepada Allah dan berjihadlah beserta RasulNya", niscaya orang orangyangsanggupdiantaramerekamemintaizinkepadamu(untuktidakberjihad)dan merekaberkata:"Biarkanlahkamiberadabersamaorangorangyangduduk".Merekarela berada bersama orangorang yang tidak berperang[653], dan hati mereka Telah dikunci mati Maka mereka tidak mengetahui (kebahagiaan beriman dan berjihad). (Q.s. al Taubah/9:8687)

ContohlainyangdiberikanalQur'anadalahapayangdilakukanoleh kaumBani Israil ketikadiajak memasukitanah(Palestina)yangdijanjikan Tuhan setelah mereka dibebaskan dari penjajahan Firaun. Dalam surat al Maidah/5:21dikisahkanbahwaNabiMusasudahmengingatkankaumBani Israilagartidaklaridarimedanperang,karenatakutkepadamusuh( ). Akan tetapi keinginan mereka untuk tetap hidup dan takut mati menyebabkan mereka menolak ikut berperang menaklukkan penguasa Palestina, sebaliknya mereka bahkan dengan tanpa malu menyuruh Musa bekerjadanmerekatinggalmemetikbuahnya.

(#q9$s% #yqJt b) $pk $YBqs% t$7y_ $R)ur `s9 $ygn=zR 4Lym (#q_s $ygZB b*s (#q_s $ygZB $R*s cq=zy
Merekaberkata:"HaiMusa,Sesungguhnyadalamnegeriituadaorangorangyanggagah Perkasa,Sesungguhnyakamisekalikalitidakakanmemasukinyasebelummerekakeluar daripadanya.jika merekake luardaripadanya,pastikamiakan memasukinya".(Q.s.al Maidah/5:22)

(#q9$s% #yqJt $R) `s9 !$ygn=zR #Yt/r& $B (#qB#y $yg ( =yd$$s |MRr& /uur IxGs)s $R) $oYgyd crs%
Mereka berkata: "Hai Musa, kami sekali sekali tidak akan memasuki nya selama lamanya, selagi mereka ada didalamnya, Karena itu pergilah kamu bersama Tuhanmu, dan berperanglah kamu berdua, Sesungguhnya kami Hanya duduk menanti disini saja". (Q.s.alMaidah/5:24)

32

Dorongan ingin tetap hidup dapat direspons secara positif maupun secaranegatif.Responssecaranegatifterhadapdoronganingintetaphidup adalah seperti yang dilakukan oleh prajurit yang lari dari medan perang, atau demi keselamatan dirinya sanggup mengkhianati bangsa sendiri denganbersekongkoldenganmusuh.Doronganyangkuatuntuktetaphidup jugadapat mendistorsipandangan.Dimataseorangpengkhianat,kehinaan itutidakterasa,dannyawaoranglainsangatmurahharganya,tapiiasendiri takutmati,dankarenadistorsipandangan,makaiatidakmelihatnilailebih dari keberanian seorang pejuang. Orangorang Yahudi seperti yang diceritakandalamsuratalMaidah/5:24diatas,meskipunsudahmendengar janji Musa bahwa mereka akan dimenangkan oleh Allah, tetapi kekuatan mereka akan mati dan keinginan mereka untuk tetap hidup mendistorsi pandangan pandangan mereka terhadap kemenangan, sehingga mereka tidakmemenuhipanggilanjihadyangdikumandangkanolehMusa,padahal mereka telah melihat bukti bahwa Musa sebelumnya telah berhasil membebaskanmerekadaribelenggupenjajahanFiraun. Pada masa Nabi, kaum Yahudi Madinah juga mengalami distorsi pandanganterhadapapayangtelahmerekasaksikansendiripadadiriNabi dankaumMuslimin.

!$Js9urr& N3Gu;|r& pt7B s% L6|r& $pkn=ViB L=% 4Tr& #xyd ( @% uqd `B Y N3Rr& 3 b) !$# 4n?t e@. &x s% !$tBur N3t7|r& tPqt s)tG9$# b$yJpg:$# b*6s !$# zNn=u9ur tZBsJ9$# zNn=u9ur t%!$# (#q)s$tR 4 @%ur Nlm; (#qs9$ys? (#q=Gs% @6y !$# rr& (#qs$# ( (#q9$s% qs9 Nn=tR Zw$tF% N3oYt7?^w 3 Nd 6=9 >tBqt >t%r& Nk]B `yJM~9 4 cq9q)t Ngduqr'/ $B }s9 Nk5q=% 3 !$#ur Nn=r& $o3 tbqJF3t t%!$# (#q9$s% NkXuqz\} (#rys%ur qs9 $tRq$sr& $tB (#q=F% 3 @% (#ru$$s `t N6Rr& |NqyJ9$# b) LZ. t%| >
Dan Mengapa ketika kamu ditimpa musibah (pada peperangan Uhud), padahal kamu Telah menimpakan kekalahan dua kali lipat kepada musuhmusuhmu (pada peperangan Badar), kamu berkata: "Darimana datangnya (kekalahan) ini?" Katakanlah: "Itu dari (kesalahan) dirimu sendiri". Sesungguhnya Allah Maha Kuasaatas segala sesuatu. Dan apayangmenimpakamupadaharibertemunyaduapasukan,Maka(kekalahan)ituadalah dengan izin(takdir) Allah,danagarAllah mengetahui siapaorangorang yangberiman.

33

Dan supaya Allah mengetahui siapa orangorang yang munafik. kepada mereka dikatakan: "Marilah berperang di jalan Allah atau pertahankanlah (dirimu)". mereka berkata: "Sekiranyakami mengetahuiakanterjadi peperangan,tentulah kami mengikuti kamu. mereka pada hari itu lebih dekat kepada kekafiran dari pada keimanan. mereka mengatakandenganmulutnyaapayangtidakterkandungdalamhatinya.danAllahlebih mengetahui dalam hatinya.dan Allah lebih mengetahuiapayang merekasembunyikan. Orangorang yang mengatakan kepadasaudarasaudaranyadan merekatidakturut pergi berperang: "Sekiranya mereka mengikuti kita, tentulah mereka tidak terbunuh". Katakanlah: "Tolaklah kematian itu dari dirimu, jika kamu orangorang yang benar". (Q.s.alImran/3:165169)

Surat alImran/ 3:165169, juga mengisyaratkan adanya distorsi pandangan pada orang munafik terhadap apa yang telah mereka ketahui sebelumnya. Orangorang munafik pada zaman Rasul, meskipun berkali kali mereka membuktikan kebenaran yang disampaikan oleh Rasul dan berkalikali kebusukan hati mereka itu dibongkar, tetapi keinginan untuk tetap hidup dan takut mati mendistorsi pandangan mereka terhadap kebenaran, baik kebenaran ajaran maupun kebenaran sejarah, sehingga mereka tetap tidak bisa belajar dari sejarah. Surat alImran/ 3:167 di atas, mengisyaratkan bagaimana orang Yahudi mengejek Nabi dan kaum mukminin sebagai orang yang tidak tahu taktik perang setelah melihat kekalahan kaum muslimin dalam perang uhud, meskipun mereka mengetahuikemenanganyanglebihdahsyatolehnabidankaum muslimin padaperangsebelumnya(perangBadar). 5.PenggerakkepadaKematiansebagaiSyahid Meskipun manusia takut mati dan ingin tetap hidup, tetapi semua manusiamati,sukaatautidaksuka.Bagiorangyangingintetaphidup,mati adalah sesuatu yang menakutkan, oleh karena itu ia bersedia melakukan apapun demi menghindarkan diri dari mati. Sedangkan bagi orang yang mengutamakan makna hidup, mati tidak harus menakutkan, tergantung bagaimana caranya mati, apakah sejalan dengan makna hidup yang diperjuangkanatautidak. Orangkafiryangtidakmempercayaiadanyakehidupanakhirat,takut kepada kematian karena ia tidak tahu apa yang ada di balik kematian. Ketakutan orang kafir kepada mati seperti ketakutan orang kepada kegelapan, yakni takut kepada halhal yang tidak diketahuinya. Perasaan takut kepada hal yang diketahui dapat dicarikan jalan keluar untuk mengatasinya, tetapi takut kepada hal yang tidak diketahui hanya bisa diatasi dengan pengetahuan. Dalam satu perspektif, orang mukmin memandang dunia ini sebagai penjara , oleh karena itu ia merindukan untuk segera keluar kea lam bebas (hidup di akhirat), sementara orang kafir memandang dunia sebagai sorga, ( ), oleh karena itu mereka takut dikeluarkan dari tempat yang menyenangkan itu
) (

34

(mati). Orang kafir memandang mati sebagai kematian yang gelap, sedangkanorangmukminmemandangkematiansebagaikehidupandialam lain yang lebih menjanjikan. Oleh karena itu orang mukmin justru merindukan datangnya mati syahid, karena kesyahidan merupakan pintu kehidupan akhirat yang lebih menyenangkan disbanding kehidupan di dunia. Term syahid disebut alQur'an dalam berbagai kata bentukannya 24 sebanyak160kali, hampirsemuanyamengandungmaknakesaksian( 25 ), baik yang berkenaan dengan Tuhan maupun yang berkenaan dengan manusia. Kata yang berkenaan dengan mati hanya terdapat dalamsuratalNisa/4:69,yangmenyatakanbahwaorangyangmatisyahid kelakakandikumpulkanbersamaparaNabidanorangorangsalih

`tBur !$# tAq9$#ur y7s9'r's ytB t%!$# zNyRr& !$# Nkn=t z`iB z`h;Y9$# t)d_9$#ur !#ypk9$#ur ts=9$#ur 4 z`ymur y7s9'r& $Z)u
Dan barangsiapa yang mentaati Allah dan Rasul(Nya), mereka itu akan bersamasama dengan orangorang yang dianugerahi nikmat oleh Allah, yaitu: Nabinabi, para shiddiiqiin orangorang yang mati syahid, dan orangorang saleh. dan mereka Itulah temanyangsebaikbaiknya.(Q.salNisa/4:69)

Dari kata syahid yang bermakna kesaksian itu, maka para mufasir tidak memberi kepastian bahwa orang mati syahid itu hanya yang gugur dalam memerangi orang kafir. Imam Fakhr alRazi misalnya lebih menekankan bahwa orang mati syahid adalah orang yang mati dalam 26 rangka kesaksiannya atas kebenaran Islam. Dalam bahasa Arab, ijazah ataudiplomajugadisebutsyahadahkarenalembarankertasitumemberikan 27 kesaksianatastingkatankeilmuanpemiliknya. Mati syahid juga disebut alQur'an dengan ungkapan gugur dalam peperangan di jalan Allah atau jihad fi sabilillah seperti yang dijelaskan dalamsuratalImaran/3:169,( )yangmempunyai arti janganlah kamu mengira orangorang yang gugur di jalan Allah itu mati. Motif orang mukmin untuk berani mati syahid adalah karena kesaksiannya(syahadadengan matahati)dankeyakinannyaatasapayang
Lihat misalnyaQ.s.alMa'arij/70:33,Q.s.alNur/ 24:6,8Q.s.alMaidah/ 5:107, Q.salHasyr/ 59:22,Q.s.alRad/ 13:9,Q.s.alMaidah/5:108,Q.s.alBaqarah/ 2:23dan Q.s.alNur/24:13 25 AlRaghibalIsfahani,op.cith.274275 26 ImamFakhralRazi,op.citjuzX,h.174 27 Ahmad Warson Munawwir, alMunawir, Qamis Arabi Indunisi, (Yogyakarta: PesantrenalMunawir,1984),h.799
24

35

akan diperoleh di alam akhirat, yakni apa yang dinilainya lebih baik disbanding yang ada dalam kehidupan di dunia. Dalam hadits Nabi disebutkanbahwahidupdiduniabagiorangmukminitubagaikanberadadi penjara,sementarabagiorangkafirmerekamerasaberadadisorga( ). Hadits ini mengisyaratkan bahwa orang mukminitumerindukan keindahanyangberadadiluardunianya(akhirat), sementara orang kafir takut kehilangan kesenangan duniawi yang sedang dinikmatinya. AlQur'an menginformasikan kepada orang mukmin calon calon syahid bahwa orang yang gugur syahid di jalan Allah sebenarnya 28 tidakmati,tetapitetaphidup( ),
29 dan tetap memperoleh rizki dari Allah ( ). Dalam al Qur'an srat Muhammad/47:4, Allah menjanjikan kepada mereka bahwa 30 amal mereka tidak akan siasia ( ), diampuni

dosanya (

31 ), memperoleh pahala yang besar (


32 33 ), danmasuksorga( ). Orangyang berperang di jalan Allah menunjukkan keberanian yang luar biasa karena disamping merindukan pahala dan keberuntungan ukhrawi juga karena dijanjikanakanmemperolehbantuandariTuhan. Analisis tentang keberanian kaum Muslimin dalam perang Badar yang sebenarnya tidak imbang, dapat diuraikan suasana batin mereka sebagaiberikut: a. Mereka telah lama hidup menderita kekurangan di Madinah, padahal mereka memiliki harta yang tertinggal di Makkah tetapi tidak dapat diambil karena diblokadi orang kafir Makkah. Ketika secara tidak terdugaberhadapandengantentara kafirMakkahyang menyusuluntuk menyelematkan kafilah dagang mereka dari cegatan kaum muslimin, merekatidakpunyaipilihanlainkecualiharusmenghadapinya. b. Mereka merasa yakin keputusan untuk berperang itu benar karena dipimpinlangsungolehRasul. c. Rasul selalu memompa semangat prajuritnya dengan janji pertolongan Allahbagiorangyangsabar. d. Rasul menggambarkan keindahan sorga sebagai sesuatu yang sangat dekat, yang cepat diraih karena ia ada dibalik kesyahidan, sehingga suasana batin prajurit Islam adalah akan masuk sorga yang lebih baik

28 29 30 31 32 33

LihatQ.s.alBaqarah/2:154danQ.s.alImran/3:169 LihatsuratalHajj/22:58dansuratalImran/3:169 Q.s.Muhammad/47:4 Q.s.AllImran/3:195 Q.s.alNisa/4:74 Q.s.alTaubah/9:111danQ.s.alImran/3:195

36

disbandinghidupdidunia.Merekamenyongsongmautdengangembira sepertigembiranyaorangmenujutempatyangmenyenangkan. e. Pada saatsaat akhir menjelang perang missal, setelah Rasul melihat tandatanda pertolongan Tuhan dengan datangnya malaikat Jibril, atas perintah Rasul disebarkan kepada para prajurit bahwa para malaikat 34 telahdatanguntukmembantukaummuslimin. Gabungan dari informasi dan sugesti itu memenuhi batin para prajurit,sehinggahatimerekamerasalonggar,ancamanmautterasasebagai kompetisiyang menantang, motifuntuk membunuhorang kafirbergabung dengan motif untuk memperoleh kesyahian sehingga suasana batin kaum musliminyangsedikititubenarbenarpadu,utuhdankentaltanpamemberi celahsedikitpunkepadakeraguandankebimbangan. Motif mati syahid berbeda dengan instink thanatos dalam teori Psikoanalisa, karena karakter thanatos itu agressif yang bersifat 35 destruktif. , sementara motif mati syahid, meskipun samasama agresif tetapi tidak destruktif. Ia berdiri di atas nilainilai mulia, yaitu menghancurkan kebatilan dan menegakkan kebenaran, sementara thanatos bekerjahanyauntukmencaripemuasanmotifkebencian. 6.PenggerakkepadaHubunganSeks

Perang Badar adalah peperangan yang terjadi antara kaum Muslimin Madinah dibawahkomandoRasulmelawankaumQuraysyMakkah.Peperanganinitermasuktidak direncanakan, karena yang menjadi pemicu adalah pencegatan oleh kaum muslimin Madinahatas kafilahdagangQuraysy.Kaummusliminmelakukanpencegatanitukarena merekamemilikihartadiMakkah,tetapitidakdapatdiambilkarenadihalangiolehorang kafir Makkah. Dalam keadaan tidak berencanaitulahakhirnya berhadapanduakekuatan yangtidakberimbangjumlahnya.AkantetapidalampeperanganitukaumMusliminyang kekuatannya hanya sepertiga lawan justru memperoleh kemenangan besar. Kemenangan itu antara lain disebabkan karena taktik strategi yang jitu, ditambah kerinduan kaum muslimin menggapai syahadah. Faktor yang secara psikologis sangat mendorong motivasiparasahabatNabiketikaituadalahpemberitahuankepadamerekapadasaatsaat genting tentang datangnya malaikat Jibril memantu kaum muslimin.Nabimemberitugas kepadaAbuBakaruntukmenyebarluaskanberitatersebutkepadaprajurit,absyiryaAba Bakr, ataka nashrullah, hadza Jibril akhidzun bi'inani farshi yaquduhu 'ala alNaqa (H.R. Bukhari). Lihat Muhammad Said Ramadlan al Buwaythi, Fiqh alSIrah, Dirasah ManhajiyahIlmiyahliSirahalMusthafawamaTanthawialaybiminidzatwamabadiwa ahkam (tt. Dar al Fikr, 1990), h. 19992333. LIhat juga Ibn Hisyam, alSirah al Nabawiyah,(Beirut,DaralJayl,1987),jilidII,h.186199) 35 Menurut teoriPsikoanalisa, tingkahlakumanusia berkisarpadapengaruh motif kehidupan (eros) dan motif kematian (thanatos). Eros mendorong manusia untuk mempertahankan eksistensinya, sementara thanatos justru mendorong untuk nekat meski harus menemui kematian. Lihat Jalaluddin Rahmat, Psikologi Komunikasi (Bandung: Remaja Karya, 1986), h. 2239. Lihat pula Sigmund Freud Sekelumit Sejarah Psikoanalisa,terjemahanK.Bertens(Jakarta:Gramedia,1986)

34

37

$pkr't $Z9$# (#q)?$# N3-/u %!$# /3s)n=s{ `iB <R ;oynur t,n=yzur $pk]B $ygy_ry ]t/ur $uKk]B Zw%y` #ZWx. [!$|Sur 4 (#q)?$#ur !$# %!$# tbq9u!$|s? m/ tP%tnF{$#ur 4 b) !$# tb%x. N3n=t $Y6%u
Haisekalianmanusia,bertakwalahkepadaTuhanmuyangTelahmenciptakankamudari seorangdiri,dandaripadanyaAllahmenciptakanisterinyadandari padakeduanyaAllah memperkembangbiakkanlakilakidanperempuanyangbanyak.danbertakwalahkepada Allah yang dengan (mempergunakan) namaNya kamu saling meminta satu sama lain, dan (peliharalah) hubungan silaturrahim. Sesungguhnya Allah selalu menjaga dan Mengawasikamu.(Q.s.alNisa/4:1)

Dari ayat di atas, dapat dipahami bahwa manusia diciptakan Tuhan bermula hanya lakilaki seorang diri, kemudian daripadanya diciptakan istrinya, dan dari pasangan suami istri inilah berkembang biak ummat manusia. Proses pengembangbiakan manusia melalui proses yang dewasa ini dikenal dengan istilah reproduksi manusia, yakni satu proses yang didahului oleh pertemuan spermatozoa lakilaki dengan sel tulur wanita yang kemudian berkembang menjadi janin, dan seterusnya lahir manusia barukedunia.Prosespertemuanspermadenganindungtelurbukansemata mata kejadian pertemuan dua unsure, tetapi dikemas dalam suatu tingkah lakumanusiayangdisebutpersetubuhanatauhubunganseks.Secarasocial, pengembangbiakan manusia itu didahului dengan adanya ketertarikan hubungan antara lakilaki dan perempuan yang kemudian setelah melalui prosedur yang diperlukan dalam system nilai social, keduanya melakukan kontak badan yang disebut dengan hubungan seks itu. Bagi manusia, hubungan seks merupakan hal yang menyenangkan dan penuh dengan suasana, berkaitan dengan reproduksi maupun tidak, karena manusia memiliki dorongan untuk berhubungan seks yang memutuhkan pemuasannya. Jadimotifkepadahubunganseksmerupakandoronganbiologisyang bersifat fitri, yang selalu menuntut untuk dipuaskan. Pengaruh dari doronganitumenyebabkanmanusiamenyukailawanjenisnya,danmereka merasa terpuaskan ketika mereka melakukan hubungan badan. Motif kepada hubungan seks yang ada dalam diri manusia relatif konstan, oleh karena itu jika tidak memperoleh penyaluran yang memuaskan, dapat mendatangkan ketidakseimbangan tingkah laku. Dalam rangkaian ibadah puasamisalnya,alQur'andalamsuratalBaqarah/2:185,mengikutibahwa dorongankepadaseksitusangatkuat( )sehinggaal Qur'an memberikan kelonggaran untuk menyalurkannya pada malam hari bulan Ramadhan. Surat Yusuf/ 12:53, juga mengisyaratkan kuatnya motif

38

kepada hubungan seks, karena jika dilihat konteks kisah dalam ayat itu maka kalimat menunjukpadamotifkepadahubunganseks yangdimilikiZulaykha. Karenamotifkepadahubunganseksitubersifatfitri,makaalQur'an bukan hanya tidak melarang, tetapi mengaturnya agar pemuasan dorongan kepada seks itu tidak bertentangan dengan kemaslahatan manusia itu sendiri. Oleh karena itu, alQur'an mencela tingkah laku seksual menyimpang, baik menyimpang dari norma maupun menyimpang dari kelaziman. AlQur'an memberikan pedoman bagaimana merespons motif kepada hubungan seks dengan caracara yang benar dalam bentukbentuk sebagaiberikut: a. Hubungan seks hanya dibenarkan bagi orang yang terikat tali perkawinan, oleh karena itu manusia yang sudah memenuhi syarat dianjurkan untuk menikah atau diberi peluang untuk menjalani hidup dalam ikatan pernikahan, seperti yang dipaparkan dalam surat alNur/ 24:32 ) b. Dalam keadaan tertentu, demi untuk menghindarkan diri dari tingkah laku seks menyimpang, poligami diizinkan tetapi dibatasi hanya maksimal empat, meskipun pernikahan yang ideal menurut alQur'an adalahmonogamy,sepertiyangdipaparkandalamsuratalNisa/4:3

b)ur Lz wr& (#q)? 4uKtGu9$# (#qs3R$$s $tB z>$s N3s9 z`iB !$|iY9$# 4o_WtB y]n=Our yt/ur ( b*s OFz wr& (#q9s? oynuqs
c. Bagi orang yang karena suatu hal tidak atau belum menikah, tetap diharuskanmemeliharakesucianhidupseksualnya,sepertiyangterdapat dalamsuratalnur/24:33

#tGu9ur t%!$# w tbrgs %n%s3R 4Lym NkuZ !$# `B &#s


d. Perbuatan zina dipandang sebagai tingkah laku menyimpang dan perbuatan dosa yang harus dihukum secara amat keras, seperti yang terdapatdalamsuratalNur/24:23,danQ.s.alFurqon/25:68).

puR#9$# T#9$#ur (#r$#_$$s @. 7nur $yJk]iB sps($B ;ot$#y_ ( wur /.{'s? $yJk5 ps&u !$#

39

e. Meskipun pernikahan menghalalkan hubungan seksual, tetapi etika dan kesehatan hubungan seksual harus tetap dipelihara, seperti dilarang melakukan hubungan seks kecuali istri sedang dalam keadaan suci, sepertiyangdijelaskandalamsuratalBaqarah/2:2222333( ) f. Hubungansekssejenis,homodanlesbidipandangsebagaitingkahlaku seksual menyimpang yang dilarang seperti yang diisyaratkan surat al Naml/27:5455,dansuratalSyuara/26:165166( ) g. Untuktidakmerangsangmotifkepadahubungansekssecaratidakbenar, alQur'anmelarangmendekatihalhalyangmerangsangperbuatanzina, seperti diisyaratkan surat alIsra/ 17:32, ( ), dan Nabi menganjurkannya dengan menjalankan puasa, karena puasa dapat 36 menekandorongankepadaseks( ). 8.PenggerakkepadaPermusuhan Isyarat bahwa manusia memiliki motif kepada permusuhan antara yang satu dengan yang lain dapat dilihat pada surat alBaqarah/2:30, yang menyebutkanpertanyaan malaikat kepadaTuhanatasdiciptakannya Adam sebagaikhalifahdibumi.MalaikatberkatakepadaTuhan:ApakahEngkau menjadikan khalifah di bumi itu orang yang akan membuat kerusakan padanya dan menumpahkan darah ( ). Perbuatan menimbulkan kerusakan dan menumpahkan darah merupakan wujud dari adanya permusuhan. Adanya motif permusuhan pada manusia dijelaskan lagiolehalQur'ansebagaiberikut:

tA$s% (#q7d$# /3t/ Ct79 Art ( /3s9ur F{$# @s)tGB tFtBur 4n<) &m
Allah berfirman: "Turunlah kamu sekalian, sebahagian kamu menjadi musuh bagi sebahagian yang lain. dan kamu mempunyai tempat kediaman dan kesenangan (tempat mencari kehidupan) di muka bumi sampai waktu yang Telah ditentukan". (Q.s. al Araf/7:24)

Surat alA'raf/ 7:24, dan juga alBaqarah/2:36, secara tegas menyatakan bahwa setelah manusia diturunkan ke bumi sebagai khalifah Allah, di antara mereka terlibat permusuhan. Ayat ini juga dapat menjadi informasi bahwa pada setiap manusia memang memiliki dorongan
36

40

permusuhan.Dalamayattersebutdikatakanbahwabumimerupakantempat kediamandantempatkesenangan( )bagimanusia.Dariketerangan itu maka dapat disimpulkan bahwa permusuhan manusia antara yang satu dengan yang lain ada hubungannya dengan problem tempat kediaman dan kesenanganmereka. Menurut alQur'an, motif kepada permusuhan itu timbul karena digelitikolehsetan.Lebihdarisebelaskali,alQur'an menyebutkanbahwa setan adalah musuh manusia yang tidak boleh diremehkan (
37 ), baiksetanyangberwujudjinmaupunyangberwujud 38 manusia( ). AlQur'anjuga menegaskan bahwa tugas utama setan antara lain mengobarkan permusuhan dan 39 kebencian di antara manusia ( ), oleh karena itu sepanjang masa selalu terjadi permusuhan dan kebencian di 40 antara manusia ( ), baik permushan

44 permusuhanitudilarangolehagama( ). AlQur'anmengisyaratkanbahwamotifkepadapermusuhanitubisa timbulkarenasebabyangberbedabeda,misalnya: a. Disebabkan karena iri hati, seperti yang dialami oleh Qabil kepada Habil,yakniQabil,sepertiyangdikisakandalamsuratalMaidah/5:27 29irihatikepadaHabilkarenakurbanHabilditerimaAllah,sementara kurban dipersembahkan Qabil ditolak. Iri hati Qabil itu menggelitik motifpermusuhannya,danQabilkemudianmeresponsmotifitudengan melakukanpembunuhanterhadapHabil( ). b. Motifpermusuhanjugabisatimbulkarenamerasadihalangipencapaian tujuantujuannya, seperti permusuhan sudahasaudara Yusuf terhadapnya. Hal ini dipaparkan dalam kisah Yusuf pada Q.s. Yusuf/ 12:718).MerekamemandangbahwakisahsayingNabiYa'qubkepada Yusuf dan Bunyamin terlalu berlebihan, hingga mereka merasa kurang

37 38 39 40 41 42 43 44

LihatsuratalBaqarah/2:168dan208 LihatsuratalAn'am/6:112 LihatsuratalMaidah/5:91 LihatsuratalMaidah/5:14dan64sertasuratalMumtahahan/60:4 LIhatsuratalMujadalah/58:89 LihatsuratalMaidah/5:62 LihatsuratalBaqarah/2:85 SuratalMaidah/5:2

tersembunyai ( segera dilakukan ( direkayasabersama(

41 ), maupun permusuhan yang 42 ), atau permusuhan yang 43 ), meskipunkerjasamadalamhal

41

c.

d.

e.

f.

) Karena merasa terancam kedudukan dan kepentingannya seperti yang dirasakan oleh orang kafir Quraysy Makkah kepada Nabi Muhammad. Mereka memusuhi Rasul seperti yang diisyaratkan surat Q.s. Muhammad/ 47:32 ( ) karena kehadiran Rasul mengubah tatanan social yang berdampak merugikan statussocialorangQuraysysebagaikelompokyangsudahmapan. Karenamempertahankanhargadirisecarakelirusepertiyangdilakukan oleh orang Yahudi dan orangorang musyrik kepada Nabi dan kaum mukminin, seperti terlihat dalam pemaparan Tuhan pada surat al Maidah/5:82( ) Karena salah paham atau berbeda pandangan sepertiyang terjadi antara suami istri atau antara orang tua dan anak, dalam Q.s. al Taqhabun/ 64:14( ) Karena sombong, seperti dorongan permusuhan setan kepada manusia setelah ia menolak perintah Tuhan untuk sujud kepada Adam, seperti yangterdapatdalamsuratalAraf/5:1112(

) Dari kisahkisah alQur'an dapat disimpulkan bahwa motif permusuhanmempunyaipengaruhyangsangatbesarterhadaptingkahlaku manusia. Orang yang berada dibawah pengaruh motif permusuhan dapat melakukan perbuatanperbuatan yang sangat menyimpang dari ukuran ukuran moral yang lazim. Orang yang sedang melakukan perbuatan permusuhan sebagai respons terhadap motif permusuhan yang ada dalam nafsnyadapatmelakukanhalyangtidakmasukakal,sepertimenyakitiatau bahkan menyiksa orang tuanya, memutuskan tali silaturahmi, melupakan rasa kasih sayang dan tidak takut kepada dosa. Motif kepada permusuhan juga dapat menumbuhkan perasaan berani melakukan perbuatan criminal sekadar untuk memuaskan motif permusuhannya, meskipun sebenarnya untuk melampiaskan permusuhannya itu terbatas jalan lain yang lebih terhormat, yang lebih masuk akal dan logis ketika motif permusuhan itu memuncak, ia mendorong untuk melakukan perbuatan yang tidak baik, yangtidaklogis,danmendoronguntuktidakmemperdulikanpertimbangan akal,perasaandanpendapatoranglain. 9.PenggerakuntukMembantah Surat alKahfi/18:54, secara jelas menegaskan bahwa manusia adalahmakhlukpalingbanyakmembantah( ).Lanjutan

diperhatikanolehayahnya,padahalmerekamerasalebihberhak.(

42

dari ayat itu mengkhisahkan bagaimana umatumat terdahulu selalu membantahseruanRasulrasulAllah. Manusia adalah makhluk social, oleh karena itu dalam pergaulan sosialnya manusia memiliki ketergantungan antara yang satu dengan yang lain. Secara social, manusia menjadi manusia karena ia bergaul dengan manusia.Jikasuatumasadisuatukomunitaslahirseorangpemimpin,maka ia pun sebenarnya dilahirkan oleh system social di man aia hidup, oleh karena itu seorang pemimpin sering disebut sebagai anak zamannya. Meskipun demikian setiap manusia memiliki tingkat kepuasan individual yang berbedabeda, berhubungan dengan system social di mana seseorang hidup.Seseorangdenganpengalamanyangdilaluinya,dimungkinkanuntuk mampu mengendalikan sifat egoisnya sehingga ia tetap menempuh jalan yangbenar. Sifat egois seseorang biasanya muncul ketika ia harus berhadapan dengan situasi di mana ia merasa harus menunjukkan jati dirinya kepada orang lain, seperti angina menunjukkan bahwa ia mempunyai pandangan tertentu, atau ia ingin memperkuat pendapatnya, atau ingin menyatakan bahwa ia tidak mau bergeser dari sikapnya, meskipun sebenarnya ia tahu bahwapendiriannyaitukeliru. Sifat egois inilah yang menyebabkan manusia suka berseteru, berdebat dan saling menentang, dalam hal kebenaran maupun dalam hal kebatilan. Jika seseorang sedang dikuasai oleh motif untuk membantah, maka ia cenderung membela matimatian pendiriannya dan menentang habishabisan dengan segala cara terhadap siapa saja yang berbeda pandangannya. Orang yang sedang dikuasai sifat egois, tidak sempat menggunakan akalnya secara cermat untuk menilai apa yang dibawa oleh orang yang tidak disukainya, oleh karena itu dalam kontak pertama biasanyaialangsungmebantahdanmenolakdanbahkansetelahkebenaran berulangulangterbukti. Menurut teori psikologi kepribadian, manusia berbedabeda kepribadiandanwataknya,adayangberkepribadianbijakdanharmoni,ada yangselalugelisahdangoyah,yangmenurutisetiapdoronganyangmuncul 45 danselalugundahgulana. Orangyang memiliki kepribadianterakhirini tidak kuat pendiriannya danmudah berubah pikiran. Di samping dua kepribadiantersebut,adaorangyangdianugerahiAllahsebuahkepribadian yang stabil dan lurus, yang jika berhadapan dengan suatu fenomena, ia berusaha mencari hokum sebab akibat pada fenomena itu dan menyimpulkannyadengan menggunakanhati nuraninya,denganakalyang matang dan dengan pikiran yang dalam. Orang yang lurus dan stabil
Tentang teori psikologi kepribadian, lihat Hassan Langgulung, Manusia dan pendidikan,SuatuAnalisisPsikologidanPendidikan(Jakarta:PustakaalHusna,1986,h. 303305,danMalindaJoLevin,Op.cit,h.419455danUtsmanNajati,op.cith.21
45

43

kepribadiannya tidak memiliki dorongan egois selain kepada kebenaran, oleh karena itu jika stimuli dari luar memperkuat pendiriannya maka ia terima, tetapi jika ternyata stimuli dari luar itu yang benar maka ia tidak merasaharusmembelapendiriannyayangkeliru. Adapun orang yang berkpribadiannya tidak stabil, perhatiannya terpusat pada bagaimana memelihara kepribadiannya yang bergejolak dan padapendapatnyayangtidakberimbang.Iaberusaha menutupi kelemahan 46 dan ketidakbenaran pendapatnya dengan helah mental ( ), dalam bentukmembantahdanmenyombongkandiri,atauburuburuberaksiuntuk menutupi kelambatan pikirnya, atau bahkan bergantung kepada kekeliruannya,sertatidakmaumengakuikecualiterhadappendapatsendiri. Semakin banyak diajukan kepadanya buktibukti baru atau argument baru yang menunjukkan kekeliruan mereka, maka semakin bertambah bantahan danpenolakannya. Diantara orang yang suka membantah adalah penderita gangguan jiwa yang berusaha menyembuhkan penyakitnya dengan caracara mistik atau pedukunan. Upaya penyebuhan yang tidak logis itu menyebabkan pasien sangat bergantung kepada pola berpikir mistik, maka ketika itu segala sesuatu diukur dengan paradigma mistik sehingga ia tidak dapat menerimapandanganlainmeskipunmasukakal. AlQur'an memberi contoh adanya orang yang memiliki sterotip terhadap kelompok tertentu, yakni orang kafir Quraiysy terhadap Nabi Muhammad dan kaum mukminin. Apapun yang disampaikan Nabi Muhammad s.a.w bahkan mukjijat yang sudah terbukti tidak terkalahkan, orangorang kafir musyrik Makkah tetap menolaknya, seperti yang dijelaskanpadasuratalAn'am/6:47

$tBur Og?'s? `iB 7pt#u `iB Mt#u Nkh5u w) (#qR%x. $pk]t tB


Dan tidak ada suatu ayatpun dari ayatayat Tuhan sampai kepada mereka, melainkan merekaselaluberpalingdaripadanya(mendustakannya).(Q.s.alAnam/6:4)

qs9ur $uZ9tR y7n=t $Y7tF. <$s% nqyJn=s Nkr'/ tA$s)s9 t%!$# (#rxx. b) !#xyd w) s 7B
Dan kalau kami turunkan kepadamu tulisan di atas kertas, lalu mereka dapat menyentuhnyadengantanganmerekasendiri,tentulahorangorangkafirituberkata:"Ini tidaklainhanyalahsihiryangnyata."(Q.salAnam/6:7)

Motif untuk membantah yang ada pada orang kafir itu mendorongnya untuk banyak mempertanyakanhalhal yang berada di luar
46

Ustsmannajati,ibid

44

pengetahuan mereka, seperti mempertanyakan kenapa Rasul itu manusia, bukandarimalaikat,tetapimenurutsuratalAn'am89seandainyamalaikat yang dirunkanpun mereka tetap ragu. Mereka mengajukan persyaratan untuk menerima kebenaran alQur'an itu dengan meminta kepada Nabi untuk memancarkan mata air, meruntuhkan langit, dan membangun mahligaidariemassepertiyangdiceritakansuratalKahfi/17:9093,tetapi permintaan itu sebenarnya hanya cemoohan yang bermakna menolak keberadaan Rasul. Penolakan seperti yang dilakukan oleh kaum kafir Makkahitu bukan barang baru, tetapi menurut surat alAn'am/ 6:10 ( ) sudah dilakukan juga oleh orangorang kafir pada masa nabinabi sebelum Muhammad, seperti penolakan orang kafir untuk menjamu Nabi Khidir dan Musa (Q.s. Thaha/ 20:56). Karakter penolakankepada kebenaran sebenarnya merupakan perwujudan dari pembangkangan Iblis terhadap perintah Tuhan seperti yang disebutkan dalamrangkaianayat3039padasuratHud/15. Disamping membantah yang bersifat negative, dalamalQur'an juga disebutkancontohpenolakanyangbersifatpositif,seperti: a. Menolakperintahorangtuayang menyuruhberbuatsyiriksepertiyang disebutkandalamsuratLuqman/29:8( ) b. Menolak mematuhi perintah pendusta agama ( ) dalam surat Q.s.alQalam/68:8 c. Menolak mematuhi perintah orang yang banyak bersumpah ( )dalamsuratQ.salQalam/68:10 d. Menolakmematuhikemauanorangkafirdanorangmunafik( )dalamsuratQ.salAhzab/33:1dan e. Menolak mengikuti orang yang lalai kepada Tuhan dan orang yang lebih mengikuti hawa nafsu ( ) seperti terdapatdalamQ.s.alKahf/18:28

B.PendekatandanBahasaDakwah uqd y7-/u b) 4 `|mr& }d L9$$/ Og9y_ur ( puZ|pt:$# psqyJ9$#ur pyJ3t:$$/ y7n/u @6y 4n<) $# ttGgJ9$$/ On=r& uqdur ( &#6y `t @| `yJ/ On=r& Serulah (manusia) kepada jalan Tuhanmu dengan hikmah[845] dan pelajaran yangbaikdanbantahlahmerekadengancarayangbaik.SesungguhnyaTuhanmu dialah yang lebih mengetahui tentang siapa yang tersesat dari jalanNya dan

45

dialahyanglebihmengetahuiorangorangyangmendapatpetunjuk.(Q.sAlNahl/ 16:125) Surat alNahl/ 16:125 di atas, mengajarkan tentang pendekatan dakwah yang harus dilakukan oleh dai sesuai dengan lapisan masyarakat yang menjadi obyek dakwahnyaselanjutnya disebut madu, yakni dengan alhikmah, dengan nasihat( )dandenganberdebat( ).Kebanyakanahlitafsirmenafsirkanal hikmah dengan syariat Islam, yakni mengajak manusia mengikuti syariat agama seperti yang diwahyukan Allah. Latar belakang dari perintah menggunakan beberapapilihanpendekatandalamberdakwahadalahkarenapengalamanutusan utusanNabiyangdakwahnyaditentangolehmasyarakatmadu,bahkanadayang 47 disiksa dan di bunuh. Tentang pendekatan dakwah secara persuasif, ada hadits Nabi yang menyebutkan secara lebih tegas bahwa berbicara kepada manusia itu 48 harusmempertimbangkantingkatanakalmereka( ). Ayatal Quran dan hadits tersebut di atas mengisyaratkan bahwa manusia memiliki kapasitasnafsyangberbedabeda,yangolehkarenaituuntukberdakwahkepada mereka memerlukan pendekatan yang berbedabeda pula. Manusia dengan temperamen dan karakter tertentu hanya cocok didekati dengan pendekatan tertentu pula, dan pendekatan itu tidak bisa digunakan untuk orang dengan temperamendankarakterlain. FakhralRazimenafsirkanalhikmah itudenganargumenyangbenardan logis (hujjah haqiqiyah yaqiniyah qhatiyah), dan berdakwah dengan alhikmah itu diperlukan untuk madu dari kalangan cerdik cendikia. Sedangkan untuk madu yang terdiri dari lapisan masyarakat yang belum sampai tingkat cerdik cendekia,tetapimerekamemilikitingkatkecerdasandantingkahlakuyangwajar, maka dakwah yang tepat untuk mereka adalah dengan pendekatan nasihat (mawizhah hasanah). Sedangkan mujadalah sebenarnya tidak termasuk metode atau pendekatan yang diperlukan dalam berdakwah, tetapi merupakan cara meladeni dan membangun mulut orang yang memang tidak berminat untuk mencari kebenaran. Oleh karena itu perintah menggunakan mujadalah tidak disebutseirama(athf)denganperintah menggunakanalhikmahdanmauihzah), misalnya: (bi alhikmah wa almawizhah alhasanah wa almujadalah), tetapi dengan kalimat baru, karena mujadalah memang bukan untuk berdakwah. Ayat tersebut juga mengingatkan dai agar tidak usah terlalu ambisi untuk menjadikan madu menerima petunjuk,meski berdakwah itu wajib karena sebenarnya Allah lebih mengetahui kapasitas setiap nafs yang siap menerima petunjuk dan yang tetapsesatjalan. Dakwah bisa dilakukan secara lisan, tulisan ataupun dengan contoh teladan, tetapi katakata merupakan cara yang paling banyak digunakan. Dalam keadaan tertentu manusia dapat dipengaruhi oleh katakata tertentu, sehingga ia mengubahtingkah lakunya,ataukatakatatertentu mempunyaikekuatantertentu dalam mengubah tingkah laku manusia. Katakata juga dapat menyebabkan
47

AhmadMushthafaalMaraghi, TafsiralMaraghi (Beirut:darIhyaalTuratsalArabiyah,1985) JilidV,h.161163,danIsmailibnKatsiralQuraysyialDimasyqi,TafsiralQuranal Azhim(Beirut:daralMaarif,1987),jilidII,h.613 48 Haditsmarfu riwayatIbnUmarBerbunyi

46

timbulnya kebencian, iri hati, dengki dan salah paham. Tidak jarang kalimat singkatdapatmemicuterjadinyapertumpahandarahantaraduaorangataubahkan duabangsa.Secarapsikologisbahasamempunyaiperanyangsangatbesardalam mengendalikan tingkah laku manusia. Bahasa dapat diibaratkan sebagai alat kendali (remote control) yang dapat digunakan untuk mengontrol manusia menjadi tertawa, menangis, sedih, marah atau semangat. Bahasa juga dapat digunakanuntukmemasukkangagasangagasanbarukedalampikiranmanusia. AlQuran yang ditujukan untuk seluruh manusia dengan ragam temperamen dan karakternya, di dalamnya terkandung beragam tuntunan yang secara sepintas nampaknya ada yang bertentangan satu sama lain, tetapi 49 sebenarnya justru merupakan hikmah . Bagi orang alim yang bijak, alQuran merupakan khazanah yang tidak keringkeringnya digali untuk mencari pendekatanyangtepatkepadamanusiayangtepatpula. Di samping pendekatan alhikmah, mawizhah hasanah dan penggunaan mujadalahalahsansepertidiisyaratkansuratalNahl125diatas,alQuranjuga memperkenalkan istilah yang dapat dipandang sebagai bahasa dakwah, yaitu (1) (qawlan layyina) (2) (qawlan baligha), (3) (qawlan maysura),(4) (qawlankarima),(5). (qawlansadida). 1.QawlanLayyina (Perkataanyanglembut) Termqawlanlayyinaterdapatdalam suratThaha/20:44dalamrangkaian kisahNabiMusaketikamenghadapiFiraun.

rr& .xtFt &#y9 $YYh9 Zwqs% ms9 wq)s 4xs mR) tbqt 4n<) !$t6yd$# 4ys
PergilahkamuberduakepadaFir'aun,SesungguhnyadiaTelahmelampauibatas Makaberbicaralahkamuberduakepadanyadengankatakatayanglemahlembut, Mudahmudahaniaingatatautakut".(Q.s.Thaha/20:4344) DalamrangkaianpanjangayatayatdalamsuratThaha/20:998dijelaskan bahwaNabi Musadiberitugasuntuk mendatangiRaja Firaun, mengingatkannya agar mengubah tingkah lakunya yang sewenangwenang dan melampaui batas. Firaun adalah seorang raja mesir yang telah sangat lama memerintah kerajaan Mesirsehinggacenderungmenjaditiran.Dalamperspektifnafs,Firaunmemiliki nafs amarah, terutama sifatsifat takabur dan zalim. Musa sendiri adalah orang yang dibesarkan di dalam istana Firaun, sebelum melarikan diri karena terlibat perkelahian yang menyebabkan tewasnya keluarga raja (Q.s Thaha/ 20:40). Settelah Musa menerima wahyu dari Tuhan, Musa disertai saudaranya, Harun, diperintahTuhanberdakwahkepadaFiraunyangtiranitu,danTuhanmemberikan
49

SebagaicontohalQuranberkalikalimengajarmanusiauntukberfikirkritisdenganungkapan ungkapanafalataqilun,afalatatafakkarun,afalatatadahbarun, tetapipadasuratalMaidah101 alQuranmelarangbanyakbertanya, latasaluanasyyaintubdalakumtasukum

47

kiatbagaimanaberhadapandenganorangdengantemperamendankaraktermodel Firaun,yaitudenganpendekatan qawlanlayyina. Ketika itu posisi Musa sebagai dai dan Firaun sebagai madu secara psikologis seimbang, yakni samasama memiliki rasa percaya diri. Firaun memiliki kekuasaan besar dan memandang Musa sebagai orang bersalah yang tibatiba datang dengan membawa sesuatu yang baru untuk disombongkan kepadanya. Sementara Musa, meskipun mengakui keterlibatannya dalam perkelahian yang menyebabkan tewasnya keluarga Firaun, tetapi kini ia mengembantugaskerasulandariTuhanyangMahaKuasa,TuhannyaFiraunjuga, 50 denganmembawabuktibuktisepertidipaparkansuratThaha/20:42. Dalam perspektif ini maka surat Thaha/ 20:44 di atas mengisyaratkan bahwa berdakwahkepadapenguasatiran modal Firaunhendaknya menggunakan bahasadakwahqawlanlayyina.DalambahasaArab,sepertiyangdisebutolehal Isfahani, kata (layyin) mengandung arti lawan dari kasar, yakni halus dan 51 lembut. Kata layyin dalam bahasa Arab pada dasarnya digunakan untuk menyebut sifat benda yang bisa diraba, kulit misalnyatetapi kemudian juga 52 digunakan untuk menyebut akhlak dan perangai manusia. Dengan demikian maka dakwah qawlan layyina dapat dipahami sebagai dakwah dengan katakata yanglemahlembut,yaknikatakatayangdirasakanolehmadusebagaisentuhan yanghalus,tanpamengusikataumenyentuhkepekaanperasaannya. Dengan perkataan yang lemah lembut, orang yang zalim dan kasar tidak diberi kesempatan untuk menunjukkan kekasarannya, sehingga sekurang kurangnya ada waktu untuk berkomunikasi dengan dai. Kekuatan pendekatan lemah lembut yang sejuk, sekurangkurangnya tidak membuat gusar penguasa zalimyangsedangmenjadimadu.Jikapadakesempatanpertamabelumberhasil menyadarkannya,sekurangkurangnyamemberiwaktukepadapenguasaituuntuk merenungkannya.Dalamperspektifnafs,tokohsepertiFiraunmemilikinafsjenis amarah,terutamadengankarakteristiktakaburdanzalim. Mengubah tingkah laku penguasa zalim seperti Firaun haruslah dengan pendekatan lemah lembut. Dengan ungkapan yang lemah lembut, teguran dai diterimanya dengan senyum. Ia sadar bahwa dirinya sedang menjadi obyek teguran dan nasihat, tetapi karena lemah lembutnya ungkapan, telinganya tidak sempatmemerah,sebaliknyahatinyajustrutergelitik.DialogpanjangantaraMusa danFiraunyangterekamdalamsuratThaha/20:4269,menggambarkantajamnya sikaplemahlembutseruanMusa,sehinggatidakmemberipeluangkepadaFiraun untuk bermain terlebih dahulu dengan melakukan kezaliman, tetapi harus mengikutipermainanNabiMusa. b.QawlanBaligha Term qawlan baligha ( ) yang dapat diterjemahkan menjadi perkataanyangmembekasdijiwaterdapatdalamsuratalNisa/4:63:

50 51

AlRaghibalIsfahani, MujamMufradatAlfazhalQuran (BeirutDaralFikr,tth),h.478 52 ibid

48

Ngur Nk]t r's Oh/q=% $tB !$# Nn=t 9$# y7s9'r& $Z=t/ Kwqs% NhRr& _ Nl; @%ur
MerekaituadalahorangorangyangAllahmengetahuiapayangdidalam hati mereka. Karena itu berpalinglah kamu dari mereka, dan berilah merekapelajaran,danKatakanlahkepadamerekaperkataanyangberbekas padajiwamereka.(Q.sAlNisa/4:63) Ayat di atas berkenaan dengan orang munafik yang di hadapan Nabi berpurapura baik, tetapi dibelakang, mereka menentang dakwah Nabi. Karakteristikorang munafiksepertiditerangkan olehRasuladalah berdusta jika berbicara,ingkarjikaberjanjidanberkhianatjikadipercaya.Bagimanusiadengan karakteristikdemikian,perkataanlemahlebutnyatidakakanmembekaskedalam jiwanya. Pesan dakwah yang tepat untuk orang munafik bukan yang indah dan lembuttetapiyangbaligh. Menurut alIsfahani dalam mujamnya, perkataan yang baligh mempunyaiduaarti. 1). Pertama, suatu perkataan dianggap baligh ketika dalam diri seseorang terkumpul tigas sifat (a) memiliki kebenaran dari sudut bahasa ( ),(b)mempunyaikesesuaiandenganapayangdimaksudkan( ),dan(c)mengandungkebenaransecarasubstansial( ). 2). Kedua, perkataan dianggap baligh ketika perkataan itu dipersepsi oleh yang 53 mendengarsepertiyangdimaksudolehyangberkata. Kalimat dakwah yang persuasif bagi orang munafik adalah kalimat yang tajam,pedastetapibenar,baikdarisegibahasamaupunsubstansinya.Sebenarnya tingkah laku munafik sangat sulit untuk diubah, karena ia bersumber dari karakteristiknafsamarahyangsukamelakukanhelahmental.Meskipundemikian dengan qawlanbalighsekurangkurangnyaorangmunafikdibuattidakberkutikdi depan dai, meskipun di belakang mereka mencaricari celah yang dapat digunakanuntukmenyerangbalik.Seranganitubolehjaditidakakandisampaikan langsungkepadadaitetapidisebarluaskandandihembuskankepada masyarakat madu. JikamelihatsifatsifatorangmunafiksepertiyangdigambarkanalQuran 54 danHaditsNabi, makaurgensiqawlanbalighbagimaduorangmunafikbukan hanya untuk membelenggu tingkah laku mereka, tetapi juga untuk konsumsi madu secara umum agar mereka tidak mudah dirongrong oleh hasutan orang munafik. Surat alBaqarah ayat 8 sampai 20 merupakan contoh statemen yang sangat tajam tetapi benar menyangkut orang munafik. Perintah alQuran untuk

53 54

Ibid, h.5859 Lihaturaiantentangkarakteristiknifakdari nafsammarah dalambabII

49

bersikap keras kepada orang kafir dan munafik secara tegas disebut dalam surat alTaubah,73:

( OYygy_ Ng1ur'tBur 4 Nkn=t =$#ur t)oYJ9$#ur u$69$# gy_ <Z9$# $pkr't yJ9$# }/ur
Hai nabi, berjihadlah(melawan)orangorangkafirdanorangorang munafik itu, dan bersikap keraslah terhadap mereka. tempat mereka ialah jahannam. dan itu adalahtempatkembaliyangseburukburuknya.(Q.S.AlTaubah/9:73) c.QawlanMasyura Term qawlanmasyurayangterdapatdalamsuratalIsra/17:28

#YqB Zwqs% Nl; @)s $ydq_s? y7i/ `iB 7puHqu u!$tG/$# Nk]t `|? $B)ur
Dan jika kamu berpaling dari mereka untuk memperoleh rahmat dari Tuhanmu yangkamuharapkan,MakaKatakanlahkepadamerekaUcapanyangpantas(Q.s. AlIsra/17:28) Dalam bahasa Arab, term (masysura) yang berasal dari kata mengandung arti mudah, lawan dari (masura) yang artinya sulit. Jika masyura menjadi sifat dari qawl, ( ), maksudnya adalah perkataan yang 55 mudahditerimadanyangpantasdidengar. Jika melihat munasabah ayat tersebut dengan ayat sebelum dan sesudahnya (ayat 2630), maka term qawlan masyura berhubungan dengan tata karma pergaulan dengan kerabat, orang miskin dan musafir, menyangkut pemenuhan kebutuhan materi. Ayat 2627 misalnya mengingatkan agar jangan melakukan kemubazir itu merupakan perbuatan setan. Dalam perspektif kebutuhanpokokbagiorangmiskin,perbuatanmubaziryangdilakukanorangdi depan mereka adalah sangat menyakitkan dan bisa dianggap sebagai bentuk penghinaan. Sedangkan ayat 28 di atas mengisyaratkan bahwa jika seseorang merasa belum mampu memenuhi kewajiban menolong membantu ekonomi kerabat,orangmiskindanibnsabil,danolehkarenaituiabermaksudpergiuntuk berusahasupayamemilikikemampuan,makaketikaiapergimeninggalkanorang orangyang mungkinkecewa, hendaknya berkatadenganperkataan yang mudah dipahami,yangtidakmenyakitkandantidakmenimbulkansalahpaham. Jadi term qawlan masyura ditujukan kepada orangorang yang sedang dalamkeadaanmembutuhkanpertolongan,baikkarenakemiskinanataukesulitan tertentu.Nafs manusia yangsedangdidesakoleh kebutuhanseringtidak mampu
55

Ibid, h.576danIbnManzhur,LisanalArab(tt:daralMaarif,tth),jilidVI,h.4958

50

mencermati secara cermat informasi yang diterimanya. Dalam keadaan terdesak, dorongan syahwat boleh jadi lebih dominant sehingga qalb tidak mampu memahami realitas secara cermat. Rentannya nafs orang yang sedang dalam keadaanterdesakolehkebutuhandijelaskanolehNabidalamhaditsyangberbunyi yangartinyakefakiranseseorangitunyaris mendorongnyapada kekufuran.Bagiorangyangberadadalamkedaandemikian,perkataanyangsulit bisadipersepsisecarakelirudanbisamenimbulkanreaksiyangkelirupula. Dengan demikian maka termqawlan masyura dalam ayat ini lebih tepat disebut untuk megendalikan tingkah laku dibanding untuk mengubahnya, yakni mengendalikantingkahlakuorangorangyangsedangdalamkefakiran(kesulitan) agarmerekatidakterdorongmelakukanperbuatankufur.

d.QawlanKarima Term qawlan karima terdapat dalam ayat yang mengajarkan etika pergaulan manusiakepadaorangtuanya yangsudahusia lanjut, yaitupada surat alIsra/17:23

uy969$# x8yY `t=7t $B) 4 $Z|m) t$!uq9$$/ur n$-) Hw) (#r7s? wr& y7/u 4|s%ur * $VJ2 Zwqs% $yJg9 @%ur $yJdpk]s? wur 7e$& !$yJl; @)s? xs $yJdx. rr& !$yJdtnr&
Dan Tuhanmu Telahmemerintahkan supaya kamu janganmenyembah selain dia danhendaklah kamu berbuat baik pada ibu bapakmu dengan sebaikbaiknya. jika salah seorang di antara keduanya atau keduaduanya sampai berumur lanjut dalam pemeliharaanmu, Maka sekalikali janganlah kamu mengatakan kepada keduanya perkataan "ah" dan janganlah kamu membentak merekadanucapkanlahkepadamerekaperkataanyangmulia.(Q.sAlIsra/17:23)

Dalam bahasa Arab, termkarima mengandung arti katakata yang penuh 56 kabajikan, ( ). Jika dihubungkan dengan qawl, ( ) maka artinya 57 sahlan wa layyinan, yakni perkataan yang mudah dan lembut. Surat alIsra 23 dan juga dua ayat sesudahnya berisi tata karma pergaulan dengan orang tua. Seoranganakdiperintahuntukberbuatbaikkepadaorangtuanya,danjikasempat mendapatkansalahsatuataukeduanya berusia lanjutdalamperawatannya, maka iatidakbolehberbuatkasarkepadamereka.Jikaterpaksaharusmenegur,makaia harus menegurdenganqawlankarima, yaknidenganperkataan yang mudahdan lembut. Manusiadalamusialanjutseringmelakukanhalhalyangtidaklogis.Hal ini disebabkan karena terjadinya distorsidistorsi pengamatan yang diakibatkan oleh melemahnya fisik. Manusia dalam usia amat lanjut dapat mengalami kepikunan, yakni kembali tidak memiliki pengetahuan setelah pernah mengetahuinya.HalinidisebutdalamsuratanNahl/16:70

56 57

IbnManzhur,Op.cit,jilidV,h.3861 Ibid h.3863

51

5O= yt/ zOn=t w s59 J9$# Asr& #n<) t `B N3ZBur 4 N39uqtGt OO /3s)n=s{ !$#ur s% O=t !$# b) 4 $x
Allah menciptakan kamu, Kemudian mewafatkan kamu dan di antara kamu ada yang dikembalikan kepada umur yang paling lemah (pikun), supaya dia tidak mengetahui lagi sesuatupun yang pernah diketahuinya. Sesungguhnya Allah Maha mengetahuilagi Maha Kuasa. (Q.s.AlNahl/16:70)

Jadi dari ayatayat di atas dapat disimpulkan bahwa tingkah laku orang yang sudah lanjut usia tidak mudah untuk diubah. Oleh karena itu berdakwah kepada mereka harus dengan penuh kelembutan. Jika orang kafir mudah menentang dakwah karena didorong oleh keingkarannya, maka lanjut usia tidak mudah menerima teguran keras karena melemahnya kemampuan respon psikologisyangdisebabkankarenausialanjut. e.QawlanSadida Manusia di samping memiliki temperamen dan karakter yang berbeda beda, juga memiliki kesamaankesamaan yang bersifat universal. Pendekatan kepada manusia bisa dilakukan dengan pendekatan khusus jika manusia itu memiliki kekhususan yang menonjol, tetapi manusia sebagai kesatuan yang berbeda dengan kesatuan hewan adalah sebuah kesatuan entitas yang memiliki kesamaanciriumum.Diantaraciriciriumumituadalahkemampuannyaberpikir logis. Manusia dalam pengertian di atas dapat diubah tingkah lakunya dengan pendekatanpendekatanyanglogis. Dalamperspektif inialQuran menyebutistilah (qawlansadida), yang dapat diterjemahkan menjadi perkataan yang harus atau yang benar. Term qawlan sadida disebut dua kali dalam alQuran, yaitu dalam surat alnisa/ 4:9 danalAhzab/33:7071

tur /3n=yJr& N3s9 x= #Yy Zwqs% (#q9q%ur !$# (#q)?$# (#qZtB#u t%!$# $pkr't $Jt #qs y$s s)s &s!quur !$# `tBur 3 N3t/qR N3s9
Hai orangorang yang beriman, bertakwalah kamu kepadaAllah dan Katakanlah perkataan yang benar. Niscaya Allah memperbaiki bagimu amalanamalanmu dan mengampuni bagimu dosa dosamu.danbarangsiapamentaatiAllahdanRasulNya,MakaSesungguhnyaiaTelahmendapat kemenanganyangbesar.(Q.sAlAhzab:33:7071)

Perintah untuk berkata benar dalam ayat di atas didahului oleh perintah bertakwa, dan ayat 71 merupakan janji keberhasilan jika pendekatan itu dipergunakan.Jadipelaksanaandakwahdengan qawlansadidaituharusberdiridi atas landasan takwa. Pesan dari ayat tersebut adalah bahwa barangsiapa yang berdakwahdenganqawlansadidadandakwahnyaberdiridiatas landasantakwa makadakwahnya bukanhanya memiliki dayapanggilterhadapmadutetapi juga akan membangun diridai. Aktivitas dai yang benar itu atas pertolongan Allah akan menyebabkan perbuatannya menjadi konstruktif, karena suatu perbuatan yangdidasariolehkepatuhankepada Allahdan RasulNya,perbuatan itusendiri sudahmerupakankeberuntungan.

52

MenurutIbnManzhurdalamlisanalArab,katasadidyangdihubungkan 58 denganqawlmengandungartimengenaisasaran,( ). Jadipesandakwah yang secara psikologis menyentuh hati madu siapapun madunya adalah jika materi yang disampaikan itu benar, baik dari segi logika maupun bahasa, dan disampaikandenganpijakantakwah.MenurutFazlurRahman,takwaadalahaksi 59 moral yang integral. Takwaadalahperbuatankebaikan yangdilakukansebagai perwujudan kepatuhan nafs kepada Tuhan. Jadi dakwah yang benar adalah dakwah yang mempunyai bobot moral, moral force, dan keluar dari orang yang bermoral,orang yang bertakwa.Pesan moral yangdisampaikanolehorang yang tidakbermoraltidakmempunyaidayapanggil,tidakakanmengubahtingkahlaku madu,karenakebenarandakwahnyadigugurkanoleh daiitusendiri. Seseorangdaiyangkonsistendenganpesankebenarandandidukungoleh integritas pribadinya yang mulia dijamin alQuran bahwa dakwahnya bukan hanya mengubah tingkah laku madu tetapi juga membangun integritas dirinya, ( ) dan karena motivasi takwanya yang kuat, maka kekeliruan kekeliruan yang dilakukan menyangkut hal teknis, metode dan strategi, akan dimaklumi oleh manusia dan diampuni oleh Tuhan, ( ). Selanjutnya komitmen dai kepada kebenaran universal, (alQuran dan hadits) sudah merupakankeberuntungantersendiri( )

D.Subsistem Nafs Seperti dikupas dalam bab terdahulu, bahwa alQur'an tidak selalu menyebut nafs dalam pengertian jiwa, hal tersbut juga berlaku bagi pengertian jiwa tidak selalu signifikan dengan termnafs. Termterm yang digunakan untuk menyebutataumengisyaratkandanyangberhubungandenganfungsifungsijiwa, disampingkalimatnafsadalah qalb'aql,ruhdan bashirah.Keempattermtersebut sebagaisubsistemdalamsystem nafsatausystem nafsani. 1.Qalb (hati)Fungsi,KandungandanSifatnya Dalam bahasa Indonesia, kalbu digunakan untuk menyebut hati, baik dalam arti fisik (liver) maupun secara maknawi, tetapi dalam bahasa Arab, term qalb digunakan untuk menyebut banyak hal, seperti jantung, akal, semangat 60 keberanian, bagiandalam, bagiantengah,untukmenyebutsesuatu yang murni. Bukan untuk menyebut organ tubuh yang disebut hati, sementara untuk hati digunakanterm alkabid.61 AlQur'an menggunakan term (qalb) dan (fu'ad) untuk menyebut hatimanusiasepertiyangdisebutdalamsuratalIsra/17:36( )dan suratalSyu'ara/26:89( ).AlQur'anjugamenggunakankata
58 59

Ibid, jilidIII,h.1970 FazlurRahman, MayorThemesoftheQuran,(Chicago:BibliotikaIslamica,1980),h.43 60 Lihat Ahmad Warson Munawwar, almunawwar, Qamus Arabi Indonisi,(Yogyakarta: PesantrenAlMunawwir,1984),h.1232.LihatpulaIbnManzhur,Op.cit,jilidV,h.37133715 61 AhmadWarson, ibid, h.1271danIbnManzhur, ibid, h.38063807

53

(shard)yangdalambahasaArabberartidadaataudepanuntukmenyebutsuasana hatidanjiwasebagaisatukesatuanpsikologissepertidalamsuratalInsyirah/94:1 . Tetapi alQur'an juga menggunakan termqalb untuk menyebut akal seperti yang tercantum dalam surat alHajj/22:46 ( ). Dalam bahasa Arab ada kemungkinan menggunakan kalimat untuk 62 mengatakan Dalam konteks nafs manusia, qalb atau hati bukanlah sepotong organ tubuh, tetapi sebagaimana juga 'aql dan bashirah merupakan elemen atau subsistem dalam system nafs yang bersifat ruhani. Oleh karena itu pembicaraan tentang qalb, sebagaimana juga tentang nafs merupakan pembicaraanyangsangatluascakupannya. Secaralughawi,qalbartinyabolakbalik,daninimenjadikarakteristikdari qalb itu sendiri, yaitu memiliki sifat tidak konsisten, bolakbalik, sehingga pengertianqalb juga merujuk pada karakter ini. Ungkapan popular tentang qalb adalah yangartinyakalbudisebutqalbkarenasifatnyayangtidak 63 konsisten. GagasantentangqalbdalamalQur'andapatdibagimenjaditiga,yaitu(a) fungsidanpotensinya,(b)kandungannya,dan(c)sifatsifatnya. a.FungsidanPotensiQalb Fungsiyangutamadariqalbadalahsebagaialatuntukmemahamirealitas dannilainilaisepertiyangtersebutdalamsuratalHajj/22:46,ataupadasuratal Araf/7:179
)(

( $pk5 tbqyJo b#s#u rr& !$pk5 tbq=)t >q=% Nlm; tbq3tGs F{$# (#ro On=sr& r9$# L9$# >q=)9$# yJs? `3s9ur |/F{$# yJs? w $pkX*s
Maka apakah mereka tidak berjalan di muka bumi, lalu mereka mempunyai hati yang dengan itu mereka dapat memahami atau mempunyai telinga yang dengan itu mereka dapat mendengar? Karena Sesungguhnya bukanlah mata itu yang buta, tetapi yang buta, ialah hati yangdidalamdada.(Q.s.alHajj/22:46) Padaayatini,qalbmempunyaipotensiyangsamadenganakal,atauyang dimaksudqalbdisiniadalahakal.Berangkatdarifungsiutamainilahmakaqalb secarasadardapatmemutuskansesuatuataumelakukansesuatu,dandaripotensi inilah maka yang harus bertanggungjawabkan manusiakepadaTuhanadalahapa yang disadari oleh qalb seperti yang disebut dalam surat alBaqarah/2:225 dan oleh fu'adsepertiyangdisebutkandalamsuratalIsra/17:36

62 63

IbnManzhur, ibid, h.3714 Ibid,

54

3 N3/q=% Mt6|x. $o3 N.{#xs `3s9ur N3YyJr& q=9$$/ !$# N.{#xs w L=ym qx !$#ur
Allah tidak menghukum kamu disebabkan sumpahmu yang tidak dimaksud(untuk bersumpah),tetapi Allah menghukumkamudisebabkan (sumpahmu) yang disengaja (untuk bersumpah) oleh hatimu. dan Allah MahaPengampunlagiMahaPenyantun.(alBaqarah/2:225)

tb%x. y7s9'r& @. y#xs9$#ur u|t79$#ur yJ9$# b) 4 O= m/ y7s9 }s9 $tB #)s? wur ZwqtB mYt
Dan janganlah kamu mengikuti apa yang kamu tidak mempunyai pengetahuan tentangnya. Sesungguhnya pendengaran, penglihatan dan hati, semuanya itu akan diminta pertanggungan jawabnya. (Q.s al Isra/17:36) Dalam bahasa Arab, qalb dan fu'ad mempunyai arti yang sangat dekat persamaannya.SebuahHaditsNabi mengisyaratkankedekatandarimaknakedua term tersebut, yakni ungkapan kelembutan qalb ( ) dan kehalusan fu'ad 64 ( ). Selanjutnyapotensipotensidari qalbyangdisebutkanalQur'anadalah: 1. Bahwaqalbitubisaberpaling,sepertiyangadadalamsuratalTaubah/9:117 ( ) 2. Merasa kecewa dan kesal, seperti yang dipaparkan dalam surat alZumar/ 39:45( ) 3. Secarasengajarmemutuskanuntukmelakukansesuatu,terterasuratalAhzab/ 33:5( ),dansuratalBaqarah/2:225 4. Berprasangka,terdapatdalamsuratalFath/48:12( ) 5. Menolaksesuatu,adadalamsuratalTaubah/9:8( ) 6. Mengingkari,sepertiyangadadalamsuratalNahl/16:22( ) 7. Dapat diuji, seperti tercantum dalam surat alHujurat/ 49:3 ( ) 8. Dapatditundukkan,adadalamsuratalHajj/22:54( ) 9. DapatdiperluasdandipersempitdiuraikanpadasuratalAn'am/6:125( ) 10. (Bahkan)bisaditutuprapat,sepertiyangterdapatdalamsuratalBaqarah/2:7 ( )
64

, .

55

Tentang bagaimana qalb bisa berbalik, berpaling, berubah, menolak, memutuskandansebagainya,jugadiisyaratkanolehsebuahHadits:


WahaiTuhan yang membolakbalikkan hati,kokohkanlah hatikamipada agamaMuuntuktaatkepadaMu(H.R.MuslimdariAmrIbnAshsh) b.Kandungan Qalb Sebagai subsistem yang bekerja dalam system dimana qalb mempunyai fungsi yang sangat penting, yakni sebagai alat untuk memahami realitas dan mempertimbangkannilainilaisertamemutuskansuatutindakan,qalbdisamping memilikipotensiyangbanyak,iajugabagaikanwadahyangdidalamnyaterdapat muatanmuatan yang memperkuat potensipotensi itu. AlQur'an memaparkan bahwadidalam alQalb,terkandungmuatanmuatanberupa: 1).Penyakit,sepertiyangadadalamsuratalBaqarah/2:10( )dansurat alAhzab/ 33:32 ( ). Dalam konteks dua ayat tersebut, yang pertama merupakan penyakit lemah keyakinan, sedang ayat kedua berkaitan denganmaknapenyakit"kenakalan" 2) Perasaantakut,suratalImran/3:151( ) 3) Getaran,suratalAnfal/8:2( ) 4) Kedamaian,suratalFath/48:4( ) 5) Keberanian, surat alImran/ 3:126 yang berkenaan dengan perang Badar ( ) 6) Cintadankasihsaying,suratalHadid/57:27( ) 7) Kebaikan,suratalAnfal/8:70( ) 8) Imam,suratalHujurat/49:7,14( ) 9) Kedengkian,suratalHasyr/59:10( ) 10) Kufur,suratalBaqarah/2:93( ) 11) Kesesatan,suratalImran/3:7( ) 12) Penyesalan,suratalImran/3:156( ) 13) Panashati,suratalTaubah/9:15( ) 14) Keraguan,suratalTaubah/9:45( ) 15) Kemunafik,suratalTaubah/9:77( ),dan 16) Kesombongan,dalamsuratalFath/48:26( ) Sesuai dengan karakternya yang bolakbalik, maka kadar kandungan hati dapat berubahubah, seringkali didominasi oleh satu atau dua hal, dan di lain waktu didominasi oleh satu atau dua hal yang lain dan suatu saat bisa dipenuhi

56

oleh berbagai hal yang tidak dominant atua bahkan kosong. Hati manusia dapat berpindahdarisatutitikekstremketitikekstremlainnya. c.SifatdanKeadaanQalb Qalb mempunyaikaraktertidakkonsisten,olehkarena itu ia bisaterkena konflik batin. Interaksi yang terjadi antara pemenuhan fungsi memahami realita dan nilainilai (positif) dengan tarikan potensi negative yang berasal dari kandungan hatinya, melahirkan satu keadaan psikologis yang menggambarkan kualitas,tipedankondisidari qalbitu.Prosespencapaiankondisi qalbitumelalui tahaptahapan perjuangan rohaniah, dan dalam prose situ, menurut alQur'an, manusia mempunyai sifat tergesagesa, seperti yang dipaparkan dalam surat al Anbiya/21:37danQ.s.alIsra/17:11( )danberkeluhkesah,seperti terdapatdalamsuratalMa'arij/70:1920( ) Proses interaksi psikologis itu mengantar hati pada kondisi dan kualitas hatiyangberbedabeda,yaitu: 1).Kersdankasarhati,suratalImran/3:159 ( ) 2).Hati yangbersih,suratalSyuara/26:89)( ) 3).Hatiyangterkuncimati,suratalSyura/42:24( dansuratal ) Mumin/40:35 ) ( 4)Hatiyangbertaubat,suratQaf/50:33( ) 5)Hatiyangberdosa,suratalBaqarah/2:283( ) 6)Hatiyangterdinding,suratalAnfal/8:283( ) 7)Hatiyangtetaptenang,suratalNahl( ) 8)hatiyanglalai,suratalAnbiya( ) 9)HatiyangmenerimapetunjukTuhan,suratalTaghabun/64:11 ) ( 10).Hatiyangteguh,suratalQashahsh/28:10 ( dansurat ) Hud/11:120( ) 11).Hatiyangtakwa,suratalHajj/22:32( ) 12)Hatiyangbuta,suratalHajj/22:46( ) 13).Hatiyangterguncang,suratalNur/24:37( ) 14) Hatiyangsesak,suratalMumin/40:18( ) 15)Hatiyangtersumbat,suratalBaqarah/40:18 ( ) 16).Hatiyangsangattakut,suratalNaziat/79:8( ) 17)Hatiyangcondongkepadakebaikan,suratalTahrim/66:4 ) ( 18) Hatiyangkerasmembantu,suratalBaqarah/2:74) ( 19).Hatiyanglebihsuci,suratalAhzab/33:53 ) ( 20).Hatiyanghancur,suratatTaubah/9:110 ) ( 21).Hatiyangingkar,suratalNahl/16:22( ) 22).Hatiyangtakut,suratalMuminun/23:60( ) 23)Hatiyangkosong,suratIbrahim/14:43, ( SuratalQashashsh/ ) 28:10 ) ( 24).Hatiyangterbakar,suratalHumazah/104:67 ( )

57

Dariketerangandiatas,yangberkaitandenganfungsi,potensi,kandungan dankualitashatiyangdisebutdalamalQuran,dapatdisimpulkanbahwaqalb memilikikedudukanyangsangatmenentukandalamsystem nafsanimanusia. Qalblahyangmemutuskan danmenolaksesuatu,dan qalbjugayangmemikul tanggungjawabatasapayangdiputuskan.Dalamperspektifinilahtampaknya Nabimenyatakanbahwaqalblahpenentukualitasmanusia,sepertiyang disebutkandalamhaditsriwayatBukhariMuslim,sepertiyangdisebutkandalam haditsriwayatBukhariMuslim.Dalamhaditsyangmenyebutkantentang kejelasansesuatuyanghalaldanharamsertakesamaransesuatuyangsyubhatitu digambarkanbahwaqalbmemilikikedudukanyangsangatmenentukankualitas keputusanseorangmanusia.

Sesungguhnyayanghalalitujelasdanyangharamjugajelas,tetapidiantarayang halal dan haram itu banyak perkara syubhat yang kebanyakan orang tidak mengetahuinya.Makabarangsiapamenjagadiridariyangsyubhatberartiiatelah membersihkan agama dan kehormatannya, dan barang siapa yang terjerumus ke dalam syubhat berarti ia telah terjerumus ke dalam yang haram, seperti seorang pengembala yang mengembalakan ternaknya di sekeliling tanah larangan, dikhawatirkan akan masuk ke dalamnya. Ketahuilah bahwa setiap raja mempunyai daerah larangan, dan ketahuilah bahwa dalam setiap tubuh manusia ada sepotong organ yang jika ia sehat maka seluruh tubuhnya juga sehat, tetapi jika ia rusak, maka seluruh tubuhnya terganggu, ketahuilah bahwa organ itu adalah qalb(HRBukhariMuslim) JikaberfungsitidaknyaakalpadamanusiadiungkapkanalQurandengan kalimat Tanya atau yang sebangsanya, maka besarnya peranan qalb dalam pengambilan keputusan diungkapkan oleh hadits riwayat Ahmad dan al Darimidengankalimatperintah, 56yangartinyamintalahfatwakepada qalbmu. Qalb di sini adalah tempat bertanya bagi seseorang jika ia harus memutuskansesuatuyangsangatpenting. RasyidRidladalam TaliqKitabHaditsArbainmenyebutkanbahwaqalb itu ada dua macam, yaitu sepotong organ tubuh yang menjadi pusat peredaran darah,danqalb merupakansubsistemnafs ( yang menjadipusta ) perasaan. Bagian pertama memiliki pengaruh yang besar terhadap kesehatan 66 badandanbagiankeduamemilikipengaruhterhadapkesehatanjiwa. 2.Akal(alAql)danKapasitanya KataakaldalambahasaIndonesiaberasaldaribahasaArab (alaql) yang mengandungarti mengikatataumenahan,tapi secaraumum akaldipahami sebagaipotensiyangdisiapkanuntukmenerimailmupengetahuan
66 RasyidRidla,SyarhalArbainHaditsalNabawiyah(Kairo:MarkazalSalaflialKitab, tth),h.30
65

58

67 . Dalam psikologi modern akal dipahami sebagai kecakapan memecahkan 68 masalah (problemsolvingcapacity). Berbeda dengan kalimat alqalb, dalam alQuran kalimat alaql tidak pernah disebut dalam bentuk kata benda, tetapi selalu dalam bentuk kata kerja, baik kata kerja fil madly maupun fil mudhari. Dalam alQuran, kalimat aql disebut dalam 49 ayat, satu kali dalam bentuk kalimat 42 96 kali dalam 72 bentukkalimat 07satukali 17 satukali dan22kalidalambenttuk 73 kalimat . Sebagai contoh, penyebutan alaql dalam alQuran adalah sepertiyangadapadasuratalBaqarah/2:75:

cqJn=t Ndur nq=s)t $tB t/ .`B mtRqhpt OO $#


lalu mereka mengubahnyasetelah mereka memahaminya, sedang mereka mengetahui

( $pk5 tbqyJo b#s#u rr& !$pk5 tbq=)t >q=% Nlm; tbq3tGs F{$# (#ro On=sr& r9$# L9$# >q=)9$# yJs? `3s9ur |/F{$# yJs? w $pkX*s
Maka apakah mereka tidak berjalan di muka bumi, lalu mereka mempunyai hati yang dengan itu mereka dapat memahami atau mempunyai telinga yang dengan itu mereka dapat mendengar? Karena Sesungguhnya bukanlah mata itu yang buta, tetapi yang buta, ialah hati yangdidalamdada.(Q.salHajj/22:46)

tbq=)s? N3=ys9 mGt#u N6s9 !$# it7 9xx.


Demikianlah Allah menerangkan kepadamu ayatayatNya (hukum hukumNya)supayakamumemahaminya.(Q.salBaqarah/2:245) MenurutLisanalArab,alaqljugaberarti yangartinyamenahan, sehingga yang dimaksud dengan orang berakal, adalah , orang

AlRaghibalIsfahani, op.cit, h.354 Psikologi Modern bukan hanya membahas tentang fungsi psikolgis akal, tetapi juga anatomiotaksebagaialatberpikir.Disebutkanbahwabrain dibagimenjaditigabagian:otakdepan (forebrain),otaktengah(midbrain)danotakbelakang(hindbrain),disampingpembagiankiridan kanan(leftbrainandRightBrain).Bagaimanaaktivitasmentaldiuraimekanismekerjanyadalam otakitu.LihatMalindaJoLevin, Psychology,ABiographicalApproach(NewYork:McGraw HillBookCompany,1978)h.101112 69 75 70 MisalnyadalamQ.s.alBaqarah/2:44,73,76,242danQ.sAlImran/3:65,118 71 10 72 43 73 Antara lain Q.s. alBaqarah/ 2:164, 170, 171, Q.s alMaidah/ 5:58, 103, Q.s alAnfal/ 8:22,Q.s.Yunus/10:42,100
68

67

59

74 yangmenahandiridanmengekanghawanafsu. AlQuranjugamenyebutorang berakaldenganbeberapaistilah,seperti ( ulialnuba)yangberartiorang 75 yangmemilikipencegah atauakalyangmencegahdarikeburukan. 76 (ulualilm),orangyangberilmu, ( ulualalbab)orangyang 77 mempunyai saripati akal, ( ulu alabshar) orang yang mempunyai 78 79 pandangantajam, dan ( dzihijr),orangyangmempunyaidayatahan. Dari ayat yang menyebut alaql, kata aql mengandung pengertian mengerti, memahami dan berpikir. Tetapi pengertian berpikir juga diungkap al Quran dengan kata yang lain, seperti mazhara ( ) yang artinya melihat secaraabstraksepertitercantumpadasuratsurat(Q.s.Qaf/50:67,Q.salThariq/ 86:57, Q.s alGhasyiyah/ 88:1720), tadabbaru ( ) yang artinya merenungkan seperti terdapat dalam surat (Q.s. Shad/ 38:29, Q.s Muhammad/ 47:24),tafakkara( ) yangartinyaberpikirsepertiyangadadalamsurat(Q.s alNahl/ 16:6869), Q.s alJatsiyah/ 45:1213), faqihatafaqqaha, ( ) yangartinya mengerti,Q.s.alIsra/17:44,Q.salNahl/16:9798,Q.salTaubah/ 9:12, tadzakkara ( ) yang artinya, mengingat, memperoleh pengertian, mendapatkanpelajaran,memperhatikandanmemelajari,terdapatpadasurat(Q.s. alNahl/16:17,Q.alZumar/39:9,Q.salDzariyat/51:4749),dankalimatfahima ( ) yangartinyamemahami,terdapatpadasurat(Q.s.alAnbiya/21:7879). Meskipun banyak istilah dalam alQuran yang berhubungan dengan aktivitas akal, tetapi kata aqala mengandung arti yang pasti, yaitu mengerti, memahami dan berpikir. Hanya saja alQuran tidak menjelaskan bagaimana 80 proses berpikir seperti yang dibahas dalam psikologi, tidak juga membedakan dimanaletakdayaberpikirdandimanaletakalatberpikirsepertiyangdibicarakan 81 oleh filsafat, tidak juga menyebut pusat kegiatan berpikir itu di dada atau di

IbnManzhur, op.citjilidIV,h.3046 54 76 18 77 lihatmisalnyaQ.salBaqarah/2:269,Q.sAlImran/3:7,Q.salRad/13:19,Q.sIbrahim/ 14:52,Q.sShad/38:29danQ.salZumr/39:9 78 13 79 80 Psikologi antara lain membahas system komunikasi intrapersonal, yakni proses bagaimana manusia menangkap stimulasi hingga mengambil keputusan, satu proses yang melibatkansensasi,persepsi,memoridanberpikir. 81 Filsfat merupakan pemikiran secara sistematis. Kegiatan kefilsfatan ialah merenung, tetapibukanmelamun,bukanjugaberpikirsecarauntunguntungan.Perenungankefilsafatanialah percobaan untuk menyusun suatu system pengetahuan yang rasional, yang memadai untuk memahmi duni tempat manusia hidup, maupun untuk memahami diri manusia itu sendiri. Perenungan kefilsafatan berusaha menyusun bagan konsepsionil. Filsafat merupakan pemikiran tentanghalhalsertaprosesprosesdalamhubunganyangumum,baiktentangpemikiranmaupun si pemikir itu sendiri. Filsfat merupakan hasil menjadisadarnya manusia mengenai diri sendiri sebagai pemikir di dalam dunia yang dipikirkannya. Penalaran merupakan proses penemuan kebenaran di mana tiaptiap jenis penalaran merupakan masingmasing. Sebagai suatu kegiatan berpikir,penalaranmempunyaicirriciritertentu,yaitupertama,polaberpikiryangdisebutlogika atau proses berpikir logis, dan kedua, sifat analitik dari proses berpikirnya. Lihat Jujun S. Suryasumantri,FilsafatIlmuSebuahPengantarPopuler(Jakarta:PustakaSinarHarapan,1988), h. 3959, dan Louis O. Kattsoff, elements of Philosophy, terjemahan Soejono Soemargono, PengantarFilsafat (Yogyakarta:TiaraWacana,1986),h.327
75

74

60

kepala,tapimenyebutbahwaqalbyangdidadajugaberpikir() sepertiakal. HalitudisebutkanantaralaindalamsuratalAraf/7:179 dan diisyaratkandalam surat alTaubah/ 9:93dansuratMuhamamd/47:24.Jadi menurutalQuran,aktivitasberpikiratau merasa, bukan hanya menggunakan akal atua hati saja, tetapi kesemuanya, akal, nafs, qalb danbashirah, yang bekerja dalam systemnafs. Hanya saja alQuran tidakmembicarakantekniskerjasystem nafssecararinci. Sementaraitupsikologimembahastekniskerjasystemjiwadengankejian yang sudah sangat rinci. Tentang otak misalnya, psikologi membahas anatomi otak sebagai alat berpikir dengan sangat rinci, lengkap dengan pembagian kerjanya. Otak kiri misalnya bekerja untuk halhal yang bersifat logis, seperti berbicara,bahasa,hitunganmatematik,menulisdanilmupengetahuan,sementara otak kanan bekerja untuk halhal yang bersifat emosi, seperti seni, apresiasi, 82 intuisidanfantasi. a.PerkembangandanKapasitasAkal Manusia adalah makhluk yang mengalami pertumbuhan sangat lambat disbanding hewan yang lain. jikakuda yang baru lahirbisa langsung berdiridan berjalan,makamanusiamembutuhkanwaktuyangpanjanguntukmemfungsikan alatalat tubuhnya secara optimal, apalagi fungsifungsi jiwanya. Meskipun lambat tetapi pertumbuhan dan kapasitas jiwa dan akal manusia pada akhirnya dapatmencapaisatutingkatanyangsangattinggidisbandinghewanyangberhenti pada sempurnanya pertumbuhan fisik. Tentang pertumbuhan dan kapasitas akal, alQuranmenjelaskansebagaiberikut: 1. Bahwa akal didisain sebagai sesuatu yang ada di dalam system sempurna. SuratalSajdah/32:79 menyebutkan bagaimana Allah menciptakan manusia dengan sebaikbaiknya, serta bagaimana proses penyempurnaan penciptaan manusiahinggasempurnanyafungsifungsijiwa ( ) 2. Ketika manusia lahir, akal belum berfungsi, sehingga ketika itu manusia belum memiliki pengetahuan apapun bagaikan kertas kosong yang belum ditulis,sepertiyangdiisyaratkansuratalNahl/16:78 ) ( 3. Pertumbuhanakalituterjadimelaluiprosesbelajar,sepertiyangdiisyaratkan suratalAlaq/96:45 ( ) 4. Dengan akal, manusia dimungkinkan untuk menemukan dan mengikuti kebenaran, sebaliknya kekeliruan cara berpikir dapat menempatkan manusia sejajar dengan mahkhluk yang tidak berakal. Hal ini diisyaratkan surat al Furqan/25:44 ) 5. Kemampuan akal bisa ditingkatkan melalui pengalaman kegiatan intelektual, seperti meneliti fenomenaalam berupapenggantian siangdan malam,proses turunnya hujan dan bagaimana air menghidupkan tanaman serta fungsi perkisaranangina,sepertiyangdiisyaratkandalamsuratalJatsiyah/45:5

82

MalindaJoLevin, Op.cit, h.109

61

6. Pengalamanberstrukturdapatmeningkatkankecerdasanakal,sepertiberusaha memilahmilahdanmenangkappesanalQuran.Halinidiisyaratkansuratal Zukhruf/43:13dansuratFuhshilat/41:34 ) ( 7. Bahwa kapasitas akal tiap orang berbedabeda. AlQuran banyak mengisyaratkan adanya orangorang yang tidak mampu secara optimal menggunakanakalnya,sepertiyangdiisyaratkansuratalAnkabut/29:63 dansuratYunus/10:42 ( ) 8. Penggunaan panca inder secara optimal dapat membantu meningkatkan kecerdasanakal,sepertiyangdiisyaratkansuratalAnfal/8:22 ) ( b.TandatandaKecerdasanAkal Dalam filsafat, kebenaran bisa dibuktikan dengan argument logika, maka kecerdasan akal dalam perspektif ini dapat dilihat dari kemampuannya berpikir logis. Di dunia pendidikan juga dikenal adanya tes IQ, yang mempunyai tujuan agar dapat mengetahui tingkat kecerdasan murid, demikian juga di lingkungan pendidikan tinggi dikenal adanya Test Potensi Akademik. AlQuran tidak berbicara tentang logika, tetapi sebagai wahyu yang berasal dari Tuhan Yang Maha Mengetahui dan ditujukan untuk manusia yang berakal, maka kebenaran logis juga terkandung di dalamnya. Dalam hal kecerdasan akal, alQuran mengisyaratkan adanya tolak ukur kecerdasan, seperti yang terdapat dalam ayat alQuran,dengancriteriakriteriasebagaiberikut: 1)MampuMemahamiHukumKausalitas

cq=)s? xsr& 4 $ygZ9$#ur @9$# #n=Gz$# &s!ur MJur t %!$# uqdur


Dandialahyangmenghidupkandanmematikan,dandialah yang(mengatur)pertukaran malamdansiang.Makaapakahkamutidakmemahaminya.(Q.s.alMuminun/23:80)

Dariayatdiatas,diisyaratkanbahwadibalikkehidupandankematianada faktorfaktoryangmenyebabkannya.Demikianjugadibalikfenomenapergantian malam dengan siang ada systemsisttem yang mengendalikannya. Orang yang tidak mampu memahami fenomenafenomena yangdapatdisebutsebagai hokum sebabakibattersebutadalahtermasukorangyangkurangcerdas. 2)MampuMemahamiAdanyaSistemJagadRaya Dialog panjang antara Nabi Musa dengan Firaun yang dikisahkan dalam surat alSyuara/ 26:18668, menggambarkan ketidakmampuan akal firaun memahamifenomenajagadrayadimanadibalikitupastiadaSangPengaturYang MahaMengetahuidanMahaKuasa.DalamhaliniFiraundipandangtidakcerdas karena ufuknya sempit sehingga ia merasa dirinya sebagai Tuhan. Firaun tidak mampu memahami pernyataan Musa yang mengatakan bahwa Tuhan yang sebenarnyaadalahyangmenguasaiseluruhalamsemesta.( ) 3)MampuBerpikirDistinkif

62

Kemampuan berpikir distinkif, yakni mampu memilahmilah permasalahan dan menyusun sistematika dari fenomena yang diketahui, seperti yangdiisyaratkan suratalRad/13:4

xur b#uqZ @wUur yur 5=uZr& `iB MZy_ur NuqyftGB s% F{$# ur 9s b) 4 @2W{$# <t/ 4n?t $pk|t/ @exRur 7nur &!$yJ/ 4s+ 5b#uqZ cq=)t 5Qqs)j9 ;MtUy
Dan di bumi Ini terdapat bagianbagian yang berdampingan, dan kebunkebunanggur,tanaman tanaman dan pohon korma yang bercabang dan yang tidak bercabang, disirami dengan air yang sama.kamimelebihkansebahagiantanamtanamanituatassebahagianyanglaintentangrasanya. Sesungguhnya pada yang demikian itu terdapat tandatanda (kebesaran Allah) bagi kaum yang berfikir.(Q.s.13:4)

4)MampuMenyusunArgumenyangLogis Hal ini siisyaratkan surat alImran/ 3:6568 yang berisi teguran kepada kaum ahl alkitab yang saling berbantah tanpa argument yang logis. Ayat 65 dalamsuratalImranmisalnyaberbunyi.

.`B w) @fRM}$#ur p1uq-G9$# Ms9R& !$tBur tLdt/) cq`!$ys? zN9 =tG69$# @dr't cq=)s? xsr& 4 nt/
Hai ahlikitab, Mengapa kamu bantahmembantah[198] tentanghalIbrahim, padahal Taurat dan Injil tidak diturunkan melainkan sesudah Ibrahim. apakah kamu tidak berpikir. (Q.s. AlImran/ 3:65)

5).MampuBerpikirKritis Berpikir kritis terhadap pendapat dan gagasan yang disampaikan orang lainyangtidakmempunyaipijakankebenarandipaparkansuratalMaidah/5:103 misalnya menyebut tradisi jahiliah yang menetapkan aturan berupa perlakuan tertentuyangharusdilakukanterhadapbinatangternakuntadandombatersebut. Mematuhi tradisi yang tidak mempunyai pijakan kebenaran itu oleh alQuran dipandangsebagaiperbuatanbodoh.

tbrtIt (#rxx. t%!$# `3s9ur 5Q%tn wur 7's#ur wur 7pt6!$y wur ;outr2 .`B !$# @yy_ $tB tbq=)t w NdsY.r&ur ( z>s39$# !$# n?t
Allahsekalikalitidakpernahmensyari'atkanadanyabahiirah,saaibah,washiilahdanhaam.akan tetapi orangorang kafir membuatbuat kedustaan terhadap Allah, dan kebanyakan mereka tidak mengerti.(Q.salMaidah/5:103)

6).MampuMengaturTaktikdanStrategi

63

Perlunya kemampuan untuk mengatur taktik dan strategi perjuangan sehingga tidak terjebak pada strategi lawan, adalah sangat dibutuhkan. Hal ini diisyaratkan dalam surat alImran/ 3:118120. dalam ayat ini kaum mukminin diingatkanTuhanagartidak mempercayakantugastugasstrategiskepadaorang orangyangmempunyaiindikasimemusuhiIslam.

Zw$t6yz N3tRq9't w N3Rr `iB ZptR$s/ (#r-Gs? w (#qYtB#u t%!$# $pkr't


7)MampuMengambilPelajarandariPengalaman Surat alAraf/ 5:164169 menegur kaum Yahudi yang tidak bisa mengambil pelajaran dari sejarah yang mereka lalui. Ayat ini diakhiri dengan pertanyaanapakahmerekatidakmengerti 3.Roh Dalam bahasa Arab kalimat roh mempunyai banyak arti. Disamping kata (ruh) ada kata ( rih) yang berarti angina dan ( rawh) yang berarti rahmat. Roh dalam bahasa Arab juga digunakan untuk menyebut jiwa, nyawa, 83 nafas, wahyu, perintah dan rahmat. Jika kata rohani dalam bahasa Indonesia digunakanuntukmenyebutlawandaridimensijasmani,makadalambahasaArab, kalimat( () ruhaniyunruhani)digunakanuntukmenyebutsemua 84 jenismakhlukhalusyangtidakberjasad,sepertimalaikatdanjin. Dalam alQuran, roh, juga digunakan bukan hanya satu arti. Termterm yang digunakan alQuran dalam menyebut roh, bermacammacam. Pertama roh disebutsebagaisesuatu:

Wx=s% w) O=9$# z`iB OF?r& !$tBur n1u Br& `B yr9$# @% ( yr9$# `t tRq=tour
Danmerekabertanyakepadamutentangroh.Katakanlah:"RohitutermasukurusanTuhanku,dan tidaklahkamudiberipengetahuanmelainkansedikit".(Q.s.alIsra/17:85)

Melihat latar belakang turunnya ayat di atas, yaitu pertanyaan orang tentangrohyangbelumbisadijawabsecaramemuaskanolehmanusia,ketikaitu adalahroh manusia yang menjadikanseseorangmasihtetaphidup ) ( , atausepertiyangdikatakanolehalFarra ( ) 85 . Jawaban singkat alQuran atas pertanyaan itu menunjukkan bahwa roh akan tetapmenjadirahasiayanghanyadiketahuiolehTuhan.Kebanyakanpenyebutan rohdalamalQuransepertidalamsuratalAnbiya/21:91( , dan ) suratalSajdah/32:9( ( ) jugaQ.s.alTahrim/66:12,Q.s.alHijr/ 15:29, Q.s. Shad/ 38:72 adalah menunjuk pada roh yang dimaksud oleh teks di atas. Selanjutnya alQuran juga banyak menggunakan kalimat roh untuk menyebuthallain,seperti:

83 84

IbnManzhur, op.cit, jilidII,h.17631771 ibid, lihatpulaE.W.Lane,op.cit,Volume,I,.1182 85 ibid, h.1768

64

1. Malaikat Jibrih. Atau jenis malaikat lain, SuratQ.s.alSyuara/26:193,Q.salBaqarah2:87,Q.s.alNahl/16:102,Q.s. alMaarij/70:4,Q.s.alNaba/78:38,Q.s.alQadr/97:4 2. rahmatAllahkepadakaummukminin ( alMujadalah/58:22 ) 3. KitabsucialQuran( )alSyura/42:52 PenyebutanrohuntukalQuranmenurutparamufasirdinisbatkankepada 86 rohkebenaran. YaknibahwaalQuranmerupakanpenyebabadanyakehidupan akhiratseperti yangdisifatkandalamsuratalAnkabut/29:664bahwaakhiratitu adalahkehidupan yangsebenarnya ( . Sedangkanroh ) dalam hubungannya dengan Nabi Isa, seperti yang tersebut dalam surat alNisa/ 4:171 ( sebagian ) mufasirmenyebutbahwakalimat bukandalamartiditiupkanrohdari 87 AllahtetapiIsaitusendiriadalahwujudrahmatdancintaNya. Dalam perspektif system nafs, roh menjadi faktor penting bagi aktivitas nafs manusia ketika hidup dimuka bumi ini, sebab tanpa roh, manusia sebagai totalitastidaklagidapatberpikirdanmerasa. Tentang bagaimana hubungan roh dengan nafs, para ulama berbeda pendapatjustrupadapangkalmasalahnya,yaitupadapengertianroh.IbnManzhur mengutip pendapat Abu Bakar alAnbari yang menyatakan bahwa bagi orang Arabrohdannafs itu merupakandua namauntuksatuhal, yangsatudipandang muannats danyanglainnya mudzakar 88 .Parafilosofmuslimdanteologjugabanyakyangberusahamemuaskan hubungan nafs dengan roh, tapi menurut Majid AliKhan, mereka dipandang gagal dalam mendefinisikan konsep kehidupan karena kegagalannya 89 mendefinisikan roh dan nafs. Pendapat tentang kesamaan roh dan nafs itu didasarkanpadaayatQuransuratalZumar42:

4|s% L9$# Js ( $ygB$oYtB MJs? Os9 L9$#ur $yg?qtB tm }RF{$# uqtGt !$# 5Qqs)j9 ;MtUy 9s b) 4 K|B 9@y_r& #n<) #tzW{$# @ur |NqyJ9$# $pkn=t cr3xtGt
Allah memegang jiwa (orang)ketikamatinya dan (memegang) jiwa (orang) yang belummati di waktu tidurnya Maka dia tahanlah jiwa (orang) yang Telah dia tetapkan kematiannya dan dia melepaskanjiwayanglainsampaiwaktuyangditetapkan Sesungguhnyapadayangdemikianitu terdapattanda tandakekuasaanAllahbagikaumyangberfikir.(Q.s.alZUmar/39:42)

ImamFakhralRazi,op.citjuzXXVII,h.190 ibid, juzXI,h.115danIsmailIbnKatsiralQuraysyialDimasyqi,op.cit,jilidI,h.605 88 IbnManzhur,Op.cit, h.1768 89 dr.MajidAliKhan,IslamandEvolutionTheory, terjemahanIndonesiaolehCukSusanto, SHdenganjudulKonsepsiIslamtentangAsalUsuldanEvolusiManusia,(Yogyakarta:PLP2M, 1987),h.8199


87

86

65

Ayattersebutsecarajelasmengisyaratkanbahwanafsdalamkonteksayat diatasadalahroh yang berhubungandengan hidupdan matinya manusia, bukan nafsyangberhubungandengankegiatanberpikirdanmerasa. a.ProsesDatangnyaRoh Secarafenomenal,hilangnyarohdariseseorangdapatdilihat,danbahkan secara teknis dapat dilakukan suatu usaha untuk memisahkan roh dari jasadnya, misalnyadenganmenutupsaluranoksigen,melumpuhkanorgantubuhyangvital ataumenghentikansuplaaimakanandanminuman.Akantetapiprosesmasuknya rohkedalamjasad,ilmupengetahuanbelumbanyakberbicaraselainpengetahuan tentangkapankehidupanjasad(janin)mulaiterdeteksi. AlQuran secara tegas menyatakan bahwa roh ditiupkan kedalam jasad setelahjasaditusempurna,sepertiyangdisebutdalamsuratalSajdah/32:79

&s#nS @yy_ OO & `B `|SM}$# t,=yz r&yt/ur ( ms)n=yz >x @. z`|mr& %!$# yJ9$# N3s9 @yy_ur ( mmr `B m yxtRur m1qy OO &gB &!$B `iB 7's#n= `B cr6n@ $B Wx=s% 4 noyF{$#ur t|/F{$#ur
Yang membuat segala sesuatu yang dia ciptakan sebaikbaiknya dan yang memulai penciptaan manusiadaritanah.Kemudiandiamenjadikanketurunannyadarisaripatiairyanghina.Kemudian dia menyempurnakan dan meniupkan ke dalamnya roh (ciptaan)Nya dan dia menjadikan bagi kamu pendengaran, penglihatan dan hati (tetapi) kamu sedikit sekali bersyukur. (Q.s. al Sajdah/32:79)

Ayat di atas menyebutkan proses kejadian manusia, dari konsep penciptaanyangsempurna,kemudianprosesreproduksimanusiadarispermadan tahapantahapannya hingga janin sebagai jasad manusia mencapai kelengkapan untuk hidup dengan ditupkannya roh, dan setelah manusia berada dalam alam kehidupan diluar rahim, proses penyempurnaan jasad itu diikuti oleh proses penyempurnaankapasitaskejiwaan(pendengaran,penglihatandan hati). Dari ayat tersebut dapat disimpulkan bahwa roh hanya mungkin bersemayam dalam jasad manusia jika jasad itu telah mencapai kesempurnaan, dan selanjutnya roh akan meninggalkan jasad ketika organorgan jasad itu tidak mampu menjalankan mekanisme kehidupan. Kenyataannya memperlihatkan bahwa tidak ada manusia yang dapat bertahan hidup tanpa oksigen, atau tanpa organ vital, seperti jantung, kepala dan sebagainya. Disinilah roh sebenarnya 90 dapat diandaikan sebagai sinergi (synergy) Dari unsureunsur yang ada dalam systemtubuh.Jikajanindalamkandunganberadadalamkondisisempurna,maka roh akan dating menempatinya. Proses peniupan roh oleh Tuhan bisa dipahami sebagai pekerjaan khusus, tetapi bisa juga dipahami sebagai system penciptaan yangmerupakansunnatullah,sehinggabisadirumuskanjikaxmakay,dandalam lingkup inilah dunia kedokteran bekerja meningkatkan tingkat keselamatan
Dalam teori system, sinergi adalah kondisi dimana efek terpadu (cambined effect) dari dua macam elemen system akan berinteraksi danmenghasilkannilai lebih disbanding gabungan dari dua element tersebut. Lihat Togar M. Simatupang, Teori Sistem (Yogyakarta: Andi Offset, 1995),h.146
90

66

kelahirananak.Prinsipkehidupaninijugabisadibawapadakehidupanhewandan tumbuhtumbuhan. 4.Bashirah(HatiNurani) Bahasa mengenal istilah hati nurani atau kata hati atau hati kecil untuk menyebut kejujuran seseorang atas diri sendiri. Kata nurani diduga berasal dari bahasaArab yangartinyacahaya,dan ( nurani)artinyasejeniscahaya atauyangbersifatcahaya,sehinggahatinuranidapatdisebutsebagaicahayahati atau lubuk hati yang terdalam. Dalam bahasa Arab, hati nurani dalam konteks tersebutdisebutbashirah ( yangberasaldarikata ) DalambahasaArab, berartijendelahati, jikadisebut ) artinya pandangan dan lintasan hati. Sedangkan kata jika dikaitkan dengan nama Tuhan maka artinya Allah mampu melihat sesuatu 91 secara total, yang tampak maupun yang tidak tampa memerlukan alat. Jika dihubungkandenganmanusia,makamempunyaiempatarti,yaitu(a)ketajaman hati, ( ( b) kecerdasan (c) kemantapan dalam agama, dan (d) ) keyakinanhatidalamhalagamadanrealita.Meskipun jugamengandungarti melihat, tetapi jarang sekali kalimat tersebut digunakan dalam literature Arab 92 untukindrapenglihatantanpadisertaipandangan hati. Dengandemikian, maka hati nurani dapat dipahami sebagai pandangan mata hati sebagai lawan dari pandanganmatakepala. BashirahdalamartihatinuranidiisyaratkandalamsuratalQiyamah14:15

nt$ytB 4s+9r& qs9ur out/ mtR 4n?t `|RM}$# @t/


Bahkan manusia itu menjadi saksi atas dirinya sendiri. Meskipun dia mengemukakan alasan alasannya.(Q.s.alQiyamah/7:1415)

Sebagian mufasir, antara lain alFarra, ibn Abbas, Muqatil dan Said ibn 93 Jabirmenafsirkanbashirahpadaayatinisebagaimatabatin( ) Seperti yangdikutipolehalMaraghi,danFakhralRazimenafsirkannyadengan 94 , akal sehat. Menurtu Ibn Qayyim alJawzi, bashirah adalah cahaya yang ditiupkanAllahkedalamqalb( ,)olehkarenaituiamampu 95 memandanghakikatkebenaransepertipandanganmata. Jikadikaitkandengansystem nafsmanusia,makaarti bashirahyangtepat adalah seperti yangdipaparkanalFarradan FakhralRazi, yaitu matabatin atau akal sehat. Akan yang sehat jika digunakan secara optimal memungkinkannya mencapaikebenaran,karena ia memilikikekuatan yang samadenganpandangan mata batin, dan itu akan muncul secara optimal pada orang yang memiliki.

IbnManzhur, op.cit .jilidI,h.291 Ibid,h.290 93 ImamFakhralRazi,op.citJuzXXX,h.222danAhmadMushthafaalMaraghi,op.cit, jilidX,h.150 94 ImamFakhralRazi, ibid 95 IbnQayyimalJauzi,MadarijalSalikin(Beirut:DaralKutubalIlmiyah,1988),jilI,h. 139
92

91

67

Jika dibandingkan dengan qalb, maka hati nurani memiliki pandangan yang lebih tajam dan konsisten. Pada surat lQiyamah/ 75: 1415 di atas disebutkan bahwa bashirah itu tetap bekerja melihat meskipun manusia masih mengemukakan alas analasannya. Ayat ini sebenarnya juga mengisyaratkan karakter qalb yang tidak konsisten, yang meskipun mengerti kebenaran tetapi masih berusaha mengelak dengan mengemukakan alasanalasan ( .) Jadi hatinurani() tetapjujurdankonsitenmeskipunhati( )manusiamasih berusahauntukmenutupnutupikesalahannyaatauberdalihdengan berbagaialas an. Kekuatan konsistensibashirah adalah sangat wajar, karena seperti dikatakan olehIbnalQayyimalJawzibahwabashirahituadalahnurAllahyangditiupkan kedalam qalb. Bashirah atau hati nurani bukan hanya diperlukan untuk intropeksi diri, tetapijugauntuksecarajujurmemahamidanmengakuikebenaranagama.Dalam suratYusuf/12:108disebutkan:

( _yt6?$# `tBur O$tRr& >out/ 4n?t 4 !$# n<) (#qr& ?6y nyd @%
Katakanlah:"Inilahjalan(agama)ku,Akudanorangorang yangmengikutikumengajak(kamu) kepada Allahdenganhujjahyang nyata.(Q.s.Yusuf/12:108

Ibnkatsirmenafsirkanbashirahdalamayatinidenganmengatakanbahwa kebenaran agama Allah itu merupakan keyakinan yang bisa diuji dengan 96 bashirah,baikdegnanpendekatan syarImaupunaqli. DariketeranganalQuranmenyangkutnafsmakastrukturbashirahdalam systemnafsdapatdigambarkansebagaierikut:manusia memilikidimensirohani yang terdiri dari nafs, aql, qalb, ruh dan bashirah. Nafs diibarkan sebagai ruangan yang sangat luas dalam alam rohani manusia. Dari dalam nafs itulah manusiadigerakkanuntukmenangkapfenomenayangdijumpai,menganalisisnya dan mengambilkeputusan.Kerjanafsdilakukan melalui jaringanqalb,aql,dan bashirah, tetapi semua itu baru berfungsi ketika roh berada Dallam jasad dan fungsikejiwaantelahsempurna. Qalb merupakan bagian dalam nafs yang bekerja memahami, mengolah, menampung realitas sekelilingnya dan memutuskan sesuatu. Sesuai dengan potensinya maka qalb merupakan kekuatan yang sangat dinamis, tetapi ia temperamental, fluktuatif, emosional dan pasang surut. Untuk memecahkan masalahmasalahyangdihadapi,qalbbekerjadenganjaringanakal,tetapikondisi qalb dan akal seringkali tidak optimal sehingga masih dimungkinkan terkontaminasi oleh pengaruh syahwat, atau dorongan kepada halhal yang bersifat negatif, dan dalam keadaan demikian, aql dan qalb dapat melakukan belahmental,yakni memandangsesuatu yangsalah,denganalasanalasan( )yangdibuatnya,seakanakanyangsalahituwajar.Bashirahbekerjamengoreksi penyimpangan yang dilakukan oleh qalb dan aql.Dapat juga disebutkan bahwa kondisi qalb dan aql tingkat kesehatannya optimum itulah yang disebut hati nuraniataubashirah.
96

IsmailIbnKatsiralQurasyialDImasqi, op.cit,jilidIIh.513514

68