Anda di halaman 1dari 81

ByDW2011

PENUNTUNPRAKTIKUM
KIMIAORGANIK(KI2152)
KIMIA



LABORATORIUMKIMIAORGANIK
PROGRAMSTUDIKIMIA
FAKULTASMATEMATIKADANILMUPENGETAHUANALAM
INSTITUTTEKNOLOGIBANDUNG
2011

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
i
DAFTARISI

DAFTARISI..................................................................................................................................................i
JADWALPRAKTIKUM.................................................................................................................................ii
PERATURANUMUM:TUGASDANKEWAJIBANPRAKTIKAN..................................................................iii
BEBERAPAPERALATANLABORATORIUM................................................................................................1
PRINSIPDANTEKNIKDASARPEMISAHANDANPEMURNIAN................................................................5
A.DISTILASI...........................................................................................................................................5
B.REKRISTALISASI&SUBLIMASI.........................................................................................................10
C.EKSTRAKSI........................................................................................................................................16
D.KROMATOGRAFIKOLOMDANKROMATOGRAFILAPISTIPIS(KLT)................................................18
Percobaan1PEMISAHANDANPEMURNIANZATCAIR:Distilasi&TitikDidih...................................31
Percobaan2PEMISAHAN&PEMURNIANZATPADAT:Rekristalisasi&TitikLeleh............................33
Percobaan3PEMISAHANSENYAWAORGANIK:Ekstraksi...................................................................35
Percobaan4KROMATOGRAFIKOLOM&KROMATOGRAFILAPISTIPIS:PemisahanSenyawa
NitrofenoldanPemisahanZatPewarnaMakanan...............................................................................37
Percobaan5KEISOMERANGEOMETRI:PengubahanAsamMaleatmenjadiAsamFumarat............40
Percobaan7Hidrokarbon:SifatdanReaksiKimia................................................................................44
Percobaan8PEMBUATANTERSBUTILKLORIDA:ReaksiSubstitusiNukleofilikAlifatik.....................50
Percobaan9AlkoholdanFenol:SifatdanReaksiKimia.......................................................................52
Percobaan10EsterifikasiFenol:SintesisAspirin..................................................................................56
Percobaan11PEMBUATANSIKLOHEKSANON......................................................................................59
Percobaan12AldehiddanKeton:SifatdanReaksiKimia....................................................................61
Percobaan13REAKSISIKLOADISIDIELSALDERDANRETRODIELSALDER.........................................65
Percobaan14ISOLASIETILpMETOKSISINAMATDARIKENCUR(KaemferiagalangaL.)DAN
SINTESISASAMpMETOKSISINAMAT:SintesisTurunannyadanPenetapanStruktur........................67
Percobaan15IsolasiKafeindariTeh.....................................................................................................69
Percobaan16IsolasiKurkumindariKunyit(Curcumalonga)...............................................................72


Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
ii
JADWALPRAKTIKUM

MingguI
Percobaan1:PEMISAHANDANPEMURNIANZATCAIR:Distilasi&Titikdidih
Percobaan2:PEMISAHAN&PEMURNIANZATPADAT:RekristalisasidanTitikLeleh
MingguII Percobaan3:PEMISAHANSENYAWAORGANIK:Ekstraksi
MingguIII
Percobaan4:KROMATOGRAFIKOLOM&KROMATOGRAFILAPISTIPIS:PEMISAHAN
SENYAWANITROFENOLDANPEMISAHANZATPEWARNAMAKANAN
MingguIV

Percobaan5:KEISOMERANGEOMETRI:PengubahanAsamMaleatmenjadiAsam
Fumarat
Percobaan13:ReaksiSikloAdisiDielsAlderdanRetroDielsAlder
MingguV

Percobaan6:PEMBUATANSIKLOHEKSENA
Percobaan7:HIDROKARBON:SifatdanReaksiKimia
MingguVI
Percobaan8:PEMBUATANTERSBUTILKLORIDA:ReaksiSubstitusiNukleofilikAlifatik
Percobaan9:ALKOHOLDANFENOL:SifatdanReaksiKimia
MingguVII

Percobaan11:PEMBUATANSIKLOHEKSANON
Percobaan12:ALDEHIDDANKETON:SifatdanReaksiKimia
MingguVIII
Percobaan10:ESTERIFIKASIFENOL:SintesisAspirin
Percobaan15:IsolasiKafeindariTeh
MingguIX
Percobaan14:ISOLASIETILpMETOKSISINAMATDARIKENCUR(Kaempferiagalanga
L.)DANSINTESISASAMpMETOKSISINAMAT
Percobaan16:IsolasiKurkumindariKunyit(Curcumalonga)
MingguX UjianPraktikum




















Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
iii
PERATURANUMUM:TUGASDANKEWAJIBANPRAKTIKAN

SelamatdatangdiLaboratoriumPendidikanKimiaOrganik!

Sebelum Anda memulai bekerja di Laboratorium Kimia Organik, sudah menjadi keharusan bagi Anda
untuk mengenal dan memahami lebih dahulu segala sesuatu yang berhubungan dengan tempat ini, terutama
yang erat kaitannya dengan praktikum atau percobaan. Hal pertama yang harus ditekankan adalah bahwa
lingkungan laboratorium kimia organik sangat berbeda dengan laboratorium kimia lainnya. Di sini hampir
semua zat bersifat racun dan mudah terbakar. Banyak reaksi yang prosesnya sangat cepat (eksplosif); tetapi
banyak pula yang reaksinya sangat lambat sehingga memerlukan kondisi tertentu, misalnya pemanasan atau
pengadukan.BeberapahalyangperluAndaingatdanpahamiantaralain:
- Reaksi kimia organik pada umumnya lambat, karena yang terlibat adalah molekul; bagaimana cara
mempercepatnya?
- Untuk suatu reaksi yang diharapkan lebih sempurna (rendemennya banyak), sering diperlukan jumlah
pereaksinya yang berlebih; bagaimana pengaruh kelebihan pereaksi tersebut terhadap proses dan
bagaimanacaramenghilangkannyasetelahreaksiberakhir?
- Setiap reaksi memerlukan kondisi reaksi tertentu, misalnya suhu, yang sangat menentukan keberhasilan
prosesreaksitersebut;bagaimanacaranya?
- Melibatkan banyak teknikteknik laboratorium yang khas, misalnya ekstraksi, distilasi, koagulasi,
rekristalisasi dsb., dan juga ketrampilan yang memadai untuk menjalankannya; bagaimana supaya
terampil?
- Mengertidanmemahamisegibahayanyabekerjadilingkunganyangterdapatbanyakzatzatyangberacun,
mudahterbakaratautidakstabil;bagaimanacarauntukmengetahuinya?
- Mutlak diperlukan kebersihan, keterampilan, ketenangan, penguasaan teori, dan yang penting Anda
bekerjatanparaguragudanselalumenggunakanlogika.

Selamatbekerja!

1.HALHALPENTINGUNTUKDIINGAT
- Tidakadapraktikumsusulan
- Dilaboratoriumdilaranguntukmakan,minum,merokok,menerimatamusertamengobrol.
- Laboratorium hanya untuk mengerjakan percobaan sesuai dengan prosedur yang diterangkan oleh
Pemimpin Praktikum (dosen praktikum atau asisten praktikum yang sudah diberikan mandat oleh
dosenyangbersangkutan).
- SECEPATNYA MENYELESAIKAN PENGGANTIAN ALAT, BILA TERLAMBAT NILAI PRAKTIKUM ANDA
MENJADITatauE.

2.KESELAMATANKERJADILABORATORIUM
KesadaranKomunikasi
KENALI lokasilokasi dan cara pengoperasian fasilitas keselamatan kerja dan keadaan darurat, seperti
pemadamkebakaran,kotakP3K,alarmkebakaran,pintudarurat,dsb.
WASPADATerhadapberbagaikondisiyangtidakaman.
SEGERALAPORKANkondisikondisitakamankepadaPemimpinPraktikumatauAsistenPraktikum.

KeselamatanKerjaPribadi
- Pakailahpakaiankerjayangsesuaidenganpekerjaandilaboratorium.Gunakanselalujaslaboratorium
lenganpanjang.
- Gunakansepatutertutupyanglayakuntukkeamananbekerjadilaboratorium.Sepatuterbuka,sandal
atausepatuhaktinggiTIDAKBOLEHdigunakandilaboratorium.
- Gunakanselalukacamatapelindungdansarungtanganketikabekerjadenganzatzatyangberbahaya
daniritan.
- JANGANPERNAHMENGGUNAKANKONTAKLENSAketikabekerjadilaboratoriumkimiaorganik.
- Rambutyangpanjangharussealaludiikatdandimasukkankedalamjaslabuntukmenghindarikontak
denganzatzatberbahaya,mesinyangbergerakdannyalaapi.
- SelalucucitangandanlenganAndasebelummeninggalkanlaboratorium.

MelakukanPercobaan
- JANGAN PERNAH melakukan pekerjaan, penyiapan sampel atau percobaan TANPA ADANYA
PENGAWASANsupervisorlaboratorium(dosenpemimpinpraktiumdanasistenpraktikum).
- SelalupersiapkanprosedurkeselamatankerjaSEBELUMbekerjadilaboratorium.Andaharusmengacu
padaMaterialSafetyDataSheets(MSDS)setiapkalibekerjadenganzatzatkimiatertentu.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
iv
- Ceksemuaperalatansebelumdigunakan.Apabilaterdapatkerusakan,segeralaporkankepadapetugas
laboratoriumuntuksegeradiganti/diperbaiki.
- Pilihlahtempatyangtepatuntukmelakukanpercobaan.Percobaanyangmelibatkanzatzatberbahaya
danberacunharusdilakukandidalamlemariasam.
- DISKUSIKAN selalu setiap perkembangan dalam percobaan kepada asisten atau dosen pemimpin
praktikum.
- JANGAN meninggalkan suatu percobaan tanpa pengawasan, terutama percobaan yang menggunakan
bahanbahanyangmudahmeledakataumudahterbakar.
- Jika perlu, TEMPATKAN TANDA BERHATIHATI DAN NAMA ANDA di tempat percobaan sedang
dilakukan,jikapercobaanyangdilakukancukupberesikodanberbahaya.
- KenakanlabelnamadanNIMdijaslaboratoriumAndaagarmudahuntukdikenalidandihubungi.
- Lakukan selalu pengecekan terhadap halhal yang menunjang keselamatan kerja setiap kali selesai
percobaan.PASTIKANsemuakrangas,kranair,saluranlistrik,saluranvakumtelahdimatikan.

PenangananKhususZatzatBeracundanBerbahaya
- Andaharusmengetahuisifatfisikdankimiazatzatyangakandigunakandalamsetiappercobaan.Baca
danpahamiMSDStiaptiapzat!
- BerilabelreagendansampelyangAndagunakan.
- Simpanzatzatkimiadilokasiyangsesuai.
- JANGANMEMBUANGzatzatkimiakewasbak!
- Pindahkanzatzatkimiasisa,residuatauzattakterpakaikebotolbotolataujerigenyangkhususuntuk
zatzatsisa,yangtersediadilaboratorium.
- JANGANPERNAHmemipetsesuatudenganmulut!.
- Segerabersihkansetiaptumpahanzatkimiamaupunairdenganlapkering.Laporkansetiapkejadian
kepadapemimpinpraktikumatauasistenbilaAndaragucaramenaggulanginya!

BAHANKIMIA
- Bahanbahan kimia di laboratorium kimia organik harus dianggap beracun dan berbahaya. JANGAN
MAKAN DAN MINUM DI LABORATORIUM! Cucilah tangan Anda setiap akan meninggalkan
laboratorium!
- Selalu nyalakan lemari asam ketika bekerja di laboratorium. Kerjakan reaksireaksi yang melibatkan
senyawayangmudahmenguapdanmudahterbakardidalamlemariasam!
- Jika Anda menyimpan zatzat yang mudah menguap di meja Anda, tutuplah selalu wadah yang
digunakanuntukmenyimpanzattersebut!
- Jika Anda menumpahkan zat kimia di meja Anda, segera bersihkan dengan lap kering atau tissue.
Buanglahtissueataulapkotorditempatsampahyangdisediakandidalamlemariasam.Janganbuang
sampahdidalamwasbak!!
- JikaAndaterkenazatkimia,segeralahcucidengansabundanbilaslahdenganairyangbanyak.KECUALI
APABILA ANDA TERKENA TUMPAHAN/CIPRATAN BROM, FENOL ATAU ASAM SULFAT PEKAT (H
2
SO
4

PEKAT),HINDARIMEMBILASDENGANAIR!!!
- Jika terkena brom, segeralah bilas dengan anti brom yang disediakan di laboratorium. Kemudian
setelahbeberapasaat,bilaslahdenganairyangbanyak.
- Jika terkena fenol, segeralah bilas dengan anti fenol yang disediakan di laboratorium. Kemudian
setelahbeberapasaat,bilaslahdenganairyangbanyak.
- Jikaterkenaasamsulfatpekat,laplahbagiantubuhAndayangterkenaasamsulfatpekatdengantissue
keringatau lap kering. Kemudian setelahbeberapa saat, cucilahbagian tubuh Anda dengan air sabun
danairyangbanyak.
- Zatzatkimiaberikutsangatiritan,kecualijikadalamkonsentrasiencer:asamsulfat,asamnitrat,asam
hidroklorida(HCl),asamasetat,larutankaliumhidroksidadannatriumhidroksida.Berhatihatilah!
- Dimetilsulfoksida,walaupuntidakiritan,tapicepatsekaliterserapolehkulit.Berhatihatilah!

KECELAKAAN
- Jika Anda terluka atau mengalami kecelakaan di laboratorium, beritahu segera dosen pemimpin
praktikum.Segerahubungipihakmedisjikalukanyacukupserius.

BERSIAPSIAPLAH:
- Kenalilokasialatpemadamkebakaran,showers,selimutapi(jikatersedia)dankranairbersih.
- Baca dan pahami prosedur percobaan sebelum Anda bekerja di laboratorium. Jka Anda tidak
mengerti, bertanyalah pada asisten atau dosen pemimpin praktikum. Bekerja tanpa memahami akan
mengakibatkankecelakaanfatal!!

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
v
3.TATAALIRANKERJADANPENGATURANLABORATORIUM
- Semuapraktikanpadaharipelaksanaanpraktikum,menungguwaktumasukkedalamlaboratoriumdi
selasar depan laboratorium, kemudian masuklah dengan tertib sambil menandatangani daftar hadir
yangtersediadimejadekatpintumasuk.
- Waktu masuk laboratorium adalah tepat pada pukul 08.00 (sesi pagi) atau jam 13.00 (sesi siang).
Praktikanlangsungmasukdanmengisidaftarhadir,kemudianmenujumejamasingmasing.
- Diwajibkanmengikutipenjelasandaripemimpinkelompokatauasistenyangditunjuk(sekitar15menit)
- Mengajukan bon peminjaman peralatan yang diperlukan, misalnya termometer, buret, dll., kepada
petugasdilab.Labsetadalahsalahsatuperalatanyangbisadipinjamharian,artinyaselesaipratikum
harusdikembalikan.Kekuranganalatlain,peminjamannyadimasukkankedalamdaftarinventaris.
- Asisten akan membantu untuk mengatur permintaan keperluan zat/pereaksi yang diperlukan untuk
percobaanpadaharitersebut.
- Selesai menerima penjelasan praktikum oleh dosen pemimpin praktikum ayau asisten, praktikan
kembali ke meja masingmasing, dilanjutkan dengan peminjaman alat yang tidak ada di lemari, dan
pengambilan bahanbahan kimia yang diperlukan di tempat yang disediakan secara bergiliran.
Kemudianpemasanganperalatan,yangterlebihdahuludibersihkanataudikeringkan.
Bekerjalahdengantenang,cepatdantanparaguragu.
Bilamanamenghadapikesulitanataukeraguan,janganlahseganseganuntukmenanyakan
kepadaasistenkelompoknya.
- Adabeberapaperalatanyangdipakaibersamadanakandiletakkan(olehpetugas)hanyapadatempat
tempatyangtelahditentukan,antaralain:
Timbangan/Neraca Vaselin Meltingpointapparatus
Refraktometer selang Kertassaring
Gelaskapiler batudidih Pompavakum
Oven/alatpengering hairdryer Klemdanstatif
- Melaporkan dan menyerahkan hasil percobaan (sintesis), yang ditempatkan dalam botol kecil (lihat
contoh) yang bersih dan diberi label yang berisi nama, NIM, kelompok, nama zat, beratnya dan data
fisik.Inidilaporkansambilmembawabukucatatanpengamatan,dandiketahuiolehasisten.
- Pengembalian semua alat yang dipinjam pada hari tersebut (misalnya labset) harus dalam keadaan
bersih dan kering; asisten/petugas lab akan memeriksa keutuhan, kebersihan dan jumlah alatalat
tersebut.
- Apabila ada percobaan yang belum selesai dan perlu dilanjutkan minggu berikutnya (harus dengan
persetuajuan dosen pemimpin praktikum dan asisten), campuran reaksi/zat harus dipindahkan ke
tempat/labu kepunyaan sendiri, tutup dengan baik dan diberi tulisan/peringatan dan label nama.
Jagalahdarikemungkinantertumpahatauterbakar.
- Waktuuntukpulang,palinglambatpukul12.00(sesipagi)ataupukul17.00(sesisiang).Bersihkanlah
mejadanlantaitempatandabekerjasebelumAndapulang.
- Sekalilagi,selesaipratikumAndaharussudahmengecek:
- Apakahalatalatyangdipinjampadahariitusudahdikembalikankegudang?
- Apakahtempat/mejakerjaAnda(danlantai)sudahbersihkembali?
- ApakahbukucatatanpraktikumAndasudahditandatanganiolehasisten?
- Apakahkrangas,airdanlistrikdimejaAndasudahdimatikan?
- Kalausudahberes,dipersilakanmeninggalkanlab.

4.PERLENGKAPANPRAKTIKAN
Perlengkapan di bawah ini harus disediakan dan dibawa setiap kali melakukan praktikum. Jangan sampai
lupa!
- Bukucatatanpratikumataujurnalpraktikum:
- Berupa buku pertunjuk praktikum atau buku kuliah, ukuran A4, bergaris, dan disampul dengan
warna yang telah ditentukan berdasarkan pembagian kelompok yang diumumkan sebelum
pelaksanaanpraktikum(SELALULIHATPAPANPENGUMUMANDIDEPANLABORATORIUM!)
- Berilahnama,NIM,nomorkelompok,nomormeja/lemaridanidentitaslainnya.
- Dii halaman sampul belakang sebelah dalam, rekatkan satu lembar formulir yang menyatakan
bahwaAndatelahmenyerahkanlaporanyangsudahditandatanganiasistenAnda.
- Tugaspendahuluan(ditulistangan,diberinama,NIM,dannomorkelompok).
- Memakaijaslab,warnaputih,terbuatdaribahansederhana,danbertanganpanjang.
- Berpakaian rapi dan sopan, bersepatu (tidak boleh pakai sandal), dan selalu memakai kacamata
pelindung(dapatdipinjamdilaboratorium).
- PerlengkapanlainnyayangakanbanyakmembantukelancarankerjaAnda,antaralain:alattulis,korek
api,lapkain,tissue,sabun/detergen,pisaulipat,guntingkecil.

5.BUKUCATATANPRAKTIKUM
Sebelum melakukan praktikum, buku catatan praktikum harus sudah diisi dengan catatan persiapan
percobaanyangakandilakukanhariitu(dikerjakansebelumdatangkelaboratorium).Bukupersiapaniniakan
diperiksaolehasistenyangbersangkutandanakandiberinilai.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
vi
Bukucatatanpratikum,harusberisi:
- Nomorpercobaandanjudulpercobaan
- Tujuanpercobaan
- Teori/prinsippercobaan,cukupberupabeberapakalimatsingkatyangmeliputigarisbesarpercobaan,
misalnya persamaan dan mekanisme reaksi, halhal yang khusus mengenai percobaan tersebut, dan
lainlain.
- Data fisik dan kimia mengenai zatzat kimia yang digunakan pada percobaan saat itu. Carilah data
tersebut di berbagai Handbook dan buku teks, jangan lupa cantumkan sumber tersebut di referensi
ataudaftarpustaka.
- Pereaksi dan peralatan yang diperlukan. Pereaksi di kiri, peralatan di kanan, dengan cara diurut dari
ataskebawah.Bilaperlu,sertaidengangambarrangkaianperalatan.
- Diagram percobaan. Tujuannya untuk mempermudah urutan kerja yang akan dilakukan dan sebagai
gambaranpercobaankeseluruhan.Membuatdiagramyangbaikmemerlukanpengalamandanlatihan.
- Carakerjadanpengamatan.
Merupakan singkatan prosedur kerja yang berbentuk kalimat pendek berupa poinpoin pengerjaan.
Bagianbukudibagidua,sebelahkiriuntukcarakerja,danbagiankanannyauntukpengamatan.Berilah
cukupspasisupayacatatanpengamatanjelaspemisahannya.
Contoh:

CaraKerja Pengamatan
Campur5gsikloheksanol+10mLH
2
SO
4
pkt .
Refluks30menit warnajadihijau
pindahkankecorongpisah,ekstraksidenganeter dualapis
dst,dst .

- Hasilperhitungan
- Daftarpustaka.TuliskansemuasumberreferensitempatAndamengambilberbagaiinformasiyang
pentingyangAndajadikanrujukanuntukpercobaanyangbersangkutan.

ContohDiagramPercobaan:
PEMBUATANSIKLOHEKSANON

Sikloheksanol+H
2
SO
4
pekat

Refluks
distilasi90
o
C


Distilat Residu
dibuang
JenuhkandgnNaCl
+larNa
2
CO
3

testlakmus,netral
diekstraksi

LapisanAir LapisanOrganik

KeringkandenganCaCl
2

distilasipada8085
o
C

Sikloheksanon

6.LAPORANPRAKTIKUM
- DitulisdenganrapidanterbacapadakertasukuranA4takbergaris.
- Isi laporan, seperti urutan pada buku catatan praktikum, meliputi semua catatan pratikum, ditambah
dengan:
Sedikitlebihbanyakpembahasanteorinya(lebihlengkap)
Diskusi
Kesimpulan
- TitikberatpenilaianlaporanadalahpadabagianpembahasandiskusiAnda.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB

ByDW2011
vii
- Yang dibahas pada diskusi adalah pembahasan mengenai hasil percobaan sendiri, misalnya mengenai
hasil data percobaan yang dilakukan dibandingkan dengan hasil data pada literatur. Bila mengalami
kegagalan,dibahasfaktorfaktorapayangmenyebabkankegagalantersebut.
- Laporan diserahkan satu minggu setelah percobaan dilakukan. Keterlambatan menyerahkan laporan
akanmempengaruhinilailaporandannilaikeseluruhanpraktikumAnda,jadijanganterlambat!
- Setiap penyerahan laporan harus disertai bukti penerimaan oleh asisten. Untuk ini formulirnya sudah
disediakan(dimintaasisten),danditempelkanpadahalamanterakhirbukucatatanpratikum.

7.SISTEMPENILAIAN

Setiap dosen pemimpin praktikum diberi kebebasan untuk menentukan cara/bobot penilaian. Sebagai
gambaran, contoh bobot penilaian meliputi: persentase dari nilai ratarata: persiapan 10%, hasil kerja 35%,
laporan 35%, tes 20%. Ujian praktikum pada akhir semester setelah pelaksanaan seluruh materi praktikum
berkontribusi25%darinilaitotalpraktikum.

8.HALHALPENTINGLAINNYA
Sebelum praktikum dimulai, 12 minggu sebelumnya (sesuai jadwal) diharuskan sudah mulai mengambil
inventarislemari.Setiappraktikanakanmendapatnomorlemari,kemudiansecarabersamasamapetugas
lab melakukan pengecekan dan mencatatnya dalam daftar inventaris. Pada kesempatan ini sebaiknya
digunakan untuk mengenali nama dan bentuk peralatan (gelas) yang biasa digunakan dalam laboratorium
kimia organik. Hal ini penting karena baik nama maupun bentuk peralatannya banyak dan khas. Anda
harusmengecekjumlahdankeutuhanalatalatyangtersedia,karenakalausudahAndatandatanganpada
daftarinventarisdandiketahuiolehpetugasmakaselanjutnyasudahmenjaditanggungjawabAndasendiri.
Kunci lemari tidak boleh dibawa pulang. Setiap kali Anda praktikum/pulang Anda bisa
minta/mengembalikankuncikepadapetugaslaboratorium.
Padasetiappelaksanaanpraktikumakandisediakanlembarkerjapraktikumyangharusdiisidanpadaakhir
praktikumharusdiserahkankepadaasistensebagaidasarpenilaianlaporanpraktikumAnda.Jikalampiran
lembar data dengan data pada laporan berbeda, maka asisten berhak memberikan nilai nol (0) untuk
praktikumAnda.
Pada akhir program praktikum maka inventaris di dalam lemari harus dikembalikan. Pengecekan akan
dilakukan terhadap: jumlah dan jenis alat (dicocokan dengan daftar inventaris), mencatat kekurangan,
kerusakan dan pemecahan alat yang diganti. Pada prinsipnya, penggantian alat dilakukan dengan
menggantijenisdankualitasalatyangsama.
Mohon diingat, penggantian alat yang rusak harus segera dilakukan begitu praktikum yang bersangkutan
selesai. Jangan menunggu sampai akhir keseluruhan program praktikum berakhir! Keterlambatan
penyelesaian masalah penggantian alat yang pecah atau rusak akan mempengaruhi nilai akhir praktikum,
sebabjikasampaibataspenyerahannilaibelumselesai,AndabisadinyatakantidaklulusataudiberinilaiT.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 1
BEBERAPAPERALATANLABORATORIUM

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 2

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 3
Beberapa Peralatan Laboratorium Kimia Organik
Labu bundar
Labu leher tiga
Labu leher dua
penghubung labu ke
kondensor
Adaptor yang bisa
dihubungkan ke
vakum
penghubung Claissen
Labu isap
Corong Pisah
Kondensor
kolom untuk
kromatografi
Corong Buchner (terbuat
dari keramik porselain)
atau Corong Hirsch
(terbuat dari kaca)
Penghubung umum
Pemanas listrik dengan pengaduk
bermagnet (magnetic stirrer
hotplate)
Labu takar/Labu volumetrik

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 4
PERHITUNGAN DATA HASIL PERCOBAAN DI LABORATORIUM

Analisis kuantitatis suatu hasil percobaan di laboratorium sangat diperlukan. Metode kuantitatif yang umum
digunakan di laboratorium kimia organik adalah penentuan persen kesalahan, persen kemurnian, persen perolehan
kembali(recovery),danpersenrendemen/hasil(yield).

Perhitungan persen kesalahan digunakan sebagai perbandingan antara suatu data fisik yang teramati di percobaan
(misalnya titik leleh atau titik didih) dengan data yang diperoleh dari literatur. Persen kesalahan menunjukkan
seberapa dekat hasil percobaan yang telah dilakukan dengan nilai yang diharapkan. Sebagai patokan umum, jika
persen kesalahan untuk data fisik yang diperoleh dari hasil percobaan melebihi 5%, maka identitas senyawa yang
diperolehharusdipertanyakan.Perhitunganpersenkesalahanmenggunakanpersamaanberikut:

nilai dari literatur - nilai dari percobaan


% Kesalahan = 100
nilai dari literatur
x
| |
|
\ .

Perhitungan persen kemurnian digunakan untuk menentukan kemurnian senyawa yang dihasilkan dari percobaan.
Persenkemurnianbersinonimdenganpersenpersenkomposisi.Datakemurniankuantitatifseringkalidiperolehdari
data hasil pengukuran menggunakan metode kromatografi (misalnya GC atau HPLC). Perbandingan antara jumlah
suatu senyawa berdasarkan pengukuran kromatografi dengan jumlah semua senyawa dalam sampel yang sama dari
pengukurankromatografiyangsamamerupakandasardaripersenkemurnian.Jikakemurnianprodukkurangdariada
85% maka produk tersebut harus dimurnikan lebih lanjut. Perhitungan persen kemurnian menggunakan persamaan
berikut:

jumlah senyawa yang diharapkan dalam sampel


% Kemurnian = 100
jumlah semua senyawa yang terdapat dalam sampel
x
| |
|
\ .

Perhitungan persen perolehan kembali (recovery) digunakan untuk membandingkan massa material yang ada pada
saat awal prosedur percobaan (belum dimurnikan, masih campuran) terhadap massa material setelah proses
pemisahan/pemurnian dilakukan. Persen perolehan kembali memberikan indikasi ketelatenan dan ketelitian
seseorang dalam melakukan percobaan. Dalam sebagian besar prosedur, Anda akan kehilangan beberapa material
dikarenakan tumpah, adhesi material pada peralatan gelas, atau hilang karena halhal mekanik lainnya. Pada
praktikum kimia organik, jika persen perolehan kembali kurang daripada 85%, maka diasumsikan terjadi kesalahan
prosedur atau kelalaian yang dilakukan oleh Anda sebagai praktikan. Tetapi Anda harus memperhitungkan terlebih
dahulukemurnianmaterialsebelummengambilkesimpulanterhadapberhasilatautidaknyaprosesperolehankembali
ataupemurnianyangAndalakukan.

berat senyawa yang diperoleh kembali setelah pemisahan


% Perolehan kembali = 100
berat awal senyawa sebelum pemisahan
x
| |
|
\ .

Perhitungan persen rendemen/hasil (yield) diguankan untuk menentukan efesiensi atau tidaknya suatu reaksi kimia.
PerhitunganpersenrendemenmengharuskanAndauntukdapatmenuliskanpersamaanreaksiyangsetaradarireaksi
yangberlangsung.Andaharusmengubahmassaatauvolumesemuapereaksiawalmenjadimol,sehinggaAndadapat
menghitungrendemen/hasilteoritisnya.Perhitunganakhiradalahmerupakanperbandinganantararendemenproduk
yang diperoleh berdasarkan hasil percobaan dengan rendemen teoritis. Dalam praktikum kimia organik, jka persen
renemen di bawa50%, maka hal tersebut menunjukkan adanya masalah dalam pengerjaan prosedur percobaan.
Namu,sekalilagiAndaharusmempertimbangkanterlebihdahulukemurnianmaterialsebelummenyimpulkanberhasil
atautidaknyapengerjaanprosedurpercobaanyangAndalakukan.

rendemen/hasil yang diperoleh pada percobaan


% Rendemen/hasil = 100
rendemen/hasil berdasarkan perhitungan (teoritis)
x
| |
|
\ .

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 5
PRINSIPDANTEKNIKDASARPEMISAHANDANPEMURNIAN

A.DISTILASI

Distilasimerupakanmetodeyangsangatbaikuntukmemurnikanzatcair.Suatuzatcairmengandungatom
atom atau molekul yang tersusun berdekatan namun masih dapat bergerak bebas dengan energi yang berlainan.
Ketika suatu molekul zat cair mendekati perbatasan fasa uapcair, maka molekul tersebut, jika memiliki energi yang
cukup, dapat berubah dari fasa cair menjadi fasa gas. Hanya molekulmolekul yang memiliki energetika yang cukup
yangdapatmengatasigayayangmengikatantarmolekuldalamfasacairsehinggadapatmelepaskandirikedalamfasa
gas.
Beberapamolekulyangberadadalamfasauapdiataszatcair,ketikamendekatipermukaanzatcairtersebut,
dapatmemasukifasacairkembalisehinggamenjadibagiandarifasayangterkondensasi.Padasaatprosesiniterjadi,
molekulmolekultersebutmemperkecilenergikinetiknya,sehinggagerakannyalebihlambat.Pemanasanterhadapzat
cairmenyebabkanbanyakmolekulmemasukifasauap;prosespendinginanuapmerupakankebalikandariprosesini.
Ketika sistem berada dalam kesetimbangan, karena banyak molekul zat cair yang memasuki fasa uap dan
kemudian kembali lagi dari fasa uap menjadi cair, maka dapat terukur tekanan uapnya. Jika sistem tetap bertahan
dalamkesetimbangan,bahkanketikaenerginyadinaikkan,banyakmolekuldalamfasacairakanmemilikienergiyang
mencukupiuntukberubahmenjadifasauap.Walaupunbanyakmolekulyangjugakembalidarifasauapkedalamfasa
cair, namun jumlah molekul dalam fasa uap bertambah dan tekanan uap akan naik. Jumlah molekul dalam fasa uap
sangatbergantungpadasuhu,tekanandankekuatangayatarikantarmolekuldidalamfasacairdanvolumesistem.
Jika dua komponen berbeda (A dan B) terdapat dalam fasa cair, uap di atas permukaan fasa cair akan
mengandung beberapa molekul setiap komponen. Jumlah molekul A dalam fasa uap akan ditentukan oleh tekanan
uap A dan fraksi mol A dalam campuran. Dengan kata lain, jumlah relatif komponen A dan B dalam fasa uap akan
berhubungan erat dengan tekanan uap tiap zat cair murni. Hubungan ini secara matematis diungkapkan menurut
hukumRaoult:

P
total
=P
A
+P
B
,dimanaP
A
=P
A
XAdanP
B
=P
B
XB
P
A
=tekananparsialA
P
B
=tekananparsialB
P
A
=tekananuapmurniA
P
B
=tekananuapmurniB
X
A
=fraksimolAdalamfasacair
X
B
=fraksimolBdalamfasacair

Tekananuaptotaldiataspermukaancampuranzatcairadalahpenjumlahankeduatekananparsialantarakomponen
A dan B. Ketika suhu naik, tekanan uap masingmasing komponen bertambah, sehingga secara proporsional
meningkatkantekananuaptotaldiataspermukaancampurancair.Padabeberapasuhu,jumlahtekananparsialsama
dengan760torr(1atm)danpadasaatinilarutanmulaimendidih.Secaraumum,titikdidihdidefinisikansebagaisuhu
ketika jumlah tekanan parsial di atas fasa cair sama dengan tekanan luar yang dikenakan pada sistem. Penurunan
tekanan luar menyebabkan larutan akan mendidih pada suhu lebih rendah penaikan tekanan luar menyebabkan
larutanakanmendidihpadasuhulebihtinggi.HukumRaoultjugamemberikaninformasitentangkomposisifasauap
diataspermukaanzatcair:
X
A
=fraksimolAdalamfasauap=P
A
/P
total

X
B
=fraksimolBdalamfasauap=P
B
/P
total

Ilustrasi teori dasar distilasi berdasarkan hukum Raoult dan hukum Dalton tentang tekanan parsial adalah
sebagaiberikut:
A.SampelZatCairMurni
EKinetikzatcairbertambah

Banyakmolekulmencapaikecepatanmelepaskandiri

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 6

Gambar1Ilustrasiprosesdistilasisampelmurni

Hukum Dalton tentang tekanan parsial: tekanan total (di atas permukaan fasa cair): P
T
= P
air
+ P
sampel
dan
P
sampel
menjadilebihjelaspadaTtinggi.
TeoriDistilasi(keterangangambar):
- KetikaTnaik,jumlahmolekulyangmelepaskandiridarifasacairmenujufasagasakanbertambah.Tekanan
uapakanbertambahdenganpenambahanjumlahsampelpadafasauap.
- Pengaruh total adalah bahwa jumlah pertambahan molekul udara akan digantikan sampai semua molekul
udaradigantikanolehfasauapsampel.PadasaatiniP
T
secarakhususmerujukpadaP
sampel.

- Fasacairmulaimendidih(terbentukgelembung)ketikaP
T
=P
sampel
.
- Padaposisiini,molekulakanmasukkefasagasdarifasacairsampeldanakanmenggantikanmolekulmolekul
yangsudahadadalamfasatersebut.Tekananparsialmolekulsampeltidakakanbertambahlagi.
- Penguapanbertambahdengancepatdanpendidihandimulai(=b.p.=titikdidih)

B.CampuranDuaKomponen

HukumDalton:

Kitaharusmempertimbangkanberapabanyaktiapkomponenterdapatdalamcampuran.Fraksimol(X)merupakan
fraksisuatukomponentertentuyangterdapatdalamkeseluruhansampel;komponeniniharussalingcampurdengan
komponenlainnya:

HukumRaoult:

Awalnya:

komponendengantitikdidihlebihrendahkontribusinyalebihbanyakpadaP
T
,jikacampuranawal1:1
maka .
Kemudian:

tetapiketikadistilasiberlanjut, akanbertambahkarenabanyaksenyawadengantitikdidih
lebihrendahtelahmenguap.

Dengandemikian,komponendengantitikdidihlebihrendahyangproporsinyalebihtinggiakanterdistilasipertama
kali,selanjutnyadiikutiolehpeningkatanjumlahkomponendengantitikdidihlebihtinggi.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 7

C.PengaruhZatPengotor
Contoh: gula dilarutkan dalam air. Zat pengotor yang nonvolatile (tidak menguap) seperti gula dapat
menurunkan tekanan uap air murni karena pelarutan gula menurunkan konsentrasi komponen yang volatile (dapat
menguap, seperti air) di dalam fasa cair. Karena tekanan uap rendah, suhu yang lebih tinggi dibutuhkan untuk
mencapai pendidihan. Pada proses distilasi, ketika proses pendidihan tercapai, suhu di atas permukaan campuran
akanmasihberadapada100
o
Cpada1atmkarenazatcairyangterkondensasidiujungbawahtermometeradalahair
murni (tidak terkontaminasi oleh gula). Tetapi suhu di dalam campuran pada fasa cair (dalam labu) akan secara
bertahap naik selama proses distilasi berlangsung seiring dengan bertambahnya konsentrasi gula (ingat: air telah
menguap).
Pengaruhzatpengotorterhadapnaiknyasuhupadaprosesdistilasidapatdilihatpadagrafikhubunganantara
tekananluardengansuhusistem(Gambar2).Untukpemisahanterbaiksehinggamendapatkankomponenkomponen
yang murni, distilasi bertingkat merupakan alternatif yang baik, terutama untuk campuran dua komponen atau lebih
dan campuran yang mengandung zat pengotor nonvolatil. Ilustrasi proses pemisahan dengan distilasi bertingkat
dapatdilihatpadaGambar3.

Gambar2Grafikpengaruhzatpengotorpadacampuran

Distilasi Sederhana: Distilasi sederhana (lihat Gambar 6) adalah proses distilasi yang tidak melibatkan kolom
fraksinasiatauprosesyangbiasanyauntukmemisahkansalahsatukomponenzatcairdarizatzatnonvolatilatauzat
cairlainnyayangperbedaantitikdidihnyapalingsedikit75
o
C.Kondensatpadadasarnyaakanmemilikiperbandingan
mol fasa cair yang sama dengan fasa uap pendidihan dari fasa cairnya. Distilasi sederhana tidak efektif untuk
memisahkankomponenkomponendalamcampuranyangperbedaantitikdidihnyatidakterlalubesar.

Gambar3Ilustrasiprosesdistilasibertingkatpadasampelcampuranduakomponenataulebihatauyang
mengandungzatpengotor
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 8
Distilasi Bertingkat: Jika suatu kolom fraksinasi digunakan dalam perangkat distilasi (lihat Gambar 7), maka
pemisahan senyawasenyawa yang memiliki titk didih berdekatan dapat dipisahkan dengan baik. Kolom fraksinasi
biasanyadiisidenganmaterialberposriyangmenyediakanluaspermukaanyanglebihbesaruntukproseskondensasi
berulang. Pengembunan uap bertitik didih lebih tinggi melepaskan kalor yang menyebabkan penguapan zat cair
bertitikdidihlebihrendahpadakolom,sehinggakomponenbertitikdidihrendahinibergerakkeatasmenujukolom,
sementara komponen bertitik didih tinggi bergerak ke bawah ke arah kondensor, walaupun sebagian kecil ada yang
kembaliturunkedalamlabudistilasi.Setiapprosessikluspengembunan/penguapanmenghasilkanfasauapakanlebih
kayadenganfraksiuapkomponenyanglebihvolatile.
Contoh:campuran60:40sikloheksana(t.d.81
o
C)dantoluen(t.d.110
o
C).Campuraniniakanmendidihpada
88
o
Cmenghasilkanuapdiatascampuranyangmendidihterdiridaricampuransikloheksanatoluen=83:17.Proses
kondensasiberulangpadakolomfraksinasimenghasilkanfasauapdengankomposisi95:5sikloheksana:toluen.Proses
ini dapat dilihat pada Gambar 4. Kurva di bawah menunjukkan komposisi fasa cair dan kurva di atas menunjukkan
komposisifasauap.Prosespengembunanditandaidengangarishorizontalyangmenghubungkankeduakurva.Setiap
pengulangansikluspengembunandanpenguapanakanmenghasilkansikloheksanayanglebihmurni.Setiapsiklusini
disebutpelatteoritis.Kolomfraksinasiyangbiasadigunakandilaboratoriumorganikmemiliki35pelatteoritis.

Gambar4KurvaDistilasiUap/CairantaraSuhuKomposisiuntukcampuransikloheksanatoluen

KurvaDistilasi:Jikaprosesdistilasisederhanadanbertingkatdialurkandalamsatugrafik(menggunakanpembacaan
suhu terkoreksi), maka akan terlihat fenomena seperti pada Gambar 5. Kurva ini memberikan informasi efisiensi
pemisahan komponen suatu campuran. Kelebihan distilasi bertingkatdaripadadistilasi sederhanadapat dilihatpada
datarnya kurva yang berarti titik didih lebih akurat dan dapat digunakan untuk mengidentifikasi titik didih fraksi tiap
komponen.
Azeotrop: Tidak semua campuran zat cair mengikuti hukum Raoult. Contoh: etanol dan air, disebabkan
adanyainteraksiantarmolekul,membentuksistemazeotrop.Campuran95,5%etanoldan4,5%airmendidihdibawah
titikdidihetanolmurni,sehinggaetanol100%takdapatdibuatsecaradistilasibiasa.Suatucampuranzatcairdengan
komposisitertentuyangmengalamidistilasipadasuhukonstantanpaadanyaperubahandalamkomposisinyadisebut
azeotrop.
Kalibrasi termometer: Mengkalibrasi titik nol termometer, dilakukan dengan cara mencelupkan
termometer pada campuran aires yang diaduk homogen, sedangkan untuk titik skala 100 termometer dilakukan
sebagai berikut: isikan kedalam tabung reaksi besar 10 mL aquades, masukkan sedikit batu didih. Klem tabung
tersebuttegaklurus,panaskanperlahansampaimendidih.Posisikantermometerpadauapdiataspermukaanairyang
mendidihtersebut.Untukmenentukantitikdidihyangsebenarnyadariair,harusdiperiksatekananbarometer.

Gambar5Kurvadistilasisederhanavsbertingkat
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 9

airmasuk
airkeluar
statif
kondensor
Adaptor
termometer
klem
manice/bosehead
manice
/bose
head
klem
labubundar
pemanaslistrik
berpengadukmagnet
(hotplatemagneticstirrer)
statif
gelasukur
atau
wadah
penampung
distilat
batang
pengaduk
magnet

Gambar6Rangkaianalatdistilasisederhana
airmasuk
airkeluar
kondensor
(tanpadialiriair!)

Gambar7Rangkaianalatdistilasibertingkat
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 10
B.REKRISTALISASI&SUBLIMASI

ApabilapadapercobaanterdahuluAndatelahdiajarkancarapemisahandanpemurniandaricampurancairan
dengan teknik distilasi, pada bagian ini Anda diperkenalkan dengan cara pemurnian zat padat dengan teknik
kristalisasi. Prinsip pemisahaan atau pemurnian dengan teknik ini didasarkan pada: pertama, adanya perbedaan
kelarutan zatzat padat dalam pelarut tertentu, baik dalam pelarut murni atau dalam pelarut campuran; dan kedua,
suatu zat padat akan lebih larut dalam pelarut panas dibandingkan dengan pelarut dingin. Sebagai contoh, jika zat
padat A sukar larut, sementara zat padat B sangat mudah larut dalam pelarut X, maka adalah logis apabila Anda
memisahkanAdariBdenganmencampurkanAdanBdenganpelarutX,zatAakantertinggalsebagian,sedangkanzat
B akan larut semuanya. Contoh lain adalah zat A dan B samasama sukar larut dalam pelarut X, tetapi perbandingan
jumlahAjauhlebihbanyakdariB.DengandemikianapabilaAndamenggunakanjumlahpelaruttertentuXAndadapat
melarutkan seluruhnya B, sedangkan A sebagian, sehingga A dapat dipisahkan dari B. Kedua contoh di atas belum
menjelaskan proses kristalisasi, karena proses ini menuntut adanya perubahan fasa zat padat yang terlarut dalam
larutanmenjadikristal,yangdijelaskanolehprinsipkeduadiatas,yaituAndaharusmembuatlarutanjenuhAdanB
dalam pelarut X panas (yaitu pada titik didih pelarut X) dan mendinginkannya kembali sehingga A mengkristal,
sedangkan B tidak mengkristal (karena mudah larut atau karena jumlahnya sangat sedikit). Zat A selanjutnya
dipisahkan dari zat B yang larut dengan cara penyaringan dengan saringan isap. Proses melarutkan zat padat tidak
murni dalam pelarut panas, yang dilanjutkan dengan pendinginan larutan tersebut untuk membiarkan zat tersebut
mengkristal,adalahteknikkristalisasi.
Sesuai dengan prinsip dan teknik kristalisasi tersebut di atas, hal yang menentukan keberhasilannya adalah
memilih pelarut yang tepat. Pelarut yang tepat adalah pelarut yang sukar melarutkan senyawa pada suhu kamar,
tetapi dapat melarutkan dengan baik pada titik didihnya. Kadangkadang, atau bahkan seringkali, Anda tidak
mendapatkanpelarutyangsesuaidenganpatokantersebut.Banyakzatpadatlarutbaikdalamdalamkeadaanpanas
maupundalamkeadaandingin,ataukalaupunadapelarutyangsukarmelarutkandalamkeadaandingin,iajugatidak
mampu melarutkan dalam keadaan panas. Jika Anda menghadapi kenyataan tersebut, maka Anda dapat melakukan
kristalisasi dengan sistem dua campuran pelarut, yaitu salah satu pelarut (X) adalah yang sangat melarutkan,
sementara yang lainnya (Y) yang tidak melarutkan sama sekali. Caranya adalah Anda larutkan zat padat tidak murni
tersebut dalam pelarut X sesedikit mungkin (beberapa mL) dalam keadaan panas, kemudian masih dalam keadaan
panas tersebut Anda tambahkan sedikit demi sedikit pelarut Y sehingga diperoleh larutan jenuh, dan selanjutnya
didinginkan.Apabilazatpadattersebuttelahmengkristaldalamkeadaandingin,makaAndamemisahkannyadengan
carapenyaringanisap.

A.Prosespelarutanzatpadat
Jumlah terkecil pelarut yang digunakan dalam melarutkan sejumlah padat, disebut larutan jenuh. Tidak
banyakzatpadatdapatlarutdalamkeadaaninikarenadalamkeadaankesetimbangan.Sedikitsajasuhudidinginkan
akanterjadipengendapan.Sejumlahenergidiperlukanuntukmelarutkanzatpadat,yaituuntukmemecahkanstruktur
kristalnya(=energikisi)yangdiambildaripelarutnya.

B.Kristalisasi
Proseskristalisasiadalahkebalikandariprosespelarutan.Mulamulamolekulzatterlarutmembentukagregat
denganmolekulpelarut,laluterjadikisikisidiantaramolekulzatterlarutyangterustumbuhmembentukkristalyang
lebih besar diantara molekul pelarutnya, sambil melepaskan sejumlah energi. Kristalisasi dari zat murni akan
menghasilkan kristal yang identik dan teratur bentuknya sesuai dengan sifat kristal senyawanya. Dan pembentukan
kristaliniakanmencapaioptimumbilaberadadalamkesetimbangan.

C.PemilihanPelarutuntukrekristalisasi
Pelarut yang paling banyak digunakan dalam proses rekristalisasi adalah pelarut cair, karena tidak mahal,
tidak reaktif dan setelah melarutkan zat padat organik bila dilakukan penguapan akan lebih mudah memperolehnya
kembali.Kriteriapelarutyangbaik:
Tidakbereaksidenganzatpadatyangakandirekristalisasi.
Zat padatnya harus mempunyai kelarutan terbatas (sebagian) atau relatif tak larut dalam pelarut, pada suhu
kamaratausuhukristalisasi.
Zatpadatnyamempunyaikelarutanyangtinggi(larutbaik)dalamsuhudidihpelarutnya.
Titikdidihpelaruttidakmelebihititiklelehzatpadatyangakandirekristalisasi.
Zatpengotoryangtakdiinginkanharussangatlarutdalampelarutpadasuhukamaratautidaklarutdalampelarut
panas.
Pelarut harus cukup volatile (mudah menguap) sehingga mudah untuk dihilangkan setelah zat padat yang
diinginkantelahterkristalisasi.

Jika data kelarutan tidak diperoleh dalam literatur, harus dilakukan penentuan kelarutan zat padat tersebut dalam
sejumlah pelarut,dengancara mengurutkepolaranpelarutpelarut tersebut. Urutankepolaran(titik didih, dalam
o
C)
beberapapelarut:
air(100)>metanol(65)>etanol(78)>aseton(56)>metilenklorida(40)>etileter(35)>kloroform(61)>benzena(80)
>CCl
4
(76)>ligroin(90115)>heksana(68)>petroleumeter(3560)>pentana(36).
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 11
D.CaraRekristalisasi
Secaraumum,rekristalisasidilakukansesuaidengantahapanberikutini:

Apabilalarutanyangakandikristalkanternyataberwarna,padahalkitatahuzatpadatnyatakberwarna,maka
kedalam larutan panas sebelum disaring ditambahkan norit (arang halus) atau arang aktif. Tidak semua zat warna
dapat diserap arang dengan baik. Zat warna yang tidak terserap ini akan tetap tinggal dalam induk lindi tetapi akan
hilang pada waktu pencucian dan penyaringan. Penggunaan norit ini tidak boleh diulang apabila larutannya masih
berwarna.Penggunaannoritjanganberlebihansebabbisamenyerapsenyawanya.
Pembentukan kristal biasanya memerlukan waktu induksi yang berkisar beberapa menit sampai satu jam.
Kadangkadang didapati suatu keadaan yang disebut lewat jenuh (supersaturation), dimana kristalkristal baru mau
keluar bila dipancing dengan sebutir kristal murni. Keadaan ini kadangkadang sangat menguntungkan dalam
pemisahan campuran dua atau lebih zat yang mempunyai kelarutan yang sama dalam suatu pelarut tertentu dan
jumlah komponen komponen campuran berbeda banyak satu dari yang lain. Agar pemisahan dapat dilakukan,maka
keadaan jenuh jangan diganggu, yaitu dengan menghindarkan pengadukan dan goncangan berlebihan ataupun
pendinginanyangterlalucepat.
Kekuatan melarutkan suatu pelarut, pada umumnya bertambah dengan bertambahnya titik didih.
Umpamanya etanol dapat melarutkan dua kali lebih banyak dari pada metanol. Kadangkadang diperlukan
pasangan/campuranpelarut.Duapelarutyangdapatbercampursatusamalain,dengankemampuanmelarutkanyang
berbeda,adalahpasanganpelarutyangsangatberguna.Dibawahinidiberikanbeberapapasanganpelarutyangsering
digunakan: metanolair, etanolair, asam asetatair, asetonair, eteraseton, etermetanol, eterpetroleum eter,
benzenligroin,metilkloridametanol.
Bilateskelarutandilakukanterhadapsekitar10mgcuplikanyangakandikristalkandidalam2pelarut(Adan
B)menunjukkanbahwazattersebutsegeralarutdalampelarutAdalamsuhukamar,tetapitidaklarutdalampelarutB
dalam keadaan panas, maka pasangan pelarut tersebut dapat digunakan untuk rekristalisasi. Caranya yaitu dengan
melarutkancuplikandalampelarutBpanas,kemudianditambahkantetesdemitetespelarutApadakondisiyangsama
sampai tepat jenuh (ditandai dengan kekeruhan yang bersifat permanen walaupun dipanaskan). Selanjutnya,
tambahkan beberapa tetes pelarut A panas sampai terbentuk larutan jernih, lalu disaring dalam keadaan panas dan
filtratnyadidinginkanuntukpembentukankristal.

E.Titiklelehdancarapenentuannya
Ketika suatu zat padat dipanaskan, maka zat padat akan meleleh, dengan kata lain, pada suhu tertentu zat
padat mulai meleleh dan dengan kenaikan sedikit suhu semua zat padat akan berubah fasa menjadi cair. Suatu zat
padat mempunyai molekulmolekul dalam bentuk kisi yang teratur, dan diikat oleh gayagaya gravitasi dan
elektrostatik. Bila zat tersebut dipanaskan, energi kinetik dari molekulmolekul tersebut akan naik. Hal ini akan
mengakibatkan molekul bergetar, yang akhirnya pada suatu suhu tertentu ikatanikatan molekul tersebut akan
terlepas,makazatpadatakanmeleleh.Titikleleh(sebenarnyatrayektitikleleh)adalahsuhuyangteramatiketikazat
padat mulai meleleh sampai semua partikel berubah menjadi cair. Contoh: gula sukrosa memiliki titik leleh 185
o

186
o
C.Iniberarti,sejumlahkecilsampelsukrosaakanmulaimelelehpada185
o
Cdansemuakristalmenjadicairpada
186
o
C.
Titik leleh senyawa murni adalah suhu dimana fasa padat dan fasa cair senyawa tersebut, berada dalam
kesetimbanganpadatekanan1atm.Kalordiperlukanuntuktransisidaribentukkristal,pemecahankisikristal,sampai
semua berbentuk cair. Proses pelelehan ini dalam kesetimbangan atau reversibel. Untuk melewati proses ini
memerlukanwaktu dan sedikit perubahan suhu.Makinmurni senyawa tersebut, trayek(range) suhu lelehnya makin
sempit, biasanya tidak lebih dari 1 derajat. Adanya zat asing di dalam suatu kisi akan mengganggu struktur kristal
keseluruhannya, dan akan memperlemah ikatanikatan di dalamnya. Akibatnya titik leleh senyawa (tidak murni) ini
akanlebihrendahdarisenyawamurninya,danyangpalingpentingadalahtrayeklelehnyayangmakinlebar.

Zat padat + pel arut panas


penyari ngan
bi asa
Zat t erl arut
(l arut an)
Pengot or
(t idak l arut )
pendi ngi nan
& penyari ngan
dengan di i sap
Pel arut
Krist al
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 12
121
termometer
kapiler
-------------------------------------------------------------------------------
padat cair
daerah TL 120 - 121
o
C
120--------

Gambar1Prosespelelehansampeldalamalatpengukurtitikleleh

Penentuan titik leleh suatu senyawa murni ditentukan dari pengamatan trayek titik lelehnya, dimulai saat
terjadinya pelelehan (sedikit), transisi padatcair, sampai seluruh kristal mencair. Hal ini dilakukan terhadap sedikit
kristal (yang sudah digerus halus) yang diletakkan dalam ujung bawah pipa gelas kapiler, lalu dipanaskan secara
meratadanperlahandisekitarkapilerini.Pengukuransuhuharustepatditempatzattersebutmeleleh.

TitikLelehCampuran:PengaruhZatPengotor
Penentuan titik leleh dapat merupakan cara yang baik untuk mengetahui kemurnian suatu sampel. Suatu
senyawamurnibiasanyamemilikititiklelehyangtajam,yaitutrayektitiklelehnyasempityaitu2
o
ataukurang.Adanya
zatpengotordalamsampelmemiliki2pengaruhterhadappengukurantitikleleh:(a)suhutitiklilihlebihrendah;dan
(b) melebarnya trayek titik leleh (> 3
o
C). Nilai dan trayek titik leleh yang teramati, apabila dibandingkan dengan
senyawa murni, merupakan informasi tentang indikasi kemurnian suatu sampel. Jika suatu sampel mengandung
campuran 2 senyawa atau lebih, setiap komponen dalam campuran akan menurunkan titik leleh komponen lainnya
(mengikuti hukum Raoult untuk campuran ideal), sehingga titik leleh sampel akan lebih rendah dan trayeknya lebih
lebar daripada titik leleh masingmasing komponen. Fenomena ini diilusrasikan dalam diagram komposisi titik leleh
untukcampuranduakomponen(Gambar2).

Gambar2Diagramtitiklelehuntukcampuranduakomponen

Berdasarkandiagramdiatas,senyawaAmemilikititikleleh120
o
C.JikasejumlahkecilsenyawaBtercampurdengan
sampel murnisenyawaA, maka senyawa B bertindak sebagai zatpengotor dalam sampel dan akanmenurunkan titik
leleh menjadi di bawah 120
o
C. Semakin banyak komponen B yang ditambahkan ke dalam sampel, titik lelehnya
semakinmenurun.Kurvatitiklelehakanmencapaisuatutitiklelehminimum(padasuhusekitar100
o
C,lihatGambar2)
untuk campuran biner. Titik leleh minimum untuk sistem ini disebut eutectic point/titik eutektik. Titik eutektik ini
merupakan titik leleh untuk kombinasi spesifik antara senyawa A dan B dalam campuran yang akan melelh secara
bersamaan. Komposisi pada titik eutektik ini tidak selalu terdiri dari campuran 50:50 antara dua komponen, karena
komposisi ini bergantung kepada perilaku pelelehan masingmasing komponen dalam campuran. Ketika konsentrasi
senyawa B semakin banyak dan melewati komposisi eutektik, maka senyawa A sekarang bertindak sebagai zat
pengotor.KetikakonsentrasikomponenAdalamcampuranmenjadinol,sampelhanyamengandungkomponenBdan
akanmelelehdengantajampada130
o
C,yangmerupakantitiklelehsenyawaB.
Pengaruh kedua akibat adanya zat pengotor adalah melebarnya trayek titik leleh. Pada diagram titik leleh
berikut (Gambar 3), kurva dengan garis putusputus menunjukkan suhu pada saat titik leleh pertama kali teramati
untuksuatucampuransenyawaAdanB,sedangkankurvadengangaristebalmenunjukkansuhuketikasemuasampel
telahmelelehdengansempurna.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 13

Gambar3Diagramfasatitiklelehuntukcampuranduakomponen

Berdasarkandiagramtersebut,suatusampelyangmengandung80%molAdan20%molBakanterlihatmulaimelelh
pada109
o
C(T
l
)danakanmelelehsemuanyapada116
o
C(T
h
).Diagraminimenunjukanadanyatrayektitiklelehyang
lebar (T
h
T
l
), yaitu sekitar 7
o
C, sehingga sampel ini dikatakan bukan suatu senyawa murni. Hanya sampel yang
mengandungsenyawamurniA,senyawamurniB,ataucampuranyangmengandungeutektikantarakomponenAdan
Byangakanmemberikantrayektitiklelehyangsempitdantajam.

CaraPenentuanTitikLeleh
Sejumlah kecil kristal ditempatkan dalam kaca arloji. Gerus sebagian sampai sehalus mungin. Ambil tabung
kapiler (kaca) yang ujung satunya tertutup. Balikkan ujung yang terbuka, lalu tekantekan kedalam serbuk kristal
sampaiserbukmasukkedalamtabungkapiler.Balikkanlagitabungdanketukketuksampaiserbukkristalbisaturun
kedasar kapiler. Ulangi pengambilan dengan cara di atas sampai serbuk yang ada di kapiler tingginya sekitar 0,5 cm.
Pasangkapileriniditempatataualatpenentuantitikleleh,alatThieleataumeltingblock.Lihatgambardanpelajari
semua alat dan teknikteknik penentuan titik leleh dengan seksama. Pemanasan harus dilakukan dengan api kecil
(elektrik) agar naiknya suhu kelihatan berjalan secara perlahan. Perhatikan dan catat suhu saat dimana kristal dalam
pipakapilermulaiadayanglelehsampaipersissemuanyameleleh(=trayekpelelehan).
Peralatan untuk menentukan titik leleh, didasarkan kepada besarnya titik leleh atau interval leleh zat padat.
Alat Thiele (Gambar 4) digunakan untuk titik leleh 25180
o
C dengan menggunakan minyak parafin atau oli sebagai
pemanas. Alat ThomasHoover (Gambar 5) untuk titik leleh 25300
o
C menggunakan silikon oli. Alat MelTemp
(Gambar7)untuktitikleleh25400
o
Cmenggunakanmeltingblock.AlatFisherJohns(Gambar6)untuktitikleleh25
300
o
Cmenggunakanheatingblock(elektrik)dankacaobjekuntukmenyimpanzatnya.Yangbanyakdigunakandilab
adalahalatThieledanmeltingblockyangdipanaskandenganbunsenkecil.Perhatikangambarterlampir,danpelajari
caramenggunakannya.

Gambar4AlatThiele Gambar5ThomasHooverApparatus
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 14

Gambar6MeltTempApparatus Gambar7AlatMeltingBlock


Gambar8AlatFisherJohnsApparatus

Sublimasi
Sublimasizatpadatadalahanalogdenganprosesdistilasidimanazatpadatberubahlangsungmenjadigasnya
tanpamelaluifasacair,kemudianterkondensasimenjadipadatan.Jadisublimasitermasukdalamcarapemisahandan
sekaligus pemurnian zat padat. Untuk bisa menyublim, suatu zat padat harus mempunyai tekanan uap relatif tinggi
pada suhu dibawah titik lelehnya. Diperlukan zat padat 1 2 gram. Sublimasi bisa dilakukan lebih efektif lagi bila
dilakukanpadatekananvakuum.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 15
CaraRekristalisasiSampelZatPadat

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 16
C.EKSTRAKSI

Kelarutan senyawa dalam suatu pelarut dinyatakan sebagai jumlah gram zat terlarut dalam 100 mL pelarut
pada 25
o
C. Senyawa akan larut dalam suatu pelarut jika kekuatan atraktif antara kedua molekul (zat terlarut dan
pelarut)adalahsesuaiataudisukai.Yangpolarlarutdalampelarutpolar,dansebaliknya.Jadisifatkepolaransenyawa,
zat terlarut maupun pelarut, merupakan dasar paling penting dalam proses pelarutan. Kepolaran ditentukan oleh
perbedaan keelektronegatifan unsurunsurnya. Senyawa nonpolar terjadi karena perbedaan kelektronegatifannya
kecil atau sama, misalnya CC, CH; sedangkan senyawa polar terdapat perbedaan keelektronegatifan besar seperti
pada CO, CN, CX. Demikian pula diantara molekul yang mengandung OH atau NH akan terjadi ikatan hidrogen
(antarmolekul)sangatmenentukankelarutan.
Ekstraksi adalah metode pemisahan yang melibatkan proses pemindahan satu atau lebih senyawa dari satu
fasa ke fasa lain dan didasarkan kepada prinsip kelarutan. Jika kedua fasa tersebut adalah zat cair yang tidak saling
bercampur, disebut ekstraksi caircair. Dalam sistem ini satu atau lebih senyawa berpartisi di antara kedua pelarut,
yaitu sebagian kecil senyawa akan berada dalam salah satu pelarut, dan sebagian besar lainnya akan berada dalam
pelarut yang kedua. Partisi adalah keadaan kesetimbangan. Keberhasilan pemisahan sangat tergantung pada
perbedaan kelarutan senyawa tersebut dalam kedua pelarut. Secara umum prinsip pemisahannya adalah senyawa
tersebut kurang larut dalam pelarut yang satu dan sangat larut di pelarut lainnya. Air banyak dipakai dalam sistem
ekstraksi caircair senyawa organik, karena banyak senyawa organik yang bersifat ion atau sangat polar yang cukup
larut dalam air. Pelarut lainnya adalah pelarut organik yang tidak bercampur dengan air (yaitu bukan dari golongan
alkohol dan aseton). Dalam sistem ekstraksi ini akan dihasilkan dua fasa yaitu fasa air (aqueous) dan fasa organik.
Selain syarat kelarutan yang harus berbeda jauh perbedaannya di kedua pelarut tersebut, juga syarat lain adalah
pelarut organik harus mempunyai titik didih jauh lebih rendah dari senyawa terektraksi (biasanya dibawah 100
o
C),
tidakmahaldantidakbersifatracun.
Dasarmetodeekstraksicaircairadalahdistribusisenyawadiantaraduafasacairyangberadadalamkeadaan
kesetimbangan. Perbandingan konsentrasi di kedua fasa cair disebut koefisien distribusi, K, yaitu K = Ca/Cb.
Perpidahan senyawa terlarut dari satu fasa ke fasa lain akhirnya mencapai keadaan setimbang (pada suhu tertentu),
maka K bisa ditentukan. Efisiensi proses ekstraksi ini tergantung pada jumlah ekstraksi dilakukan, bukan volume
pelarut.Halinidinyatakandenganperhitungankonsentrasizatterlarut:

C
n
=C
o
[KV
1
/(KV
1
+V
2
)]
n

dimana C
o
adalah konstrensi semula, V
1
volume semula, K koefisien distribusi dan V
2
volume pengekstrak. Dengan
persamaaninikelihatanakanlebihefektifnkaliekstraksidaripadasatukaliekstraksi(buktikan!).Lebihbaikdilakukan
beberapakaliekstraksidaripadasatukalidenganjumlahvolumeyangsama.

Tabel1Beberapapelarutyangbiasadigunakandalamekstraksi

JenisPelarut
Nama&Struktur
TitikDidih,
o
C
Kerapatan
(g/mL)
Sifatdanpenggunaannya
Air,H
2
O 100 1,000 Sangatluas,polar,ionik
Dietileter,C
2
H
5
OC
2
H
5
35 0,714 Sangatluas,mudahterbakar
Heksan,C
6
H
12
61 0,659 Hidrokarbon/nonpolar,terbakar
Benzen,C
6
H
6
80 0,879 Aromatik,mudahterbakar,racun
Toluen,C
6
H
5
CH
3
111 0,867 Sepertibenzen
Pentan,C
5
H
12
36 0,626 Nonpolar,mudahterbakar
Metanol,CH
3
OH 65 Mudahterbakar,racun
Kloroform,CHCl
3
61 1,492 Sangatpolar
Metilenklorida,CH
2
Cl
2
41 1,335 Polar,beracun
Karbontetraklorida,CCl
4
77 1,594 Hidrokarbon,nonpolar,racun

Ekstraksi asambasa, adalah termasuk jenis ekstraksi yang didasarkan pada sifat asam dan basa senyawa
organik, disamping kelarutannya. Senyawa asam atau basa organik direaksikan dengan basa atau asam sehingga
membentuk garamnya. Garam ini tidak larut dalam pelarut organik (non polar) tetapi larut baik dalam air. Ekstraksi
basa, dikembangkan untuk isolasi kopalen asam organikdari campurannya, juga kovalen basa organik (alkaloid) yang
diekstraksidenganasammineraldengancaratitrasi.
Ekstraksi padatcair, adalah juga termasuk cara ekstraksi yang lazim disebut ekstraksi pelarut, dimana zat
yangakandiekstraksi(biasanyazatpadat)terdapatdalamfasapadat.Carainibanyakdigunakandalamisolasisenyawa
organik(padat)daribahanalam.Efesiensiekstraksipadatcairiniditentukanolehbesarnyaukuranpartikelzatpadat
yangmengandungzatorganik,danbanyaknyakontakdenganpelarut.Makadariitudalampraktekisolasibahanalam
harusmenggunakanperalatanekstraksikontinuyangbiasadisebutsoxhlet.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 17
Penyaringan dan corong pisah. Corong pisah adalah alat untuk melakukan ekstraksi caircair, yaitu proses
pengocokansistemduapelarut,agarsupayaprosespartisibisaberjalanlebihcepat.Setelahdibiarkanbeberapalama
sampai kedua pelarut terpisah dengan baik, baru dilakukan pemisahan salah satu pelarut. Identifikasi pelarut bagian
atasdanbawah,ditentukanatasdasarperbedaankerapatannya(g/mL).Kerapatanyangbesaradadibagianbawah.
Proses penyaringan, merupakan bagian penting dalam pemisahan zat padat dari larutan atau zat cair. Dilakukan
denganmenggunakankertassaringyangdipasangdalamcorong.Adaduamacamcarapenyaringanyaitupenyaringan
gaya berat (biasa) dan penyaringan dengan pengisapan (suction). Penyaringan biasa, digunakan untuk
mengumpulkan cairan dari zat padat yang tak larut. Kertas saring yang digunakan adalah jenis lipat (fluted).
Penyaringan cara ini sering dilakukan pada kondisi suhu panas (penyaringan panas), misalnya untuk memisahkan
karbon aktif setelah proses penghilangan warna larutan (decolorizing). Cara penyaringan lain adalah penyaringan
dengan pengisapan (suction), yaitu cara penyaringan yang memerlukan kecepatan dan kuat dan digunakan untuk
memisahkanpadatankristaldaricairannyadalamrekristalisasi.Pengisapandilakukandenganmenggunakanaspirator
air atau pompa vakum dengan desain khusus. Dan corongnya yang digunakan adalah corong Bchner atau corong
Hirsch. Untuk jelasnya, caracara penyaringan dan penggunaan corong pisah, bisa dilihat pada gambar lampiran cara
menyaringdanekstraksi.
Pengeringanekstrak.Ekstraksiyangmelibatkanairsebagaipelarut,umumnyaairakansedikitterlarutdalam
sejumlah pelarut organik seperti kloroform, benzen dan eter. Air ini harus dikeluarkan sebelum dilakukan distilasi
pelarut. Ada dua tahap pengeringan, pertama ekstrak ditambahkan larutan jenuh natrium klorida (garam dapur)
sejumlah volume yang sama. Garam akan menaikkan polaritas air, berarti menurunkan kelarutannya dalam pelarut
organik. Kemudian tambahkan zat pengering garam anorganik anhidrat yang betulbetul kering atau baru. Zat
pengeringiniadalahanhidratdarigaramberairkristal,yangkapasitasnyasebandingdenganjumlahairkristalnya.Yang
umumdigunakanadalahMgSO
4
,Na
2
SO
4
danCaCl
2
.Magnesiumsulfatadalahpengeringpalingefektif(airkristalnya
sampaidengan7H
2
O)akantetapisangatmahal.Kalsiumkloridalebihmurah,akantetapiseringmembentukkomplek
denganbeberapasenyawaorganikyangmengandungoksigen(misalnyaetanol).

SOXHLET
Ekstraktor Kontinu
Cara menggunakan corong pisah
buka
waktu mengeluarkan
cairan
Air
keluar
Air
masuk
sekali-kali dibuka
buka
batas
fasa berat
fasa ringan
ring
diputar
atau
dikocok
waktu dikeluarkan
erlenmeyer
klem bundar
+ karet
batas
penampung
mantel
kertas
berisi
sampel
pelarut
naik larutan
turun
kran
pelarut
turun
kondensor



Cara Ekst raksi
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 18
D.KROMATOGRAFIKOLOMDANKROMATOGRAFILAPISTIPIS(KLT)

Kromatografi adalah suatu metode yang digunakan ilmuwan untuk memisahkan senyawa organik dan
anorganiksehinggasenyawatersebutdapatdianalisisdandipelajari.Denganmenganalisissenyawa,seorangilmuwan
dapatmengetahuiapayangmembangunsenyawatersebut.Kromatografiadalahsuatumetodefisikyangbaiksekali
untuk mengamati dan menyelidiki suatu campuran dan pelarutnya. Kata kromatografi berarti tulisan berwarna,
artinya suatu cara seorang kimiawan dapat menguji campuran zat cair. Ketika mempelajari material zat warna dari
tumbuhan,seorangbotanisRusiamenemukankromatografipadatahun1903.NamanyaadalahM.S.Tswett.
Kromatografi digunakan oleh berbagai orang dan disiplin ilmu di dalam berbagai bidang. Sebagian orang
menggunakankromatografiuntukmengetahuikomponenapasajayangterdapatdalamsuatuzatpadatatauzatcair.
Metode ini digunakan juga untuk mengetahui zatzat yang tak dikenal dalam suatu sampel. Polisi, FBI, dan agen
detektif lainnya menggunakan kromatografi ketika mengusut suatu kasus kriminal. Metode ini digunakan pula untuk
menguji keberadaan kokain dalam urin, alkohol dalam darah, PCB (polychlorinated benzene) dalam ikan, dan
kandungantimbaledalamsistemperairan.
Metode kromatografi adalah cara pemisahan dua atau lebih senyawa atau ion berdasarkan pada perbedaan
migrasi dan distribusi senyawa atau ionion tersebut di dalam dua fasa yang berbeda. Dua fasa ini bisa berwujud
padatcair,caircair,ataugascair.Zatterlarutdidalamsuatufasagerakmengalirpadasuatufasadiam.Zatterlarut
yang memiliki afinitas terhadap fasa gerakyang lebih besar akan tertahan lebih lamapada fasagerak, sedangkan zat
terlarut yang afinitasnya terhadap fasa gerak lebih kecil akan tertahan lebih lama pada fasa diam. Dengan demikian
senyawasenyawadapatdipisahkankomponendemikomponenakibatperbedaanmigrasididalamfasagerakdanfasa
diam.
Dalam semua metode kromatografi terdapat fasa gerak dan fasa diam. Fasa diam adalah fasa yang tidak
bergerak, sedangkan fasa gerak adalah fasa yang bergerak melalui fasa diam dan membawa komponenkomponen
senyawa yang akan dipisahkan. Pada posisi yang berbedabeda, senyawasenyawa yang berbeda akan tertahan dan
terabsorbsipadafasadiam,dankemudiansatudemisatusenyawasenyawainiakanterbawakembaliolehfasagerak
yang melaluinya. Dalam kromatografi kertas dan kromattografi lapis tipis, fasagerak adalah pelarut. Fasa diampada
kromatografi kertas adalah kertas yang menyerap pelarut polar, sedangkan fasa diam pada kromatografi lapis tipis
adalah pelat yang dilapisi adsorben tertentu. Kedua jenis kromatografi ini menggunakan aksi kapilaritas untuk
menggerakkanpelarutmelaluifasadiam.
Terdapat empat jenis utama kromatografia: kromatografi Cair, Kromatogrfi Gas, kromatografi lapis Tipis dan
kromatografi kertas. Keempat jenis kromatografi ini beserta aplikasinya dapat dilihat pada Tabel 1. Keakuratan hasil
pemisahandenganmetodekromatografibergantungpadabeberapafaktorberikut:
1. Pemilihanadsorbensebagaifasadiam
2. Kepolaranpelarutataupemilihanpelarutyangsesuaisebagaifasagerak
3. Ukurankolom(panjangdandiameter)relatifterhadapjumlahmaterialyangakandipisahkan.
4. Lajuelusiataualiranfasagerak.
Dengan pemilihan kondisi yang sesuai, hampir semua komponen dalam campuran dapat dipisahkan. Dua
pemilihanmendasaruntukpemisahansecarakromatografiadalahpemilihanjenisadsorbendansistempelarut.Pada
umumnya, senyawa non polar melewati kolom lebih cepat daripada senyawa polar, karena senyawa non polar
memilikiafinitaslebihkecilterhadapadsorben.Jikaadsorbenyangdipilihmengikatsemuamolekulyangterlarut(baik
polarmaupunnonpolar)dengankuat,makasenyawasenyawatersebuttidakakanbergerakturunkeluardarikolom.
Sebaliknya, jika pelarut yang dipilih terlalu polar, semua zat terlarut (polar maupun non polar) akan dengan mudah
tercuci keluar kolom, tanpa adanya pemisahan. Adsorben dan pelarut sebaiknya dipilih sedemikian rupa sehingga
kompetisimolekulmolekulterlarutdiantarakeduafasaterjadidalamkesetimbangan.Koefisienpartisi,k,yangmirip
dengankoefisiendistribusiuntukekstraksi,merupakantetapankesetimbanganuntukdistribusimolekulmolekukatau
ionterlarutdiantarafasagerakdanfasadiam.Kesetimbanganinilahyangdapatmemisahkankomponenkomponen
dalamcampurannya.

FasaDiam
Silika gel, fasa diam yang paling umum digunakan sebagai fasa diam, memiliki rumus empiris SiO
2
. Tetapi,
padapermukaanpartikelsilikagel,terdapatatomatomoksigenyangterikatpadaproton.Adanyagugushidroksilini
mengakibatkanpermukaansilikagelsangatpolar,sehinggaanalitorganikyangmemilikigugusfungsipolarakanterikat
dengan kuat pada permukaan partikel silika gel dan senyawa yang non polar hanya berinteraksi lemah dengan silika
gel. Molekul yang memiliki gugus fungsi polar dapat terikat pada silika gel dalam dua cara: melalui ikatan hidrogen
danmelaluiinteraksidipoldipol.PadaGambar1diperlihatkanmodelinteraksianalitsenyawaoraganikdengansilika
gel.Fasadiamlainyangjugabiasadigunakanuntukkromatografikolomdanlapistipisadalahalumina,yangmemiliki
rumusempirisAl
2
O
3
.ModelinteraksisenyawaorganikdenganaluminadapatdilihatpadaGambar2.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 19
Tabel1Berbagaijeniskromatografidanaplikasinya

JenisKromatografi AplikasidalamDuniaNyata ApadanMengapa


KromatografiCair
Menganalisissampelairuntuk
mengetahuiadanyapolutandalam
ekosistemperairan
Digunakanuntukmenganalisision
logamdansenyawaoraganikdalam
larutan.Metodeinimenggunakanzat
cairyangakanmengikatmolekul
hidrofilikyangtaklarut.
KromatografiGas
Mendeteksibomdanjugadigunakan
dalambidangforensik.Metodeini
digunakanpulauntukmenganalisis
seratpadasuatubagiantubuh
seseorangdanjugamenganalisis
darahyangditemukanditempat
kejadianperkarakriminal.
Digunakanuntukmenganalisisgasas
volatile(mudahmenguap),seperti
minyakatsiri.Gasheliumdigunakan
untukmenggerakkancampurangas
agardapatmelaluikolomyangberisi
materialadsorbensebagaifasadiam.
KromatografiLapis
Tipis
Metodeinidigunakanpulauntuk
mendeteksiresidupestisidaatau
insektisidadidalammakanan.
Kromatografilapistipisdigunakan
puladalambidangforensikuntuk
menganalisiskomposisizatpewarna
padaseratkain.
Menggunakansuatumaterialadsorben
padapelatkaca,plastikatau
alumuniumtipis.Metodeini
merupakancarayangsederhanadan
cepatuntukmengujikemurniansuatu
senyawaorganik..
KromatografiKertas
Memisahkanasamaminodananion,
sidikjariRNA,pemisahandan
pengujianhistamin,antibiotik.
Salahsatujeniskromatografiyang
palingumumdigunakan.Metodeini
menggunakanpotongankertassebagai
fasadiam.Aksikapilaritaspadaserat
kertasdigunakanuntukmenarik
pelarutnaikmelauikertasdan
kemudianmemisahkanzatterlarut
padasuatusampel.

Gambar1ModelinteraksiAnalitsenyawaOrganikdenganSilikaGel

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 20

Gambar2Modelinteraksisenyawaorganikdenganalumina

FasaGerak
Pada kromatografi yang menggunakan silika gel sebagai fasa diam, fasa gerak yang digunakan adalah suatu
pelarutorganikataucampuranbeberapapelarutorganik.Ketikafasagerakmelaluipermukaansilikagel,fasagerakini
membawa analit organikkmelalui partikelpartikel pada fasa diam. Tetapi, molekul analit hanya bebas bergerak oleh
adanyapelarutapabilamolekultersebuttidakterikatpadapermukaansilikagel.Kemampuansuatuanalitterikatpada
permukaan silika gel dengan adanya pelarut tertentu dapat dilihat sebagai penngabungan 2 interaksi yang saling
berkompetisi. Pertama, gugus polar dalam pelarut dapat berkompetisi dengan analit untuk terikat pada permukaan
silikagel.Dengandemikia,jikapelarutyangsangatpolardigunakan,pelarutakanberinteraksikuatdenganpermukaan
silikageldanhanyamenyisakansedikittempatbagianalituntukterikatpadasilikagel.Akibatnya,analitakanbergerak
cepatmelewatifasadiamdankeluardarikolomtanpapemisahan.Dengancarayangsama,guguspolarpadapelarut
dapat berinteraksi kuat dengan gugus polar dalam analit dan mencegah interaksi analit pada permukaan silika gel.
Pengaruh ini juga menyebabkan analit dengan cepat meninggalkan fasa diam. Kepolaran suatu pelarut yang dapat
digunakan untuk kromatografi dapat dievaluasi dengan memperhatikan tetapan dielektrik () dan momen dipol ()
pelarut. Semakin besar kedua tetapan tersebut, semakin polar pelarut tesebut. Sebagai tambahan, kemampuan
berikatanhidrogenpelarutdenganfasadiamharusdipertimbangkan.
Semua jenis kromatografi melibatkan proses kesetimbangan molekulmolekul yang dinamis dan cepat
diantara2fasa(diamdangerak).Kesetimbangandiantarakeduafasatersebutbergantungpada3faktor:
Kepolarandanukuranmolekulyangakandipisahkan
Kepolaranfasadiam
Kepolaranfasagerak
Kepolaranmolekulditentukanolehstrukturnya.Denganpemilihanfasagerakdanfasadiam,seseorangdapat
mengubah kesetimbangan di antara kedua fasa, dimana molekulmolekul yang akan dipisahkan berada dalam
kesetimbangandistribusidiantarakeduafasaini(Gambar3).PadaGambar4,molekulAterabsorbsilemahpadafasa
diam, maka kesetimbangannya pada arah konsentrasi yang lebih tinggi di dalam fasa gerak. Molekul B, sebaliknya,
terabsorbsikuatpadafasadiam,sehinggakonsentrasinyalebihtinggipadafasadiam.

Gambar3CampuransenyawaAdanByangberadadalamkesetimbanganpadafasagerakdanterabsorbsipada
fasadiam

Gambar4KesetimbangandinamisantarasenyawaAdanBdiantarafasagerakdanfasadiam
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 21
Proses pemisahan dapat dilihat pada Gambar 5. Pada proses ini, molekul A yang terabsorbsi lebih lemah pada fasa
diamakanbergerakkeluarlebihduluterbawaolehpelarut(fasagerak).

Gambar5CampuranAdanBdipisahkanolehpergerakanfasagerakketikasebagianmolekulterabsorbsipadafasa
diam
Pada Gambar 6 dapat dilihat struktur silika gel dan beberapa struktur fasa diam yang juga biasa digunakan dalam
kromatografi cair. Pada Gambar 7 dapat dilihat daftar beberapa fasa diam yang digunakan dalam kromatografi
berdasarkanurutankepolarannya.


Gambar6Struktursilikagel(SiO
2
)(kiri);polimerpolimetilsiloksan,polimercarbowaxdanfasadiamterbalikC18
(fasadiamyangnonpolar)

Polydimethylsiloxane*
Methyl/Phenylsiloxane*
Cyanopropylsiloxane*
Carbowax(polietilenglikol)*
ReversePhase(hydrocarboncoatedsilica,C18)
Kertas
Selulosa
Pati
Kalsiumsulfat
Silika(silikagel)
Florisil(magnesiumsilikat)
Magnesiumoksida
Alumina(aluminiumoksida;asam,basaataunetral)
Karbonteraktifkan(charcoal;Norit)
*fasadiamuntukGC(GasChromatography)
K
E
P
O
L
A
R
A
N

B
E
R
T
A
M
B
A
H

Gambar7Beberapajenisfasadiamuntukkromatografiberdasarkanurutankepolaran

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 22
Berdasarkan gambar di atas kita dapat memilih fasa diam yang sesuai dengan pemisahan yang diinginkan.
Semakin polar senyawa yang akan dipisahkan, maka jika digunakan fasa diam yang polar seperti silika gel, senyawa
tersebut akan terikat kuat pada fasa diam dan akan terpisah pada urutan terakhir. Pada Gambar 8 terdapat daftar
urutangolongangugusfungsisenyawayangakankeluarlebihduludarifasadiamsilikageldanaluminayangpolar.
Yangterelusipalingcepatolehfasageraknonpolar
HidrokarbonAlkana
Alkilhalida
Alkena(olefin)
Diena
HidrokarbonAromatik
Aromatikhalida
Eter
Ester
Keton
Aldehid
Amina
Alkohol
Fenol
AsamKarboksilat
AsamSulfonat
Yangterelusipalinglambat(perlufasagerakpolaruntukmengelusinya)
M
e
n
i
n
g
k
a
t
n
y
a

K
e
p
o
l
a
r
a
n

G
u
g
u
s

F
u
n
g
s
i

Gambar8Urutanelusi(terbawakeluarolehfasagerak)senyawaorganikdarifasadiamsilikaataualuminapada
KLT(KromatografilapisTipis)maupunkromatografikolom

Karakter elektropositif yang dimiliki alumiunium atau silikon dan karakter elektronegatif oksigen
menyebabkanaluminadansilikamerupakanfasadiamyangsangatpolar.Olehkarenaitu,semakinpolarmolekulyang
akan dipisahkan, semakin kuat interaksinya dengan fasa diam, akibatnya molekul tersebut akan tertahan lebih lama
dalam fasa diam. Sebaliknya, molekul non polar yang afinitasnya lebih kecil terhadap fasa diam akan cenderung
beradadalamfasageraklebihlamadanakanterelusilebihdahulu.PadaGambar9terdapatdaftarurutankepolaran
pelarutyangbiasadigunakandalamkromatografi.Sepertitelahdikemukakansebelumnyabahwakepolaranfasagerak
dapat mempengaruhi proses pemisahan, sehingga informasi pada Gambar 9 cukup membantu pemilihan fasa gerak
yangsesuaiuntukpemisahanyangdiinginkan.
Helium
Nitrogen
PetroleumEter(pentana)
Ligroin(heksana)
Sikloheksana
Karbontetraklorida*
Toluena
Kloroform*
Diklorometana(metilenklorida)
tButilmetileter
Dietileter
Etilasetat
Aseton
2Propanol
Piridin
Etanol
Metanol
Air
Asamasetat
*(didugabersifatkarsinogen)
M
e
n
i
n
g
k
a
t
n
y
a

K
e
p
o
l
a
r
a
n

d
a
n

"
K
e
k
u
a
t
a
n

P
e
l
a
r
u
t
"

t
e
r
h
a
d
a
p

G
u
g
u
s

F
u
n
g
s
i

P
o
l
a
r

Gambar9Daftarurutankepolaranfasagerakuntukkromatografi

Secaraumum,jikapadakromatografidigunakanfasadiamyangpolar,pertamakalipilihlahpelarutyangnon
polar sebagai fasa gerak untuk mengelusi komponen dalam campuran. Selanjutnya, lakukan proses elusi dengan
penggantian fasa gerak dengan pelarut yang semakin lebih polar, sampai akhirnya semua komponen terpisah dan
keluardarifasadiam.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 23
D.1CaraPenyiapanKromatografiKolomSkalaMakro


Gambar10.Penyiapankolom(kiri);Prosespemisahansampel(kanan)

D.2CaraPenyiapanKromatografiKolomBerskalaMikro
D.2.1KolomBerskalaMikrodenganPipetTetes
Dalam kromatografi kolom berskala mikro, tidak dibutuhkan kolom yang berkeran. Sebagai gantinya,
digunakanpipettetesyangberujunglancip,dankeluarnyapelarutdiaturmenggunakanpropkaretpipet.

(1)Penyiapankolom.

Ujungpipetdiisidengansedikitkapas.Gunakanbatanglidi
untuk mendorong dan menekan kapas untuk tetap dalam
posisinyadidalampipet.
Masukkan adsorben silika gel, 230400 mesh. Salah satu
caraialahdenganmencelupkanujungbagianataspipetke
dalamwadahberisisilikagel.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 24

Kemudianposisikanpipetdenganujungpipetdibawah. Caralainadalahmengisinyalangsungmenggunakangelas
kimia10mL,sedangkanpipetnyadiklempadastatif.

Caraapapunyangdipilihuntukmengisikolom,lakukanlah
selalu untuk mengetukkan pipet di atas meja untuk
memadatkan silika gel dan agar udara keluar dari dalam
pipet.
Setelah terisi baik, biarkan ruang sekitar 4 5 cm di atas
permukaansilika.Klempipetpadastatif.

(2)PreelusiKolom.
Prosedur ini umum untuk mengembangkan adsorben agar siap untuk untuk mengabsorbsi pelarut beserta
sampel yang akan dipisahkan. Pelarut non polar seperti heksan merupakan pilihan yang umum dipilih untuk
melakukanpreelusi.

Tambahkan pelarut heksan (atau pelarut khusus


lainnya),biarkanturunmelewatisilika.
Monitorlajuturunnyapelarutmelewatikolomsecaragravitasi.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 25

Percepat proses turunnya pelarut menggunakan prop


karet pipet. Tempatkan prop karet pada bagian atas
pipet,lalutekansampaipelarutturunmelaluisilikagel.
Untuk menambah pelarut, lepaskan prop karet dari
pipet dalam keadaan masih kempes (tertekan) lalu isi
kembalipipetdenganpelarut.
Ketika pelarut telah mencapai bagian dasar pipet, proses pre
elusitelahselesaidankolomsiapuntukdiisisampel.

Jika Anda belum siap mengisi sampel ke dalam kolom, kolom


boleh dibiarkan pada posisi ini, tapi jangan biarkan kolom
kering! Selalu ingat untuk menambahkan pelarut seperlunya
agarkolomtidakkering.

(3)Pengisiansampelkedalamkolom.
Terdapatduametodeberbedauntukmengisikansampelkedalamkolom:metodebasahdanmetodekering.
Dalammetodebasah,sampelyangakandimurnikan(dipisahkan)dilarutkandalamsedikitpelarut.Larutaninilangsung
dimasukkankedalamkolom.

MetodePengisianbasah
Kolom pada gambar diisi oleh larutan berisi sampel.
Biarkan sampel perlahan melarut ke dalam silika,
kemudian isilah kolom dengan pelarut dan proses
pemisahansiapdimulai.

Terkadangpelarutyangdipilihuntukmengisikansampelkedalamkolomlebihpolardaripadapelarutyangdigunakan
sebagai fasa gerak. Untuk kasus seperti ini, ketika Anda menggunakan metode basah, gunakan pelarut sesedikit
mungkin, karena apabila terlalu banyak akan mempengaru proses pemisahan campurn. Untuk menghindari hal
tersebut,metodekeringlebihbaikdilakukanuntukmenggantikanmetodebasah.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 26


Metodekering
Pertama kali, larutkan sampel yang akan dianalisis di dalam jumlah
pelarut seminimum mungkin, kemudian tambahkan sekitar 100 mg
silika gel. Aduk campuran sampai pelarutnya menguap dan
tertinggal serbuk yang mengandung sampel. Tempatkan serbuk
pada kertas, lalu masukkan serbuk ke dalam kolom yang telah
disiapkan. Tambahkan pelarut perlahan, dan proses kromatografi
siapdimulai.


(4)Mengelusikolom.
Laju pelarut dipercepat dengan mendorong pelarut menggunakan prop karet. Jangan biarkan silika kering!!
Selalutambahkanpelarutsetiapsaat.

Gambar di samping menunjukkan pelarut didorong turun oleh


prop karer. Serangkaian gambar di bawah menunjukkan
senyawaberwarnabergerakturunmelaluikolomdankemudian
ditampung.Ketikafraksiberbedawarnakeluar,gantilahwadah
penampungdenganwadahlain.Selaluberilabelwadahtempat
hasilpemisahanuntukanalisisberikutnya.

(5)Mengelusikolomdenganpelarutkeduadanseterusnya.
Jika Anda memisahkan dua atau lebih komponen, Anda perlu mengganti pelarut dengan pelarut yang lebih
polardaripadapelarutpertama.Proseselusidilanjutkansepertitahap(4)diatas.

(6)Analisisfraksieluat
Jika fraksi yang keluar dari kolom berwarna, Gabungkanlah fraksifraksi yang berwarna. Jika fraksifraksinya
tak berwarna, biasanya lakukan analisis dengan KLT, sehingga fraksi yang mengandung noda sama kemudian
digabungkan.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 27
D.2.2KolomBerskalaMikrodenganSyringesuntikplastik
Berikutadalahcarapenyiapankolomberskalamikromenggunakansyringesuntikplastik.
a. Penyanggakolomdarikarton/dusbekasyang
dilubangisecukupnya:

b. Pemasangansyringe 10ccpadapenyangga:

c. Pemasukansilikagelpadasyringe:

d. Penempatanvialdibawahsyringe:

e. Penambahaneluenpadasilika:

f. Pemadatankolomsilikaoleheluenmenggunakan
dorongandaripendorongsyringe:

g. Posisieluenpadakolomsebelumdimasukkan
sampel:

h. Prosespemasukansampelkedalamkolom:

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 28

i. Prosespemisahan:



Gambar11Contohhasilkromatografikolomsampel

D.3CaraPenyiapanKromatografiLapisTipis

(1)PenotolansampelpadapelatKLT
Tandai pelat mengunakan pensil dan penggaris untuk posisi tempat sampel ditotolkan, sekitar 1 cm dari
bagian bawah pelat. Gunakanlah selalu pensil untuk memberi label sampel. Kemudian totolkan sampel di atas pelat
menggunakanpipakapilersampainodacukuptebaltetapitidakmelebar.

Gambar12Pelatsiapditotolisampel(kiri)dancaramenotolsampel(kanan)

(2)ProsesElusipelatKLT
Setelah noda pada pelat kering, masukkan pelat ke dalam wadah bertutup yang telah berisi pelarut yang
sesuai. Sebelumnya pelarut dalam wadah dijenuhkan terlebih dahulu dengan menempatkan kertas saring di dalam
wadahdanwadahharustertutup.Kemudianbiarkanpelarutmenaikipelatdidalamwadahperlahansampaimencapai
sekitar0,5cmdaribagianataspelat.Selanjutnyakeluarkanpelatdanbiarkanpelarutmengeringdiudara.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 29

Gambar13PelatKLTsiapdielusididalamwadahbertutupberisipelarutyangdijenuhkan

(3)PenampakanNoda
Beberapa senyawa organik berwarna. Jika Anda beruntung memisahkan sampel yang berwarna, maka
penampakan noda dengan mudah terlihat. Namun sebagian besar senyawa organk tak berwarna, oleh karena itu
untuk penampakan noda diperlukan alat Bantu. Biasanya pelat KLT menggunakan bahan indicator fluoresens yang
dapat memancarkan warna biru keunguan di bawah lampu UV pada panjang gelombang 254 nm. Senyawa yang
menyerapsinarUVpadapanjanggelombangtersebutakanmemberikanpenampakannodadibawahlampuUV.Cara
lain untuk penampakan noda adalah memasukkan pelat KLT ke dalam wadah berisi iod padat yang akan menyublim
dan mengabsorbsi molekul organik pada fasa gas, sehingga akan terbentuk noda kecoklatan. Selain itu terdapat
beberapalarutanpenampaknodalainsepertiseriumsulfat,danfosfomolibdat.

Gambar14PenampakannodadibawahsinarUV.

(4)penentuannilaiRf
Selainberfungsisebagaianalisiskualitatif,KLTmenyediakangambarankuantitatifkromatografikyangdisebut
nilaiRf.NilaiRfadalahretardationfactorataunilairatiotofrontyangdiekspresikansebagaifraksidesimal.
f
Jarakyangditempuhsampel Jaraknodadaribatasbawah
R = =
Jarakyangditempuhpelarut Jaraktempuhpelarutdaribatasbawah

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 30

Gambar15CarapenentuannilaiRf

Pustaka
http://ochem.jsd.claremont.edu/lab.htm#,TheVirtualLabTutor,OrganicChemistry,diunduhpadaAgustus2006
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.61100;111114;129149
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.5;4381;387406
Williamson (1999), Macroscale and Microscale Organic Experiments, 3
rd
edition, Boston, p. 39 65; 82 155; 160
166;704706

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 31
Percobaan1PEMISAHANDANPEMURNIANZATCAIR:Distilasi&Titik
Didih

SasaranPercobaan
Pada akhir pecobaan mahasiswa diharapkan memahami: 1) prinsip distilasi dan 2) pengertian campuran
azeotrop. Selain itu, mahasiswa juga diharapkan terampil dalam: 1) mengkalibrasi termometer, 2) merangkai
peralatandistilasidan3)melakukandistilasiuntukpemisahandanpemurnian.

I.Pendahuluan
Distilasi merupakan metode yang sangat baik untuk memurnikan zat cair. Pada percobaan ini Anda akan
melakukan pemisahan campuran zat cair dengan cara distilasi biasa, distilasi bertingkat dan distilasi azeotrop. Teori
danprinsipdasarsilakandipelajaripadababPrinsipdanTeknikPemisahandanPemurnian,subbabDistilasi

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan

III.Carakerja

A.KalibrasiTermometer.
Isi gelas kimia 400 mL dengan bongkahan kecil es hingga kedalaman 10 cm. Tambahkan sedikit air dingin
sampai sebagian bongkahan mengambang di permukaan air. Celupkan termometer ke dalam air es ini hingga
kedalaman7atau8cm.Adukairespelanpelandengantermometerdanamatipenurunansuhuyangteramatipada
skala termometer. Ketika suhunya sudah tidak turun lagi, dan stabil selama 10 15 detik, catat skala termometer
tanpamengangkattermometerdaridalamaires.Jikapembacaanskalaberadadalamtrayek1
o
Cdibawah/diatas0
o
C, maka termometer tersebut layak pakai. Jika pembacaan melebihi trayek tersebut, tukarkan termometer Anda
denganyangbaru,lalukalibrasilagi.Keringkantermometerdengankertastissue.
B.Distilasibiasa
Pasang peralatan distilasi sederhana (lihat Gambar 6 pada sub bab Distilasi). Masukkan 40 mL campuran
asetonair (1:1) ke dalam labu (jumlah maksimum setengah volume labu). Masukkan batang pengaduk magnet ke
dalam labu (catatan: jika tak ada batang pengaduk magnet, masukkanlah beberapa potong batu didih ke dalam
labu). Mulai lakukan pemanasan dengan pemanas listrik sambil dilakukan pengadukan secara magnetik hingga
mendidih.Aturpemanasanagarsupayadistilatmenetessecarateraturdengankecepatansatutetesperdetik.Amati
dan catat suhu dimana tetesan pertama muai jatuh. Penampung diganti dengan yang bersih, kering dan berlabel
untukmenampungdistilatmurni,yaitudistilatyangsuhunyasudahmendekatisuhudidihsebenarnyasampaisuhunya
konstan. Catatlah suhu dan volume distilat secara teratur setiap selang jumlah penampungan distilat tertentu,
misalnyasetiap5mLpenampungandistilat,sampaisisayangdidistilasitinggalsedikit(jangansampaikering).
C.Distilasibertingkat
Pasangperalatandistilasibertingkat(lihatGambar7).Masukkan40mLcampuranasetonair(1:1)kedalam
labu(jumlahmaksimumsetengahvolumelabu).Masukkanbatangpengadukmagnetkedalamlabu(catatan:jikatak
ada batang pengaduk magnet, masukkanlah beberapa potong batu didih ke dalam labu). Lakukan proses distilasi
sampaisepertiprosespengerjaandistilasisederhana.

D.Distilasiazeotropterner
Masukkan kirakira 25 mL metanolair (1:1) ke dalam labu bundar 100mL dan tambahkan benzen sebanyak
setengah dari volume tersebut. Pasang peralatan untuk distilasi bertingkat, lalu lakukan distilasi secara teratur,
denganmencatatsuhudanvolumedistilat.Gantipenampungsetiapsaatandamengirasudahmencapaititikdidihzat
PERHATIAN:
o Dalam setiap pengerjaan distilasi, labu tidak boleh terisi oleh campuran senyawa yang akan
dipisahkanlebihdariisilabu!!!!
o JangansampaiAndamelakukandistilasisampaikering!!
o Akan selalu ada kemungkinan terdapat zat cair tertentu yang bersifat eksplosif dan mudah
terbakar,jadi,berhatihatilah,janganbiarkanadaapiterbukadisekitarzatzattersebut!
o Bekerjalahdenganhatihatidantidakbermainmain!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 32
murni.dan hentikandistilasi apabila sisacampuran dalam labu tinggal 3 4 mL lagi. Jangan sampaikering! Catatan:
jika distilat yang Anda tampung membentuk dua fasa, pisahkan fasa atas dari fasa bawah dengan cara memipet
keluarsecaraperlahanfasabagianatasdantampungdiwadahyangbersihdankering.Ukurvolumemasingmasing
fasasetelahterpisah.

TUGAS: Lakukan pengukuran indeks bias untuk semua senyawa murni dan semua hasil distilasi. Bandingkan!
Bandingkanpuladengandataindeksbiasmasingmasingsenyawamurnidariliteratur!

Tugaspostlab:buatlahkurvadistilasi(lihatGambar5padasubbabDistilasi)hasiltiappercobaandiatas.Diskusikan
hasilnya.Manayangmemberikanhasilpemisahanlebihbaik?

IV.TugasPendahuluan(PreLab)
1. Suatucampuran10mLisoamilasetat(MW=130,2g/moldankerapatan=0,88g/mL)dan15mLmetilbenzoat
(MW=136,2g/moldankerapatan=1,09g/mL)didistilasi.Hitunglah%moltiapkomponen.Gunakan%molini
besertagambardibawahuntukmenjawabpertanyaanberikut:
a. Berapatitikdidihawalcampurantersebut?Jelaskan!
b. Berapakomposisifasauapketikadalamkesetimbangandenganfasacair?

2. Caridangambarkanrangkaianalatdistilasiuapdanvakum.Jelaskanpulaprinsipdantujuankeduametode
distilasitersebut!
3. Cari minimal 4 contoh campuran yang bisa membentuk sistem azeotrop biner beserta komposisi dan titik
didihazeotropnya.Jelaskanbagaimanasistemazeotropinibisadipisahkan!

Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.6167;129140
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.4755;396398
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.82121
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 33
Percobaan2PEMISAHAN&PEMURNIANZATPADAT:Rekristalisasi&
TitikLeleh

SasaranPercobaan
Pada akhir percobaan ini mahasiswa diharapkan dapat menjelaskan konsep dan tujuan kristalisasi dan
terampil dalam: 1) melakukan rekristalisasi dengan baik; 2) memilih pelarut yang sesuai untuk rekristalisasi; 3)
menjernihkan dan menghilangkan warna larutan; dan 4) memisahkan dan memurnikan campuran dengan
rekristalisasi.

I.Pendahuluan
Prinsippemisahaanataupemurnianzatpadatdenganteknikrekristalisasididasarkanpadaadanyaperbedaan
kelarutanzatzatpadatdalampelaruttertentu,baikdalampelarutmurniataudalampelarutcampuran;sertabahwa
suatu zat padat akan lebih larut dalam pelarut panas dibandingkan dengan pelarut dingin. Prinsip dan teknik dasar
lebih detail dapat dipelajari pada bab Prinsip dan Teknik Pemisahan dan Pemurnian, sub bab Reksristalisasi &
Sublimasi.

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
A.KalibrasiTermometer
Mengkalibrasi titik skala 100 termometer dilakukan sebagai berikut: isikan ke dalam tabung reaksi besar 10
mL aquades, masukkan sedikit batu didih atau batang magnet untuk pengadukan magnetik. Klem tabung tersebut
tegak lurus, panaskan perlahan sampai mendidih. Posisikan termometer pada uap di atas permukaan air yang
mendidihtersebut.Untukmenentukantitikdidihyangsebenarnyadariair,harusdiperiksatekananbarometer.

B.KristalisasiAsamBenzoatdalamair
Siapkan pelarut (air) panas. Timbang 1,5 g asam benzoat kotor, masukkan dalam gelas kimia 100 mL yang
dilengkapi batang pengaduk magnet, lalu masukkan sedikit demi sedikit sambil diaduk pelarut (air) dalam keadaan
panas sampai semua asam benzoat tepat larut. Setelah semua senyawa larut, tambahkan sedikit berlebih beberapa
mLpelarutpanas.Didihkancampuraninidiataspemanaslistrik.Kedalamcampuranpanastambahkansedikitdemi
sedikit, hatihati, sambil diaduk dengan kaca pengaduk, sekitar 0,25 g karbon (charcoal) atau norit untuk
menghilangkanwarna.Didihkanbeberapasaatsupayapenyerapanwarnalebihsempurna.Siapkancorongpenyaring
kacatangkaipendek,lengkapidengankertassaringlipat(lihatgambardanpelajaricaramembuatnya!).Tempatkan
labu Erlenmeyer bersih untuk menampung filtrat panas di atas pemanas listrik bersebelahan dengan gelas berisi
larutan asam benzoat. Pasang corong yang telah dilengkapi kertas saring pada labu Erlenmeyer tersebut. Dalam
keadaanpanas,tuangkanlarutanasambenzoatekelabuErlenmeyermelaluicorongsecepatmungkin(jangansampai
dingin, ?). Jika larutan menjadi dingin dan mengkristal, ulangi pemanasan, dan ulangi penyaringan, sampai semua
larutan tersaring. Bilas sisa larutan asam benzoat dalam gelas kimia dengan sesedikit mungkin air panas, tuangkan
bilasannya ke dalam labu Erlenmeyer penampung filtrate melalui corong. Jika semua sudah tersaring sempurna,
angkatlabuErlenmeyerdaripemanaslistrik,biarkanfiltratdingindenganpenurunansuhusecaraperlahan(diudara
terbuka)danjangandigangguataudiguncang.Jikasudahlamabelumterbentukkristal,bisadidinginkanErlenmeyer
disiramdibawahcurahanairkranataudirendamdalamaires.Biladidalamairesbelumjugaterbentukkristalberarti
larutannya kurang jenuh, maka jenuhkan dengan cara penguapan sebagian pelarutnya. Pembentukan kristal dapat
dibantu dengan cara menggoresgores bagian dalam labu Erlenmeyer berisi filtrate dengan batang kaca pengaduk
hingga terbentuk kristal. Jika semua kristal sudah terbentuk dan terpisah, lakukan penyaringan kristal dengan
menggunakan corong Bchner yang dilengkapi dengan peralatan isap (suction). Lihat gambar dan pelajari cara
menggunakanpenyaringanBchnerdengansuction.Ingat,kertassaringyangdigunakanharustepatseukurancorong
Bchner,tepatmenutuplubang(?).CucikristaldalamcorongBchnerdengansedikitpelarutdingin,satusampaidua
kali. Tekan kristal dengan spatula, sekering mungkin. Tebarkan kristal diatas kertas saring lebar (kering), tekan
sekering mungkin. Timbang kristal kering dan tentukan titik leleh dengan menggunakan cara kapiler (gunakan alat
pengukur titik leleh yang ada di laboratorium. Minta bantuan asisten untuk mengajarkan Anda cara mengukur titik
leleh). Hitung perolehan kembali asam benzoat murni. Jika trayek leleh masih lebar (lebih dari 1 atau 2 derajat),
ulangirekristalisasi.

C.Sublimasi
Tempatkandalamcawanporselensekitar1gserbukkamperkotor.Letakkancawandiataspemanaslistrik,
kemudian tutup cawan dengan kaca arloji yang di atasnya diletakkan bongkahan es sebagai pendingin. Lakukan
pemanasansecaraperlahanhinggasemuapadatankampermenyublim.Kumpulkankristalyangmenempelpadakaca
arloji, dengan cara sebelumnya cairan es di atas arloji dihilangkan dulu menggunakan pipet tetes. Timbang dan
tentukantitiklelehnyadanbandingkandengantitiklelehkampersemula.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 34
IV.TugasPendahuluan(PreLab)

1. Sifatsifatapakahyangharusdipunyaiolehsuatupelarutagardapatdigunakanuntukrekristalisasisuatusenyawa
organiktertentu?
2. Sebutkanminimallimatahapyangharusdilakukandalampengerjaanrekristalisasi.
3. Jelaskanprinsipdasarrekristalisasi.
4. Carilah 5 pasangan pelarut yang biasa digunakan untuk rekristalisasi dalam 2 pelarut (pasangan pelarut), lalu
tuliskanpuladatafisikdansifatsifatpelaruttersebutdalamsuatutabel!

Pustaka

Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,,p.8591;111114
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.4346;5;387395
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.122126;3965
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 35
Percobaan3PEMISAHANSENYAWAORGANIK:Ekstraksi

SasaranPercobaan
Pada akhir percobaan diharapkan mahasiswa dapat memahami konsep dan jenis ekstraksi, yaitu ekstraksi
padatcair,caircairdanasambasa,sertaterampildalammelakukantekniktekniktersebut.Selainitujuga,mahasiswa
diharapkanmemahamitujuanpenggaramandanpengeringanlarutan.

I.Pendahuluan
Ekstraksi adalah metode pemisahan yang melibatkan proses pemindahan satu atau lebih senyawa dari satu
fasakefasalaindandidasarkankepadaprinsipkelarutan.Dasarmetodeekstraksicaircairadalahdistribusisenyawa
diantara dua fasa cair yang berada dalam keadaan kesetimbangan. Prinsip dan teknik dasar lebih detail dapat
dipelajaripadababPrinsipdanTeknikPemisahandanPemurnian,subbabEkstraksi.

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan

III.Carakerja
A.Ekstraksicaircair(kelarutan)
Masukkan 5 mL larutan asam asetat glasial (5 mL dalam 110 mL air) dalam corong pisah 100 mL, ekstraksi
dengansatukali15mLeter.Hatihatidenganeterkarenamudahsekaliterbakardantekananuapnyatinggi.Setelah
dikocok12kalipadaawal,bukakrancorongpisahdenganposisiterbalik.Krandipegangdengantangankiri.Pelajari
dan latihlah cara mengekstraksi yangbenar. Simpan corong pada klembundar. Jika sudahterpisah, keluarkanbagian
bawah ke dalam Erlenmeyer dengan hatihati (Ingat, waktu mengeluarkan cairan agar tutup corong pisah sedikit
terbuka). Titrasi larutan dalam fasa air dengan larutan NaOH 0,3 M dan indikator fenolftalein. Sebelumnya, lakukan
titrasilebihduluterhadap5mLlarutanasamasetatawal.Lakukanperhitungankonsentrasiterhadap:a).larutanasam
asetatawal,b).jumlahasamasetatdalamlapisanair,c).persentaseasamasetatdalamfasaairdanfasaeter.Dengan
carayangsamasepertidiatas,akantetapiekstraksiterhadap5mLlarutanasamasetatdalamairdilakukan3(tiga)kali
masingmasingdengan5mLeter.Titrasi larutanasamasetatdalamfasaair.Lakukanperhitungansepertidiatas,dan
bandingkanhasilnya.

B.EkstraksiAsamBasa:Pemisahancampuransenyawaorganikasam,basadannetral
Timbang 0,2 g campuran padatan yang mengandung sejumlah yang sama senyawa (1) asam benzoat
(C
6
H
5
CO
2
H);(2)pnitroanilin(NO
2
C
6
H
4
NH
2
);dan(3)naftalen(C
10
H
8
),kemudianlarutkandalam2mLdiklorometanadi
dalam tabung reaksi bertutup, hangatkan di atas pemasnas listrik jika perlu untuk penyempurnaan pealrutan.
Tambahkan2mLlarutanNaOH6Mkedalamtabungreaksitersebut,tutuptabungreaksi,guncangkanlahtabungreaksi
dengan kuat. Buka perlahan tutup tabung reaksi untuk mengeluarkan tekanan dari dalam tabung akibat proses
pengguncangan.Ulangipengguncanganbeberapakali.Simpantabungreaksipadarakdanbiarkanterjadipemisahan
2fasasecarasempurna.Pindahkanfasaorganik(?)secaraperlahanmenggunakanpipetteteskedalamtabungreaksi
kosongdanbersih,berilabel.Pindahkanpulafasalarutanbasa(?)kedalamtabungreaksilainyangkosongdanbersih,
beri label. Pindahkan kembali fasa organik ke dalam tabung reaksi semula dan ulangi proses ekstraksi dengan
sebelumnyamenambahkan2mLlarutanNaOH6Mkedalamfasaorganik.Lakukanpemsahanfasa,gabungkanfasa
larutanbasadenganlarutanbasayangdihasilkandariprosessebelumnya.
Tambahkan2mLlarutanHCl6Mkedalamfasaorganikdidalamtabungreaksidanlakukanekstraksiseperti
proses sebelumnya. Pisahkan fasa larutan asam ke dalam tabung reaksi kosong dan bersih. Ulangi ekstraksi dengan
menambahkan2mLlarutanHCl6Mkedalamfasaorganik.Gabungkanfasalarutanasamyangdihasilkanpadaproses
inidenganfasalarutanasamdariprosesekstraksisebelumnya.Pindahkanfasaorganikkedalamtabungreaksikosong
danbersih.Tambahkan1mLdiklorometanakedalamfasaorganikpadatabungreaksi,kemudiantambahkansedikit
garam natrium sulfat anhidrat untuk menghilangkan sisa air yang mungkin ada, goyangkan tabung perlahan hingga
tidak lagi terbentuk emulsi. Pisahkan cairan fasa organik dari padatan garam menggunakan pipet tetes yang bagian
bawahnyadisumbatdengansedikitkapas,masukkanfasaorganiktersebutkedalamtabungreaksikosongdanbersih.
SekarangAndamemilikitigafasayangberbeda:(1)fasalarutanbasa(?);(2)fasalarutanasam(?);dan(3)fasaorganik
(?). Dinginkan fasa larutan basa dan kemudian netralkan dengan penambahan larutan HCl 6 M tetes demi tetes
sampai kertas lakmus berwarna merah (atau terbentuk banyak endapan, sekitar 24 mL HCl). Saring padatan secara
vakum menggunakan corong Hirsch atau Buchner dan labu isap, bilas dengan sedikit air dingin. Pindahkan padatan
pada kertas saring lain untuk dikeringkan, ditimbang dan ditentukan titik lelehnya. Ulangi cara yang sama terhadap
fasa larutan asam, hanya untuk penetralan digunakan larutan NaOH 6 M. Padatan yang terbentuk disaring vakum,
dikeringkan, ditimbang dan ditentukan titik lelehnya. Untuk fasa organik, lakukan penguapan diklorometana pada
penangasairdiataspemanaslistrikhinggavolumenyaberkurang(jangansampaikering!!).Angkattabungreaksidari
penangasair,dinginkanpadasuhukamar,lalumasukkankedalampenanagasesagarterbentukkristal.Saringvakum
kristal, kemudian keringkan, timbang dan tentukan titik lelehnya. Catat semua data pada buku catatan paraktikum
Andadanpadalembardatayangtersedia.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 36
C.Ekstraksipelarut:IsolasiTrimiristindaripala(DemonstrasiolehAsisten)
Timbang 10 g pala yang sudah dipotongpotong atau diserbukkan dan bungkus dengan kertas saring
menyerupai silinder dan diikat dengan tali benang kasur. Masukkan bungkusan serbuk pala itu ke dalam tabung
Soxhlet. Perhatian: ukuran bungkusan pala tidak boleh melampaui tinggi dari saluran pelarut pada tabung Soxhlet!!
Masukkan sekitar 40 mL eter ke dalam labu bundar. Hatihati: eter tekanan uapnya sangat tinggi dan mudah sekali
terbakar. Jauhkan dari api!! Pasang tabung Soxhlet di atas labu berisi eter dan pasang kondensor di atas tabung
Soxhlet(lihatgambar!!).Siapkanairpanasditempatlaindantidakbolehadaapidisekitareter!!!Pasangpenangasair
berisiairpanas/mendidihpadaalatSoxhletyangtelahterpasang.Janganlupapasangselangairdannyalakanaliranair
ke dalam kondensor yang sebaiknya dibalut dengan selimut berisi es. Lakukan proses Soxhletasi selama 30 menit.
Janganlupagantiselaluairpanasdidalampenangas.SetelahSoxhletasi,tuangkanekstrakdalamlabubundarkedalam
labu bundar lain untuk didistilasi lebih lanjut (Anda harus sudah merangkai peralatan distilasi pada saat menunggu
proses Soxhletasi). Lakukan distilasi dengan penangas air panas tanpa api!! Larutan ekstrak dikisatkan dengan cara
distilasisampaikirakira15mL.(Perhatian:distilasieterharusmenggunakanpemanasnyaadalahairpanastanpaapi,
pendingin kondensor harusnya pakai air es, dan dilakukan dalam lemari asam. Eter sangat mudah terbakar, titik
didih rendah, uapnya lebih berat dari udara, dan bersifat membius). Setelah didistilasi, ke dalam ekstrak eter
tambahkansedikitdemisedikitsambildiaduksekitar40mLmetanol,sampaiendapanmulaiterlihatdanmengendap
semua. Pisahkan endapan dengan penyaringan Bchner yang dilengkapi pengisapan, cuci sekali dengan campuran
etermetanol (1:1), lalu biarkan kristal kering. Timbang hasil yang diperoleh, tentukan titik leleh dan hitung
rendemennyadalampala.

IV.TugasPendahuluan(PreLab)
1. Termasukmetodeekstraksiapayangdigunakandalampemisahanasambenzoatdalamtoluenyangdiekstrak
kefasaair?Jelaskanmengapacarainiyangdilakukan,danpenjelasanharusdidasarkanpadadatafisikasam
benzoat!
2. Buatlahdiagramalircarapemisahan:asambenzoat,fenol,anilindannaftalenpadapercobaanekstraksicair
cair! Jelaskan prinsip dasar pemisahan keempat senyawa tersebut dan fungsi penambahan reagenreagen
padawaktuekstraksi!
3. Gambarkanstrukturtrimiristinyangdiisolasidaripala!

Pustaka

Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.6784;141149
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.5659;399404
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.127155

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 37
Percobaan4KROMATOGRAFIKOLOM&KROMATOGRAFILAPISTIPIS:
PemisahanSenyawaNitrofenoldanPemisahanZat
PewarnaMakanan

SasaranPercobaan
Padaakhirpercobaanmahasiswaharusdapat:
1.Melakukandanmenjelaskanteknikteknikdasarkromatografikolomdankromatografilapistipis
2.MenjelaskanPrinsipdasarkromatografi.
3.Melakukanisolasicampuransenyawasampaipemurniannyasecarakromatografikolom.

I.Pendahuluan
Kromatografi adalah suatu metode untuk memisahkan senyawa organik dan anorganik sehingga senyawa
tersebutdapatdianalisisdandipelajari.Kromatografiadalahsuatumetodefisikyangbaiksekaliuntukmengamatidan
menyelidikisuatucampurandanpelarutnya.PrinsipdanteknikdasarlebihdetaildapatdipelajaripadababPrinsipdan
TeknikPemisahandanPemurnian,subbabKromatografiKolomdanKromatografilatisTipis(KLT).

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
A.PemisahandanPemurnianNitrofenol
Padapercobaaniniakandilakukanpemisahandengancarakromatografikolomdarisuatucampuranmono,
di dan trinitrofenol yang berasal dari percobaan hasil nitrasi terhadap fenol. Pemisahan ini kemudian diikuti oleh
pemeriksaan secara kualitatif dengan kromatografi lapis tipis. Jadi pemeriksaan yang terakhir ini merangkap pula
sebagaicarauntukmemonitorapakahpemisahandengancarakromatografikolomberhasilatautidak.Padasenyawa
fenol,gugusOHmengaktifkancincinbenzen.Olehkarenaitupadanitrasifenoldenganasamnitratpekat,dihasilkan
campuran yang terdiri dari onitrofenol sebagai hasil utama, pnitrofenol dalam jumlah yang lebih sedikit, dan 2,4
dinitrofenol serta 2,4,6trinitrofenol yang lebih sedikit lagi. Bila campuran hasil nitrasi yang masih kotor ini
dimasukkankedalamkolomyangberisialumina,Al
2
O
3
,atausilikageldandielusi(dilalukan)denganmetilenklorida,
makafraksifraksieluendapatdikumpulkan,dimanaakhirnyamasingmasingfraksimengandungsatukomponenyang
identitasnyaditentukandengancarakromatografilapistipis.

a.Nitrasifenol
Masukkan3mLHNO
3
pekatkedalam7mLairpadagelaskimia50mLdalampenangases,dinginkansampai
5
o
C.Tambahkancampuraninikepada3gfenolyangditempatkandalamlabuErlenmeyer50mL.Sambildiaduk,atur
suhu campuran antara 20 25
o
C selama kirakira 15 menit, kemudian antara 30 35
o
C selama 15 menit, dengan
caramendinginkannyadalamair.Tambahkankirakira7mLaires,laluekstrakduakali,masingmasingdengan10mL
metilenklorida(diklorometana).Cucifasaorganikyangtelahdigabungduakalidenganair,keringkandengannatrium
sulfatanhidrat,danuapkanpelarutnyadiataspenangasair.

b.Kromatografikolom
Siapkankolomgelasyangbagianbawahnyatelahdilengkapidengankranteflon,berisipenyumbatglasswool
atau kapas, dan isikan ke dalamnya 10% etil asetat dalam nheksan (sudah disiapkan) secukupnya. Tuangkan
perlahanlahan 15 g alumina, Al
2
O
3
, atau silika gel yang sudah berupa bubur/slurry dalam pelarut 10% etil asetat
dalam nheksan, ke dalam kolom, sedikit demi sedikit (perhatian: usahakan jangan adagelembung udara!). Setelah
buburaluminaatausilikageltertuangkansemuanyakedalamkolom,turunkanpermukaanpelaruthinggamencapai
permukaan alumina/silika gel dalam kolom. Usahakan kolom bebas dari gelembung gas dan kolom tidak patah.
Seluruhcampuran reaksi nitrasi di atas (hasil percobaan (a)), dengan berat 1/50 1/30 dari beratalumina/silika gel
yangdigunakan(0,30,5gsampel),larutkansedikitdalammetilenklorida,lalutuangkanmenggunakanpipettetes
secaraperlahandiataspermukaankolomalumina/silikagel(jangansampaipermukaankolomteraduk).Tambahkan
eluen10%etilasetatdalamnheksankedalamkolommenggunakanpipetperlahanlahan,mulaibukakerankolom.
Lakukanelusidenganeluen10%etilasetatdalamnheksan.Aturpengeluaraneluen(=kecepatanelusi)kirakira35
mL/menit. Satu pita kuning akan terlihat dengan jelas yang merupakan komponen campuran reaksi yang bergerak
menurunikolom.Bilatetesteteskuningsudahmulaikeluardarikolom,mulailahtampungsetiapfraksieluendengan
tabungreaksi.Penampungandigantisetiap10mL(setaradengan1tabungreaksipenuh),hingga8sampai10fraksi
dapatterkumpul.Pisahkanpenampungsetiapfraksinya.

Catatan:alternatifeluen/pelarutyangdigunakanadalahmetilenklorida/diklorometana(CH
2
Cl
2
).
Lakukan terlebih dahulu KLT terhadap prosuk campuran reaksi sebelum dilakukan kromatografi kolom
(lakukancaranyasesuaiprosedurbagaian(c)).

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 38
c.KromatografiLapisTipis(KLT)
Masingmasingfraksiyangdiperolehdiatas,ditotolkandenganpipakapilerpadapelatpelatlapistipissilika
gelyangsudahtersedia(Catatan:pelatlapistipisdapatdisiapkandengancaramencelupkankacaobjek5x20cmke
dalam bubur silika gel [35 g silika gel G dalam 100 mL kloroform:metanol perbandingan 2:1] dikeringkan dan
diaktifkandalamoven100
o
Csekitar30menit).Pelatlapistipisyangtelahditotolifraksitersebutlaluditempatkan
berdiri di dalam wadah pengembang KLT yang telah berisi benzena setinggi kirakira 0,7 cm (sebagai eluen), lalu
lakukanelusi.Perhatian:jangansampainodasampelpadabatasbawahKLTterendam.Setelahselesaielusi(kirakira
eluen mencapai 1 cm dari tepi atas pelat KLT), keringkan di udara, dan bercakbercak noda hasil pemisahan bisa
dilihat di bawah lampu UV atau dengan cara memasukkan pelat KLT ke dalam botol yang sudah berisi uap iodium
jenuh.TentukannilaiR
f
darinodanodayangdiperoleh!Diketahui:nilaiR
f
standaronitrofenol=0,9;pnitrofenol=
0,4;2,4dinitrofenol=0,2;dan2,4,6trinitrofenol=0,05.

B.PemisahanZatPewarnaMakanan
a.Penyiapansampel
Sedikit sampel zat pewarna makanan (0,5 g) dilarutkan dalam sedikit larutan 25 % isopropanol (atau 95% etanol).
SampeldisimpanuntukdilakukankromatografikolomdanKLT.Berikutbeberapacontohzatpewarnamakananyang
diakuiFDA.

Gambar1Strukturzatpewarnamakanan(A:SunsetYellow;B:Ponceau;C:Tartrazine;D:BrilliantBlue)

b.Kromatografikolom
Buatlahkolomkromotografiskalamikrodenganadsorbensilikagelmenggunakankolomdaripipettetesatau
syringeplatik(pilihsalahsatu).Gunakansekitar11,5gsilikageluntukkolomsyringeplastik;sedangkanuntukkolom
pipettetesgunakansilikagelsecukupnya(hanyamengisisekitarpanjangkolom).Gunakanpelarutisopropanol25%
(atau etanol 95%) untuk membasahi/mengembangkan silika gel dalam kolom. Kemudian teteskan (sekitar 5 10
tetes) sampelzat pewarna pekat yang telah dilarutkandengan sedikitpelarut isopropanol25%(atau etanol 95%) ke
dalam kolom. Tambahkan pelarut isopropanol 25% (atau etanol 95%) perlahanlahan sampai memenuhi kolom.
Lakukan penambahan pelarut sampai terlihat pemisahan pitapita berwarna. Setiap warna yang keluar, tampunglah
dalam wadah yang berbeda. Setelah pita pertama keluar, untuk mengeluarkan pitapita berikutnya, gunakan urutan
pelarut(setelahisopropanol25%atauetanol95%)adalahisopropanol5%(atauetanol70%),kemudianterakhiraqua
dm(air).FraksieluatyangkeluarkemudiandisimpanuntukdianalisisdenganKLT.

c.KromatografiLapisTipis(KLT)
Lakukan KLT terhadap sampel zat pewarna sebelum dan sesudah kromatografi kolom. Gunakan pelarut
isopropanol25%atauetanol95%sebagaieluenuntukKLT..HitunglahsetiapR
f
nodayangmuncul.

IV.TugasPendahuluan
1. Tuliskanreaksidanmekanismereaksipembentukan2nitrofenol,4nitrofenoldan1,4benzokuinondarireaksi
nitrasifenolini!
2. Jelaskanmengapa2nitrofenolkurangpolardaripada4nitrofenol!
3. Jelaskandenganmekanismereaksimengapaproduk3nitrofenoltidakterbentuk!
4. Jelaskanmengapareaksinitrasisulitatautidakterjadijikadilakukanpadacincinaromatiktanpagugus
hidroksi!
5. CaridangambarkanstruktursenyawazatpewarnalainnyayangdiperbolehkanolehFDA!

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 39
Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.92100
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.6081;404406
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.160166;p.704706

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 40
Percobaan5KEISOMERANGEOMETRI:PengubahanAsamMaleat
menjadiAsamFumarat

SasaranPercobaan
Padaakhirpercobaanmahasiswadiharapkandapatmenjelaskan:
1. Azasdasarkonfigurasiruang,khususnyaisomergeometri.
2. Perbedaankofigurasicisdantranssecarakimiadanfisika.

I.Pendahuluan
Struktur ruang atomatom dalam molekul seringkali sangat menentukan sifatsifatnya. Bila dua gugus yang
reaktifadalahcisdantranssatuterhadapyanglainnya,makaperbedaangeometrikadangkadangmudahditunjukkan
secara kimia, seperti halnya asam maleat dan asam fumarat, yaitu masingmasing cisasam butenadioat dan trans
asambutenadioat.Bilaasammaleatdipanaskandalamsuatutabungtertutupdiatastitiklelehnya130
0
C,makaakan
dihasilkananhidridamaleatdan1molmolekulair.

Sebaliknya, asam fumarat tidak meleleh, akan tetapi menyublim pada suhu 287
o
C, dan membentuk anhidrida
polimerik,ataupadasuhuyangtinggiberubahmenjadianhidridamaleat.
Perubahan isomerisomer geometri, seperti asam maleat menjadi asam fumarat, dapat terjadi melalui
penentuanikatanrangkapC=CyanguntuksementarawaktudiubahmenjadiikatantunggalCC.Melaluiikatantunggal
inilah perputaran dapat berlangsung dengan bebas. Seringkali, walaupun tidak selalu, isomer trans lebih stabil
daripadaisomercis,danmerupakanbagianterbanyakdalamkesetimbangan.
Pengubahan isomerisomer geometri dari yang satu ke yang lain, boleh dijalankan melalui pembentukan
senyawaantarayangbersifationatauradikalbebas.Padapercobaanini,asammaleatdirefluksdenganasamkhlorida
yangakanmengubahnyamenjadiasamfumaratyanglebihstabil.Asamfumaratjauhlebihsedikitlarutdalamairdari
pada asam maleat, sehingga menyebabkan mudah mengkristal dari larutan selama reaksi berjalan. Mekanisme
reaksinyasudahdisarankansebagaiberikut:

O
OH
O H O
OH
O
O H
O
Asam maleat (cis)
Asam fumarat (trans)
H
+
OH
OH
O H O
+
OH
OH
O H O
+
rotasi
OH
OH
O H
O
+
:
..
OH
OH
O H
O
+
-H
+

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
Didihkan 20 mL air suling dalam labu Erlenmeyer 125 mL dan tambahkan 15 g anhidrida maleat. Anhidrida
maleat mulamula akan melebur/meleleh (t.l. 53
o
C), kemudian bereaksi dengan air menghasilkan asam maleat yang
sangat larut dalam air panas (400 g/100 mL air panas) bahkan mudah larut dalam air dingin (79 g/100 mL air pada
25
0
C). Setelah larutan menjadi jernih, dinginkan labu di bawah pancaran air kran sampai sejumlah maksimum asam
maleat mengkristal dari larutan. Kumpulkan asam maleat di atas corong Buchner, keringkan dan tentukan titik
lelehnya.Jangandibuangfiltratyangmengandungbanyakmaleatterlarut!

O
OH
O H O
OH
O
O H
O
Asam maleat (cis) Asam fumarat (trans)
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 41
Pindahkan larutan filtrat ke dalam labu bundar 100 mL, tambahkan 15 mL HCl pekat dan refluks perlahan
lahan selama 10 menit. Kristal asam fumarat akan segera mengendap dari larutan panas (kelarutannya dalam air 9,8
g/100 mL pada 100
0
C dan 0,7 g/100 mL pada 25
0
C). Dinginkan larutan pada suhu kamar, kumpulkan asam fumarat
dalam corong Buchner, dan rekristalisasi dalam air. Tentukan titik lelehnya dengan menggunakan melting block atau
meltingpointapparatus(yangtersediadilaboratorium).Bandingkantitiklelehasammaleatdanasamfumarat!Ukur
spektrumUVVisasammaleatdanasamfumarat,bandingkanhasilnya!

IV.TugasPendahuluan
1. Apakah cis 1,2dikloroetan boleh saling bertindih dengan isomer trans? Apakah yang menghalangi terjadinya
perubahanyangleluasadaribentukyangsatukebentukyanglain?
2. Apakah syarat yang terpenting agar suatu alkena dapat berada dalam bentuk isomer cis dan trans? Manakah
antara alkena berikut yang dapat berada dalam bentuk isomer cis, trans? 1kloropropena, 2kloropropena, 2
butena.Gambarkanstruktursenyawatersebutuntukmenunjukanjawabananda.
3. Bagaimanakah struktur anhidrida maleat? Terangkan mengapa anhidrida maleat sangat baik sebagai dienofil
dalamreaksiDielsAlder?

Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.163173
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.488490
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.706707
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 42
Percobaan 6 PEMBUATAN SIKLOHEKSENA

SasaranPercobaaan

Pada akhir percobaan ini mahasiswa harus dapat menjelaskan mengenai: 1) teknikteknik dasar dalam
pemisahandanpemurnianzatcair,sepertipenyaringan,pengeringandandistilasi,2)azasazasdehidrasialkohol,dan
3)azasazasketakjenuhandanreaksireaksiuntukmenunjukkanadanyaketakjenuhansenyawaolefin.

I.Pendahuluan

Salahsatucontohpembuatanolefindarialkoholadalahdehidrasisikloheksanolmenjadisilokhesenadanair.
Dehidrasidapatdilakukandengancaramemanaskanalkoholdengansuatuasam,padasuhutidakterlalutinggi.Dalam
percobaan ini, sebagai katalis dipilih asam fosfat. Hasil reaksi segera dikeluarkan begitu ia terbentuk, dengan cara
distilasi.

OH
H
+
+ H
2
O

Campuranreaksiakanterdiridaricampuranazeotropdarisikloheksena,airdansedikitbahanbahanlainyang
bertitik didih tinggi. Asam fosfat yang ikut serta waktu didistilasi, dihilangkan dengan mencucinya berturutturut
dengan air dan larutan NaHCO
3
. Pada pencucian ini bahan organik dan air tidak saling bercampur, sehingga lapisan
organik bisa dipisahkandengan corong pisah. Sikloheksena yang dihasilkan dikeringkan dengan CaCl
2
kering sehingga
air terikat sebagai hidrat dan sebagian sikloheksanol sisa membentuk kompleks yang sejenis dengan hidrat tersebut.
Sikloheksena yang bebas air ini mungkin masih bercampur dengan sedikit sikloheksanol sisa dan diskloheksil.
Pemurniansikloheksenadilakukandengancaradistilasi.Kemurniannyaditentukanolehidentifikasiindeksbiasnya.

II.PeralatandanZat

Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.CaraKerja

Tempatkan20gsikloheksanoldalamlabubundar100mL.Tambahkanhatihati5mLlarutan85%H
3
PO
4
pekat,
dikocok dengan baik. Pasang kolom bertingkat dan kondensor refluks pada labu, pasang juga adaptor pada ujung
kondensoryangdihubungkandengantabungreaksididalamErlenmeyer125mLberisipotonganes(lihatGambar1).
Panaskan labu dengan api kecil sampai mendidih (jangan lupa tambahkan batu didih atau masukkan batang
pengadukmagnetlalulakukanpengadukan!),danlakukandistilasisampaivolumeresidudalamlabusekira510mL
danhanyasedikitsekalidistilatyangterbentuk(amatiperubahansuhu!).Kemudianbiarkanperangkatdistilasisampai
dingin sebentar. Lepaskan termometer dengan cepat dan tuangkan 20 mL toluen ke dalam labu distilasi tersebut
menggunakan corong panjang. Perhatikan jumlah lapisan campuran reaksi bagian atas di dalam labu, lalu distilasi
kembali sampai volume lapisan berkurang setengahnya. Tuangkan isi distilat dalam tabung reaksi ke dalam corong
pisah dan bilaslah dengan sedikit toluen; gunakan pelarut ini untuk setiap proses pencucian dalam percobaan
selanjutnya.CucicampuranreaksidenganlarutanNaCljenuhdalamjumlahvolumeyangsama.Lakukanekstraksi,lalu
pisahkanlapisanair.Lapisanorganikdipindahkankedalamwadahyangbersih,tambahkan5gCaCl
2
anhidrat(?),lalu
saring. Lakukan distilasi bertingkat pada filtrat yang diperoleh, kumpulkan fraksi distilat pada suhu antara 80 85
o
C
(jangan lupa tambahkan batu didih atau masukkan batang pengaduk magnet lalu lakukan pengadukan!). Timbang
distilatyangdiperoleh(rendemen:13,2g)dantentukanindeksbiasnya!

Perhatian:susunanalatdistilasibertingkatyangdigunakanpadatahappertamatidakperludibongkar.Andahanya
cukupmenggantilabunyasajapadasaatakanmelakukandistilasitahapkedua.
SimpanproduksikloheksenaAndadalambotol/vialtertutupuntukdigunakanpadapercobaanminggudepan!
Berinama,NIMdanno.KelompokAndapadabotol/vialtersebut!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 43

Gambar1Rangkaianalatuntukdistilasisikloheksena

IV.TugasPendahuluan(PreLab)

1. Tulispersamaanreaksidanmekanismereaksipembuatansikloheksenadarisikloheksanol.
2. Bedasarkancarakerjadiatas,padatahapmanapengotorpengotorberikutdipisahkan:a.Sikloheksanol;b.Asam
fosfat;danc.Air.
3. Melihatmekanismereaksidiatas,reaksipembentukansikloheksenamerupakanreaksikesetimbangan.Mengapa
dengancaradiatasternyatareaksinyabisadilakukansecarasempurna?Jelaskan!

Pustaka

Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.409420
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemisty, Prentice Hall Inc., New
Jersey,,p.417418
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.278283
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 44
Percobaan7Hidrokarbon:SifatdanReaksiKimia

SasaranPercobaan
Padaakhirpercobaanmahasiswadiharapkandapatmenjelaskanmengenai:
a. perbedaansifatsifatsenyawahidrokarbon
b. jenisjenispereaksiuntukmembedakansenyawasenyawahidrokarbon.

I.Pendahuluan
Kimiaorganikadalahilmukimiatentangsenyawakarbon.Hinggasaatini,terdapatlebihdari20jutasenyawa
yang dilaporkan di dalam berbagai literatur; sekitar 90% di antaranya adalah senyawa organik, yaitu senyawa yang
mengandung karbon. Sisanya adalah senyawa anorganik dan senyawa lain yang terbentuk dari unsurunsur lain,
sekitar 100. Senyawa karbon begitu mendominasi pembentukan berbagai senyawa merupakan fakta dari keunikan
karbondalamkemampuannyamembentukrantaipanjangdengansesameatomkarbon.Tetanggakarbondalamsatu
golongandalamsystemperiodicunsur,yaitusilicon,dapatjugamembentukrantaipanjangdengansesamanya,namun
jarangterjadi).Rantaikarbonyangterbentukdapatberbentukrantailurus,bercabang,bahkanlingkar/siklik.Sebagai
contoh, salah satu golongan senyawa karbon disebut senyawa
hidrokarbon karena ikatannya hanya terdiri dari karbon dan
hidrogen. Senyawa hidrokarbon terbagi lagi menjadi nbeberapa
kelompok senyawa berdasarkan ikatan antara atom karbonnya.
Jika semua ikatan karbonkarbon adalah tunggal, golongan
senyawa ini disebut alkana. Jika paling sedikit terdapat satu
ikatan rangkap dua pada karbonkarbon, sedangkan sisa ikatan
lainnya merupakan ikatan tunggal, maka kelompok senyawa ini
disebut alkena. Sedangkan jika terdapat paling sedikit satu
ikatan rangkap tiga pada karbonkarbon, maka kelompok
senyawa ini disebut alkuna. Jika suatu senyawa mengandung
cincin beraatom karbon 6 yang terdiri dari ikatan tunggal dan
rangkap berselangseling, maka golongan senyawa ini disebut
aromatik. Sepintas, senyawa aromatik terlihat seperti senyawa
alkena dengan 3 buah ikatan rangkap membentuk cincin lingkar
enam. Namun, ikatan yang sebenarnya pada aromatik berbeda
sama sekali dengan alkena, sehingga sebagai konsenuensinya
banyak sifat kimia senyawa aromatik yang berbeda dari
alkena.Oleh karena itu, senyawa ini ditempatkan dalam
golonganyangberbeda.
Senyawa hidrokarbon terbagi menjadi sub kelompok:
jenuh dan tak jenuh. Hidrokarbon jenuh adalah menunjukkan
jumlah hidrogen yang terikat dalam total jumlah karbon yang
terdapat dalam senyawa sedemikian rupa sehingga tidak
mungkin menambahkan atom hidrogen lain dari luar untuk
terikat dengan karbon dalam senyawa. Senyawa alkana asiklik
(rantaiterbuka,lurusmaupunbercabang),termasukhdrokarbon
jenuh.Alkena,alkunadanalkanasikliktermasukhidrokarbon
tak jenuh karena atom hidrogen masih bisa ditambahkan ke
dalam struktur senyawa tersebut untuk menjadikan senyawa
tersebutmenjadigolonganalkana.Beberapacontohreaksipengubahanhidrokarbontakjenuhmenjadijenuhterlihat
padaGambar2.
Gambar1Senyawahidrokarbonrantailurus,
bercabangdansiklik
Oktana - tak bercabang (rantai lurus)
CH
3
C
H
2
H
2
C
H
2
C
C
H
2
H
2
C
H
3
C
4-etil-2-metiloktana - bercabang
CH
3
CH
CH
2
CH
H
2
C CH
2
H
2
C CH
3
H
3
C
H
2
C
H
3
C
etilsikloheksana - siklik
CH
H
2
C CH
2
CH
2
CH
2
H
2
C
H
2
C
H
3
C
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 45
H
3
C C
H
C
H
CH
3
+ H
2
katalis
H
3
C
H
C
H
C CH
3
H H
H
3
C C C CH
3
+ 2H
2
katalis
H
3
C C C CH
3
H H
H H
3H
2 katalis
H
2
C
H
2
C
C
H
2
CH
2
CH
2
H
2
C
+ H
2
menurut teori
bisa,
dalam
prakteknya
tidak mudah
H
2
C
H
2
C
CH
3
CH
3
CH
2
H
2
C
H
H
H
H
H
H
Senyawa Tak Jenuh
Senyawa Jenuh

Gambar2.Reaksiperubahanhidrokarbontakjenuhmenjadijenuh

SifatFisik
Kepolarandankelarutan.Beberapamolekulmemilikimuatanlistrikkarenaterdapatperbedaanantarajumlah
electron (masingmasing dengan muatan 1) dengan jumlah proton (masingmasing bernmuatan +1) dalam molekul.
Molekulmolekulinidisebuttipeion.Contoh,ionammonium,NH
4
+
,memilikimuatan+1karenamemiliki11proton(7
dari nitrogen dan 4 dari hidrogen) dan 10 elektron (2 dari kulit pertama nitrogen, dan 8 dari kulit keduanya, yang
dipakai untuk membentuk ikatan antara hidrogen dengan nitrogen). Dengan demikian, muatan plus 11 ditambah
muatan minus 10 menghasilkan muatan total ion ammonium +1. Sebagian besar molekul bukanlah ion, sehingga
secara muatan listrik netral, dan muatan totalnya 0 karena jumlah proton dan elektronnya sama. Dalam beberapa
molekul,walaupunmuatantotalnya0,namundistribusimuatanpositif(proton)danmuatannegative(electron)dalam
molekultidaksama.Molekulsepertiinimemikidistribusimuatanyangtidakberimbangdisatusisimolekultersebut
kaya electron (memiliki muatan parsial negative) dan di sisi lain kaya akan proton (muatan parsial positif). Molekul
sepertiinidisebutmolekulpolarataumemilikimomendipole.Semakintidakberimbangdistribusimuatanini,semakin
besar momen dipole dan molekul tersebut semakin polar. Di dalam beberapa molekul distribusi muatan positif dan
negatifnya sama, dan molekul ini dikatakan tidak memiliki momen
dipole atau non polar. Ketika molekul organik bersifat non polar
biasanya disebabkan adanya satu atu lebih atom yang lebih
elektronegatif daripada karbon terikat pada salah satu sisi molekul.
Atomatom elektronegatif adalah atom yang dapat menarik electron,
di antaranya: nitrogen,oksigen, dan halogen, terutama fluor dan klor.
Molekul polar saling tarik menarik satu sama lain akibat adanya sisi
negativesatumolekulmenariksisipositifmolekullainya.Molekulnon
polar gaya saling tarik antarmolekulnya tidak sekuat pada molekul
polar, sedangkan molekul polar sama sekali tidak salin berantaraksi
dengan molekul non polar. Hidrokarbon merupakan molekul yang
kurang atau tidak polar karena kelompok senyawa ini tidak
mengandung atom yang elektronegatif. Kelarutan senyawa ini baik
dalampelarutyangkepolarannyarendahdantidaklarutdalampelarut
yangsangatpolarsepertiair.
Kerapatan adalah massa material dibagi dengan volumenya,
sering diungkapkan dalam satuan g/cm
3
. Sebagian besar senyawa
hidrokarbonlebihrendahdaripadaair.
Indeks bias,n, suatu senyawa adalah kecepatan cahaya dalam ruang hampa, S
v
, dibagi dengan kecepatan
senyawa zat yang dilewati, S
m
. Oleh karena kecepatan cahaya lebih cepat d dalam ruang hampa, maka indeks bias
Gambar3IndeksBias
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 46
senyawa lebih besar daripada 1. Indeks bias senyawa dapat diukur menggunakan Abb refractometer. Oleh karena
terdapat banyak electron di sekitar cincin aromatik, maka senyawa ini biasanya memiliki indeks bias lebih besar
daripada senyawa hidrokarbon lainnya. Biasanya senyawa aromatik memiliki indeks bias lebih besar darida 1,45,
sementarasenyawahidrokarbonlainnyamemilikinilaiyanglebihkecil.
Wujudzat.Gasalamterdiridarialkana,mengandung90%metanadansedikitetanadanpropana.Metana,
etana, propana dan butana berwujud gas pada suhu kamar. Pentana berwujud cair pada suhu kamar, dan alkana
rantailurusmulaiberwujudpanjangketikajumlahatomkarbonnya16.

ReaksiKimiaHidrokarbon
1.Pembakaran
Semuahidrokarbonmengalamipembakaranapabilaadaoksigenyangcukup.Reaksipembakaransempurna
akan mengubah hidrokarbon menjadi karbon dioksida dan air, disertai pelepasan energi (eksoterm). Contoh reaksi
pembakaranberikutadalahpembakaranpropana,bahanbakuLPG(bahanbakaruntukmemasak).

C
3
H
8
+5O
2
3CO
2
+4H
2
O

2.Reaksidenganbrom
Hidrokarbon dengan ikatan rangkap (hidrokarbon tak jenuh, kecuali sebagian besar sikloalkana) bereaksi
dengan brom. Tetraklorometana (karbon tetraklorida) atau sikloheksana biasa digunakan sebagai pelarut karena
bersifat tak reaktif terhadap brom dan hidrokarbon berikatan rangkap. Alkena dan alkuna mengalami reaksi adisi
denganbrom.Ikatanrangkapalkenamenjadiikatantunggaldansalahsatuatombromterikatpadasalahsatukarbon
yang asalnya berikatan rangkap. Tidak ada produk lain yang terbentuk Ikatan rangkap tiga pada alkuna juga
mengalami reaksi adisi menjadi ikatan tunggal, dengan dua ikatan tunggal baru mengikatmasingmasing satu atom
brom.Contohreaksinyasebagaiberikut.

Reaksi ini biasanya terjadi dengan cepat pada suhu kamar tanpa katalis. Brom berwujud cair berwarna coklat
kemerahan.Semuasenyawahidrokarbonyangakanbereaksitidakberwarna.Jadi,ketikabrommengadisialkenaatau
alkuna, warna coklat kemerahan memudar dengan cepat. Brom dapat bereaksi dengan alkana, namun reaksinya
membutuhkan panas atau sinar ultraviolet agar reaksi terjadi, jenis reaksinya disebut reaksi substitusi, bukan adisi,
karena satu atom hidrogen pada alkan digantikan oleh satu atom brom dan terbentuk hidrogen bromide sebagai
produksamping.

KarenareaksiinitidakdapatterjadiapabilatakadasinarUV,makajikabromditambahkankedalamalkanapadasuhu
kamar dan tanpa cahaya matahari atu sumber UV lain, maka warna brom yang coklat kemerahan akan tetap ada.
Cincinaromatikbereaksidenganbromdalamsuatureaksisubstitusi;reaksiinilebihlambatdaripadareaksiadisibrom
terhadapalkenadanalkunadanmembutuhkankatalis.Besi(III)bromidemerupakankatalisyangbaikuntukreaksiini.
Jika logam besi dimasukkan ke dalam campuran senyawa aromatik dengan brom, maka besi(III)bromide akan
terbentuk.Perhatikanbahwagugushidrokarbonyangterikatpadaaromatikakanbeeaksisepertiyangdigambarkandi
atas.

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 47

3.ReaksidenganAsamSulfatpekat
Alkena bereaksi dengan asam sulfat pekat pada suhu kamar menghasilkan suatu asam alkyl sulfonat. Asam
alkylsulfonatsanagtpolardanlarutdalamasamsulfatyangpolardengansedikitpengadukan.Alkenayangnonpolar
tidak larut di dalm asam sulfat yang pekat, tetapi akan larut ketika bereaksi dengan asam ini dan kemudian diaduk.
Yangkedua,alkenatidakmampumembentukikatanhidrogen,sedangkanasamsulfatdanasamalkylsulfonatmampu.
Ikatanhidrogenadalahsuatuikatankhususgayatarikdipoledipolyangkuat.

Alkuna bereaksi lambat atau tidak bereaksi sama sekali dengan asam sulfat pekat, kecuali apabila terdapat katalis
(HgSO
4
). Alkuna akan berubah warna menjadi gelap tetapi tidak larut di dalam asam sulfat. Alkana tidak bereaksi
denganH
2
SO
4
pekat.Aromatikbereaksiagaklambatpadasuhukamar(mengalamireaksisubstitusidimanasatuatom
hidrogenyangterikatpadacincinkarbonaromatikdigantikanolehgugusSO
3
H).

4.ReaksidenganKaliumPermanganat
Larutan kalium permanganate encer dapat mengoksidasi alkena menghasilkan diol geminal (diol berarti dua
gugus OH. Geminal berarti terletak pada dua atom karbon yang berikatan langsung). Alkuna teroksidasi menjadi
diketongeminal.Padaprosesini,warnaungukaliumpermanganttereduksimenjadiendapancoklatmangandioksida.
Karena kalium permanganate larut dalam air, tetapi baik air maupun kalium permanganate larut dalam hidrokarbon,
maka reaksi berlangsung pada antarmuka airhidrokarbon, sehingga berlangsung lambat. Sebagai konsekuensinya,
endapan coklat yang terbentuk lebih lama. Alkana dan cincin aromatik tidak bereaksi dengan larutan kalium
permanganateencer.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 48

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
Tersediadilaboratorium:
1. Hidrokarbon: heksana atau sikloheksana (alkana), sikloheksena (alkena; diperoleh dari Percobaan 6), dan toluena
(aromatik)
2.Reagenpenguji:1%bromdalamsikloheksana,1%larutankaliumpermanganat,danasamsulfatpekat.
3.ZattakdikenaldalambotolberlabelA,B,C,danD.Salahsatudarisenyawadalambotolbisaalkana,alkena,alkuna
atauaromatik.
4. Catat pengamatan Anda. Jika Anda tidak mencatatnya, maka sama dengan Anda tak pernah melakukan
percobaanini!

a.SifatFisik
1. berinama4tabungreaksidengannamasenyawahidrokarbondiatas.
2. Masukkan10tetesmasingmasingsenyawakedalamtabungreaksi.
3. Uji kelarutan keempat senyawa tersebut dalam air dan kerapatan tiap senyawa relatif terhadap air, dengan
menambahkanmasingmasing10tetesairkedalamtiaptabungreaksi.
4. Ulangitahapno.2.
5. Uji kelarutan keempat senyawa dalam heksana dan kerapatan relatif terhadap heksana, dengan menambahkan
10tetesheksanakedalamtiaptabungreaksi.
6. Ukurindeksbiaskeempatsenyawadenganrefraktometer(denganbimbinganasisten!).

b.ReaksiKimia
1.ReaksidenganBrom

1. Berilabel4tabungreaksisesuaidengansenyawayangakandiuji.
2. Masukkan10tetestiapsenyawakedalammasingmasingtabungreaksi.
3. Tambahkan15teteslarutanbrom1%dalamsikloheksana.Goyangkantabung.Catatwaktu(dalamdetik)ketika
terjadiperubahanwarnabrom(jikaada)
4. Berilabel4tabungreaksidenganA,B,CdanD.
5. Ulangitahapno.2.denganmenggunakansenyawapadabotolA,B,C,danD.
6. Ulangitahapno.3terhadapzattakdikenalA,B,CdanD.

2.ReaksidenganKaliumPermanganat.

1. Berilabel4tabungreaksisesuaidengansenyawayangakandiuji.
2. Masukkan10tetestiapsenyawakedalammasingmasingtabungreaksi.
3. Tambahkan10teteslarutan1%kaliumpermangant.Goyangkantabung.Catatwaktu(dalamdetiksampaimenit)
ketikaterjadiperubahanwarnakaliumpermanganat(jikaada)
4. Berilabel4tabungreaksidenganA,B,CdanD.
5. Ulangitahapno.2.denganmenggunakansenyawapadabotolA,B,C,danD.
6. Ulangitahapno.3terhadapzattakdikenalA,B,CdanD.
Hatihatibekerjadengankaliumpermanganat,jangansampaimengenaianggotatubuhAnda!Kaliumpermanganate
adalahoksidatorkuat!
Hatihatibekerjadenganbrom,jangansampaimengenaianggota tubuhAnda danjangandibilasdenganair!!!Cari
dantemukanlokasiAntiBromuntukmenjagakemungkinanterkenabrom.Segeracelupkanbagiantubuhyang
terkenabromkedalamlarutanAntiBrom (larutannatriumbikarbonat)!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 49

3.ReaksidenganAsamSulfatpekat

1. Berilabel4tabungreaksisesuaidengansenyawayangakandiuji.
2. Masukkan10tetestiapsenyawakedalammasingmasingtabungreaksdantempatkankeempattabungreaksidid
lamaires.Jangansampaiairesmasukkedalamtabung!
3. Tambahkan 5 tetes asam sulfat pekat. Aduk hatihati dengan batang pengaduk kaca dan tabung reaksi masih di
dalamaires.Apakahterjadipelepasankalor?Apakahterjadiperubahanwarna?Apakahcampuranhomogenatau
terbentukdualapisan?CatathasilpengamatanAnda.
4. Berilabel4tabungreaksidenganA,B,CdanD.
5. Ulangitahapno.2.denganmenggunakanzattakdikenalA,B,C,danD.
6. Ulangitahapno.3terhadapzattakdikenalA,B,CdanD.

4.ReaksiNitrasiterhadapSenyawaAromatik

1. Isilahtabungreaksisebagaiberikut:

Tabungreaksi1 1mLlarutantoluena dalametanol


Tabungreaksi2 1mLlarutanfenoldalametanol
Tabungreaksi3 1mLlarutan2naftoldalametanol

2. Tambahkan10tetes(tetesdemitetes)HNO
3
kedalamtiaptabungreaksi.Amatidancatatlahapayangterjadi!

IV.TugasPendahuluan(PreLab)
1. Bila dianggap bahwa heptana (C
7
H
16
) adalah salah satu komponen dari ligroin, tulislah persamaan reaksinya
denganbrom!?
2. Tulislahpersamaanuntukreaksiantarasikloheksenadenganbrom!Apakahjenisreaksiini?
3. Tulislahpersamaanreaksiantarasikloheksenadengankaliumpermanganat!
4. Bedasarkan reaksireaksi di atas, bagaimanakah dengan mudah dibedakan antara siklopentana dan
siklopentena?
5. Tulislahpersamaanuntukreaksiantarasikloheksenadenganasamsulfatpekat!
6. Bagaimanakahhidrokarbontakjenuhdapatdihilangkan/dipisahkandaribensinyangmengandungnya?
7. Apakah reaksi yang sederhana yang dapat digunakan untuk membedakan benzena dari sikloheksena, dan
bensindariligroin?
8. Apakahperanandaripotonganpotonganbesidalamreaksibenzenadenganbrom?
9. Tulislah mekanisme reaksi untuk brominasi benzena ? Tulislah pula mekanisme reaksi dan adisi brom pada
propilen!

Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.644645
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organik Chemisty, Prentice Hall Inc., New
Jersey,
Williamson(1999),MacroscaleandMicroscaleOrganikExperiments,3
rd
edition,Boston,
Hatihatibekerjadenganasamsulfatpekat,jangansampaimengenaianggotatubuhAnda!Janganlangsung
membilasanggotatubuhAndadenganairapabilaterkenaasamsulfatpekat!Lapduludengankain/kertaskering,
barulahbilasdenganairsebanyakbanyaknya!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 50
Percobaan8PEMBUATANTERSBUTILKLORIDA:ReaksiSubstitusi
NukleofilikAlifatik

SasaranPercobaan
Padaakhirpercobaanmahasiswaharusmahirmengenaihalhalberikut:1)carapenyusunandanpenggunaan
alat yang diperlukan dalam pembuatan senyawa organik berwujud cair sepeti merefluks, ekstraksi pelarut,
menggunakan corong pisah, pengeringan, penyaringan dan distilasi; 2) azasazas reaksi substitusi nukleofilik alifatik;
dan3)perbedaanyangkhasantarareaksisubstitusijenisSN
1
danSN
2
.

I.Pendahuluan
Gugushidroksildalamtersieralkoholadalahgugusyangpalingmudahdisubstitusi,danhalinimenyebabkan
alkoholtersebutdapatbereaksidenganHClpekatpadasuhukamar.Reaksitersebutadalahreaksisubstitusinukleofilik
tipeSN
1
yangmelibatkanpembentukansenyawaantara,yaituionkarboniumyangrelatifstabil.

R C
R
R
OH H Cl +
R C
R
R
O
+
H
H
H
2
O R C
+
R
R
+
R C
R
R
Cl
Cl
-

Alkohol sekunder, apalagi yang primer, memerlukan kondisi yang sangat kuat untuk melakukan reaksi
substitusi,yangbiasanyamemerlukanpemanasancampuranalkoholasamdansengkloridaanhidrat.Bilaalkoholnya
berupa alkohol alisiklik, dianjurkan menggunakan CaCl
2
anhidrat sebagai pengganti ZnCl
2
. Reaksi yang menggunakan
HClZnCl
2
merupakanreaksisubstitsusitipeSN
2
,terutamauntukalkoholprimer.

R OH HCl
ZnCl
2
+
R OH H Cl ZnCl
2
- H
2
O
R Cl + ZnCl
2
+ H
2
O

MekanismetipeSN
1
jugamemungkinkanterjadi:
ROH
ZnCl
2
R O
+
H
ZnCl
2
R
+
+
HO ZnCl
2
H Cl
R Cl + ZnCl
2
+ H
2
O

Jalurreaksiyangterakhirinicenderungterjadipenataanulanggugusalkil.
Penataan ulang dapat dicegah dengan mengganti senyawa klorida yang digunakan dengan senyawa tionil
kloridaataucampurantionilkloridadenganpiridin.Piridinyangdigunakan,dapatdalamjumlahkatalitikatauekimolar.
Bila hanya menggunakan tionil klorida saja, yang pertama kali terbentuk adalah ester klorosulfit, yang kemudian
teruraimenjadialkilkloridadenganmekanismesiklik(SN
1
).

R OH
Cl S Cl
O
O S Cl
O
R
+
Cl
-
R Cl + SO
2
+ HCl
-
Cl
-

Bila menggunakan piridin, ion klorida akan dilepaskan pada tahap reaksi pertama (pembentukan klorosulfit), terjadi
reaksisubstitusiSN
2
.

HCl +
C
5
H
5
N
C
5
H
5
NH
+
Cl
-
+
Cl
-
R O S
O
Cl +
R Cl + SO
2
Cl
-
+
(CH
3
)
3
C OH + HCl
(CH
3
)
3
C Cl + H
2
O

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 51
II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.CaraKerja
Isi corong pisah 250 mL dengan 25 g (0,34 mol) tbutilalkohol (t.d. 8283
0
C) dan 85 mL HCl pekat. Kocok
campuran dari waktu ke waktu selama 20 menit. Tiap pengocokan, longgarkan kran corong pisah untuk mengurangi
tekanan. Biarkan campuran selama beberapa menit sampai kedua lapisannya memisah sempurna. Ambil dan buang
lapisan asam di bagian bawah. Cuci halida (lapisan bagian atas?) dengan 20 mL larutan NaHCO
3
5%, lalu pisahkan.
Lapisan halida disaring menggunakan corong yang dilengkapi kertas saring berlipat. Filtrat ditampung dalam labu
distilasi 100 mL, tambahkan 23 potong batu didih, lakukan distilasi (gunakan penangas air), kumpulkan fraksi didih
pada 49 51
0
C. Fraksi tersebut diperkirakan tbutil klorida sebanyak 28 g. Hitung % rendemen yang Anda peroleh!
Tentukankemurniannyadenganmengukurindeksbiasnya!

UjiAlkilHalida:ReaksiSN
1
atauSN
2
?
a.NatriumIodidadalamAseton
Berinama4buahtabungreaksidanmasukkanmasingmasingsebanyak0,1mLatau100mgsenyawaberikut:
1klorobutana/1bromobutana, tersbutil klorida, 2bromobenzena, dan 2klorobutana (atau senyawa alkil halida
alifatik dan aromatik lainnya yang tersedia di laboratorium). Ke dalam masingmasing tabung reaksi, tambahkan
dengan cepat 1 mL larutan 18% NaI dalam aseton. Tutup masingmasing tabung reaksi, kocok dengan baik, dan
perhatikan waktu saat muncul endapan pertama kali. Jika tak ada reaksi dalam waktu 5 menit, tempatkan tabung
reaksidalampenagasair(suhu50
o
C)danamatiperubahanyangterjadidalamwaktu5atau6menit.

b.LarutanPerakNitratdalamEtanol
Masukkankedalam4buahtabungreaksisenyawasenyawadiatas(samadenganprosedura).Tambahkanke
dalam tiap tabung reaksi 1 mL larutan 1% perak nitrat dalam etanol, kocok dengan baik, dan perhatikan waktu
terbentuknyaendapanpertamakali.Jikatakadareaksidalamwaktu5menit,tempatkantabungreaksidalampenagas
air(suhu50
o
C)danamatiperubahanyangterjadidalamwaktu5atau6menit.
Untuk menguji pengaruh pelarut terhadap laju kerektifan reaksi SN
1
, bandingkan waktu yang dibutuhkan
untukterbentuknyaendapanketika2klorobutanaatautersbutilkloridadireaksikandenganlarutan1%AgNO
3
dalam
etanoldanketika2klorobutanaatautersbutilkloridadireaksikandenganlarutan1%AgNO
3
dalamcampuranetanol
air1:1.Bandingkanpulapengaruhstruktur,gugushalidadansuhuterhadapkereaktifanreaksiSN
1
danSN
2
.

c.PengaruhpelarutterhadapkereaktifanreaksiS
N
1(Solvolisis)
Perhatikan tabel di bawah. Siapkan 1 tabung reaksi untuk setiap campuran pelarut. Dengan gelas ukur,
siapkan 2 mL campuran pelarut seperti tertera pada tabel. Ke dalam tiap tabung reaksi, tambahkan hanya 3 tetes
larutanNaOH0,5Myangmengandungindikatorfenolftalein.Tutuptabungreaksidengangabusataualumuniumfoil
dan simpan di dalam penangas air bertemperatur 301
o
C. Ke dalam tabung reaksi, tambahkan hanya 3 tetes tert
butil klorida. Perhatikan waktu penambahan, goyangkan tabung untuk pencampuran, lalu simpan kembali dalam
penangasair.Catatwaktuyangdiperlukanuntukhilangnyawarnamerahmudadariindikator.

Perbandinganpelarut:air
50:50 60:40 70:30
mLpelarut 1,0 1,2 1,4
mLair 1,0 0,8 0,6
Pelarut Waktu
Etanol
Metanol
Aseton

IV.TugasPendahuluan(PreLab)
1. Dapatkah nbutilalkohol dan sekbutilalkohol diubah menjadi kloridanya dengan cara hanya mengocoknya
denganHClpekat?Jelaskan!
2. DiantaraHI,HBrdanHCl,manakahyanglebihmudahbereaksidenganalkoholmembentukhalidanya?
3. ApakahyangakanterjadibilatersbutilalkoholdipanaskandenganlarutanNaOH?Jelaskan!
4. Pada uji alkil halida di atas, jelaskan apakah reaksi SN
1
atau SN
2
yang terjadi ketika alkil halida direaksikan
denganNaIdalamasetondanreaksidenganlarutanAgNO
3
dalametanol?

Pustaka

Williamson,MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,1999,p.258264
Moore,J.A,andDalrymple,D.L.,ExperimentalMethodsinOrganicChemistry,2
nd
edition,Saunders:Philadelphia,
1976,p.139
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 52
Percobaan9AlkoholdanFenol:SifatdanReaksiKimia

SasaranPercobaan
Padaakhirpercobaanmahasiswadiharapkandapatmenjelaskanmengenai:
a. perbedaansifatsifatsenyawaalkoholdanfenol
b. jenisjenispereaksiuntukmembedakansenyawasenyawaalkoholdanfenol.

I.Pendahuluan
Hampir lebih dari 20 juta senyawa organik telah diketahui dan dipublikasikan di berbagai publikasi
internasional.Jikasetiapsenyawaharusdipelajarisebagaibagianyangtesendiri,makastudikimiaorganikhampirtak
mungkin dilakukan. Untungnya, ilmu kimi organik telah membagibagi senyawa organik berdasarkan konsep gugus
fungsi.Gugusfungsiadalahsuatuatomataukumpulanatomyangterikatbersamadengansuatucaratertentusebagai
bagiandarisuatumolekul,dankemudianmempengaruhikarakteristiksifatfisikdankimiamolekulsecarakeseluruhan.
Kelompok gugus fungsi yang akan dipelajari pada percobaan ini adalah gugus fungsi hidroksi (atau hidroksil), OH.
Gugus fungsi ini menunjukkan dominasinya di antara senyawasenyawa organik, karena begitu banyak dan beragam
senyawayangmemilikigugusfungsiini.
Gugusfungsiyangakandipelajaridalampercobaaniniadalahalkoholdan
fenol.Padaalkohol,gugusOHterikatpadaatomkarbontetrahedral.Jikagugus
OHterikatpadasatuatomkarbonyangmengikat3atomhidrogenmakaslkohol
tersebutadalahmetanol.JikakarbonyangmengikatOHterikatpadasatuatom
karbonlaindan2atomhidrogen,alkoholinidisebutalkoholprimer(1
o
).Jikaatom
karbonyangmengikatgugusOHterikatpada2atomkarbonlain,disebutalkohol
sekunder (2
o
) dan alkohol yang mengikat 3 atom karbon lain di samping gugus
OH disebut alkohol tersier (3
o
). Semua jenis alkohol ini memiliki beberapa
karakteristik yang sama di samping beberapa karakteristik lain yang berbeda
akibatperbedaandalamstrukturnya.Dalamfenol,gugusOHterikatpadakarbon
yang menjadi bagian langsung dari cincin aromatik. Alkohol dan fenol memiliki
kemiripan dalam beberapa hal, tetapi terdapat perbedaan yang cukup mendasar
sehinggakeduakelompoksenyawainidianggapsebagaikelompokgugusfungsiyangberbeda.Salahsatuperbedaan
utama adalah bahwa fenol bersifat jutaan kali lebih asam daripada alkohol. Penambahan sejumlah larutan natrium
hidroksidakedalamfenolakanmenyebabkangugusOHdalammolekulterdeprotonasi;halinitakakanterjadikepada
alkohol.

SifatFisik
Semakinbesarstruktursuatualkoholataufenol,makabiasanyatitikdidihnyasemakintinggi.Ketikaukuran
suatu alkohol bertambah besar, maka probabilitas alkohol menjadi berwujud padat semakin besar. Sebagian besar
senyawa fenol berwujud padat. Sebagian kecil alkohol larut dalam air karena gugus hidroksi pada alkohol dapat
membentuk ikatan hidrogen dengan molekul air. Namun ketika ukuran gugus alkil pada alkohol bertambah besar,
kelarutannya dalam air akan berkurang. Hal ini disebabkan oleh kemampuan gugus alkil yang dapat mengganggu
pembentukan ikatan hidrogen antara gugus hidroksi dengan air. Jika gangguan ini menjadi cukup besar, akibatnya
molekulmolekulairakanmenolakmolekulmolekulalkoholuntukmenstabilkankembaliikatanhidrogenantarmolekul
air. Jika gugus non polar (seperti gugus alkil) terikat pada cincin aromatik, maka kelarutan fenol dalam air akan
berkurang.Haliniyangmenjadialasanmengapagugusnonpolarseringdisebutsebagaigugushidrofob.

SifatKimia
Pada percobaan ini focus utamanya adalah reaksireaksi kimia yang dapat membantu dalam membedakan
alkoholdenganfenoldanantarasenyawasenyawaalkoholsendiri.

1.UjiLucas
Ujiinidilakukanuntukmembedakanalkoholalkoholprimer,sekunderdantersieryangdapatlarutdalamair.
Reagen Lucas merupakan suatu capuran asam klorida pekat dengan seng klorida. Seng klorida adalah suatu asam
Lewis,yangketikaditambahkankedalamasamkloridaakanmembuatlarutanmenjadilebihasam.Alkoholtersieryang
larutdalamairakanbereaksidenganreagenLucasdengancepatmembentukalkilkloridayangtaklarutdalamlarutan
berair.Pembentukanfasacairkeduayangterpisahdarilarutansemuladidalamtabungreaksisegerasetelahalkohol
beeaksi merupaka indikasi keberadaan alkohol tersier. Alkohol sekunder bereaksi lambat, dan setelah sedikit
pemanasan akan terbentuk fasa cair lapisan kedua, biasanya sekitar 10 menit. Alkohol primer dn metanol tidak
bereaksi pada kondisi ini. Pada alkohol tersier, atom klor biasanya terikat pada atom karbon yang sebelumnya
mengikat gugus OH. Pada alkohol sekunder, seringkali atom klor ini terikat pada atom karbon yang mengikat gugus
hidroksi,namunpenantaanulangdapatsajaterjadiyangmengakibatkanterikatnyaatomklortidakterjadipadaatom
karbonyangsebelumnyamengikatOH.
H
C OH H
H
metanol
H
C OH H
C
Alkohol 1
o
H
C OH C
C
Alkohol 2
o
C
C OH C
C
Alkohol 3
o
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 53

2.UjiAsamKromat(UjiBordwellWellman)
Alkohol primer dapat teroksidasi menjadi asam karboksilat dengan adanya asam kromat. Bilangan oksidasi
Cr
+6
pada asam kromat, yang berwarna merah kecoklatan, tereduksi menjadi Cr
+3
, yang berwarna hijau. Alkohol
sekunder teroksidasi menjadi keton oleh asam kromat. Alkohol tersier tidak dapat teroksidasi oleh asam kromat.
Oleh karena itu reaksi ini di satu sisi dapat membedakan alkohol primer dan sekunder, dan di sisi lain membedakan
alkoholprimerdansekunderdenganalkoholtrsier.Fenolbiasanyateroksidasimenjaditarberwarnacoklatolehasam
kromat.

3.UjidenganNatriumdanLarutanNaOH
Atom hidrogen dari gugus hidroksil dalam alkohol dan fenol dapat disingkirkan oleh natrium. Fenol lebih
asamdaripadaalkoholdandapatdiubahmenjadigaramnatriumbiladireaksikandenganlarutanNaOH,dangaramini
biasanyalarutdalamair.Berikutadalahreaksialkoholdengannatrium:
Alkoksidayangdihasilkanadalahbasakuat,yangbergunasebagaikatalisdalamreaksireaksiorganik.

4.KeasamanFenol
Sebagian besar fenol bersifat asam yang lebih lemah daripada asam karboksilat dan asam yang lebih kuat
daripadaalkohol.Ketikafenolbereaksidengansuatubasa,fenolakandiubahmenjadianionfenoksida,sehinggafenol
akan terlarut dalam larutan basa (sebagai garam fenoksida). Larutan natrium hidroksida dan natrium karbonat
merupakanbasayangcukupkuatuntukdapatmelarutkanhampirsemuafenolyangtaklarutdalamair,tetapilarutan
natrium bikarbonat tidak dapat. Tidak satu pun di antara basabasa tersebut yang cukup kuat untuk mengubah
sejumlahtertentualkoholmenjadiionalkoksida(yangakandapatmelarutkanalkoholyangtaklarutairdalambentuk
anionalkoksida).

Urutan kebasaan dari basabasa yang terdapat dalam persamaan reaksi di atas, mulai dari yang paling kuat ke yang
kurangkuat:natriumhidroksida,NaOH>natriumkarbonat,Na
2
CO
3
>natriumbikarbonat,NaHCO
3
.

5.UjiBesi(III)Klorida
Penambahan besi (III) klorida yang terlarut dalam kloroform (triklorometana) ke dalam suatu larutan fenol
dalam kloroform, menghasilkan suatu larutan berwarna ketika ditambahkan piridin. Berdasarkan struktur fenol,
warna produk yang dihasilkan dapat bervariasi mulai dari merah sampai ungu. Alkohol tidak menghasilkan warna
apapunterhadapujiini.
2 R-O-H + 2 Na 2 R-O
- +
Na

+ H
2
alkoksida
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 54

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja

A.KelarutanAlkoholdanFenol
DalamsetiappercobaanAndaakanmencobamembuatkirakira10%beratlarutanalkoholataufenoldalam
air (sangat polar) dan dalam heksana (non polar), untuk melihat apakah senyawa tersebut dapat larut dalam kedua
pelarutatautidak.
1. Beri label tabung reaksi Anda untuk setiap senyawa turunan alkohol dan fenol yang tersedia di laboratorium.
Masukkan 10 tetes (= ~0,5 mL = ~0,5 g) setiap senyawa ke dalam tabung reaksi masingmasing. Untuk fenol,
tambahkan 0,5 g. Dengan menggunakan gelas ukur 10 mL, tambahkan 4,5 mL (= 4,5 g) aqua dm ke dalam tiap
tabung.Goyangkantabunguntukpengadukanatauadukdenganbatangpengaduk.Catatapakahsenyawaterlarut
sempurna,terlarutsebagianatautaklarutdalamair.
2. Lakukanhalyangsamasepertidiatas,tetapisebagaipelaruttambahkan6,8mLheksana(~4,5g).Adukdanamati
kelarutannya.

B.UjiKimia
BerilabeltabungreaksiAndauntuksetiapsenyawaturunanalkoholdanfenolyangtersediadilaboratorium
ditambahsampelsenyawatakdikenal(diberikanolehasisten).

1.UjiLucas
Masukkan5tetestiapsampelkedalammasingmasingtabungsesuailabel.Tambahkan1mLreagenLucas.
Tutup tabung reaksi dengan gabus atau alumunium foil dan goyangkan dengan kuat untuk mengaduk campuran.
Setelahbenarbenartercampur,bukatutuptabungdanbiarkantabungbeberapasaat(sekitar5menit).Amatiapakah
terlihatkekeruhanataulapisankeduapadalarutan.Apabilaterdapattabungyanglarutannyamasihbening,masukkan
tabung tersebut ke dalam penagas air bersuhu 60
o
C selama 15 menit, kemudian amati apakah terdapat kekeruhan
atautidak.CatathasilpengamatanAnda.

2.UjiAsamkromat(UjiBordwellWellman)
Masukkan 5 tetes sampel ke dalam tabung reaksi masingmasing, lalu ke dalamya ditambahkan 10 tetes
aseton dan 2 tetes asam kromat. Tutup tabung reaksi, lalu aduk. Buka tutup tabung dan simpan tabung di dalam
penangasairbersuhu60
o
Cselama5menit.Amatiperubahanwarnayangterjadidancatatlahhasilnya.

3.UjidenganNatriumdanLarutanNaOH
a.Reaksidengannatrium
Tempatkan 2 mL dari masingmasing senyawa berikut dalam tabung reaksi: etanol, 1propanol, 2propanol,
dan fenol (bila fenol berbentuk kristal, panaskan sedikit supaya melebur). Tambahkan sepotong kecil logam Na ke
dalam tiaptiap tabung reaksi di atas. Catat hasilnya. Ke dalam larutan yang diperoleh, tambahkan beberapa tetes
fenolftalin,catat hasilnya.(hatihati, natrium sangat reaktif, reaksi dengan air bisa menimbulkan ledakan!!! Buang
bekashasilreaksikedalamwadahyangberlabelSisaNatrium!).

b.Reaksidenganalkali
Kedalamempattabungreaksimasukkanmasingmasing0,5mLsenyawa:nbutanol,sikloheksanol,fenoldan
2naftol.Tambahkan5mLlarutanNaOH10%kedalamtiaptiaptabungreaksi,adukdanamatihasilnya!

Perhatian!!
Asamkromatsangatkorosif!JikaAndaterkenazatini,segerabilasanggotatubuhAndayang
terkontaminasiolehairyangbanyak!Fenolsangatkorosif!Jikaadapadatanataularutanfenolyang
mengenaiAnda,segeracuciataurendambagianyangterkenadenganAntiFenol,kemudianbilaslahdengan
airyangbanyak!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 55
4.Keasaman
Masukkan5tetessampelkedalamtabungreaksi,lalutambahkanmasingmasing5tetesaquadm.Gunakan
batangpengadukkacauntukmengaduksampelkemudiansentuhkanujungbatangpengadukpadakertaspH.Setelah
15detik,bandingkanwarnakertaspHdengankertasskalapH.CatatpHtiapsampel.

5.UjiBesi(III)klorida
Masukkan10tetestiapsampelkedalamtabungreaksiberlabel,lalutambahkan10teteskloroformkedalam
tiaptabung.Tambahkanpula5teteslarutanbesi(III)kloridadalamkloroformkedalamtabungreaksi.Tambahkan2
tetespiridinkedalamtiaptabung.Aduktabungreaksi,amatidancatatyangterjadi.

6.Reaksifenoldenganairbrom
Ke dalam larutan 0,1 g fenol dalam 3 mL air, tambahkan air brom tetes demi tetes sambil digoncangkan
sampaiwarnakuningtidakberubahlagi.Amatihasilnya!

TUGASDILABORATORIUM:Berdasarkanujiujidiatas,Andaharusdapatmengidentifikasisampeltakdikenal(yang
akandiberikanolehasistenAnda),apakahsuatualkoholprimer,sekunder,tersierataufenol.

IV.TugasPendahuluan(PreLab)

1. Apakah kesimpulan umum yang dapat diambil mengenai kelarutan alkoholalkohol di dalam air? Jelaskan
manakahdari1pentanoldan1heptanolyangakanlebihsukarlarutdalamair?
2. TuliskanpersamaanreaksiyangmenunjukkankelarutanfenoldalamlarutanNaOH10%.Daripercobaandiatas,
jelaskanapakahsikloheksanollebihataukurangasamdaripadafenol?
3. Dari percobaan, jelaskan bagaimana membedakan secara kimia isopropil alkohol dari benzen, dan sikloheksanol
darifenol?
4. BagaimanareaksiLucasterhadap:
a. isobutanol
b. 1metilsiklopentanol
c. 2metilsiklopentanol
5. Diantara alkoholalkohol pada soal no.4, manakah yang tidak mengalami oksidasi pada pengujian Bordewell
Wellman?Tuliskanmasingmasingreaksinya!
6. Tuliskanpersamaanreaksiantarafenoldanairbrom!

Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.640642;653
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 56
Percobaan10EsterifikasiFenol:SintesisAspirin

SasaranPercobaan
Padaakhirpercobaanmahasiswadiharapkandapatmenjelaskandanterampildalammelakukansintesis
aspirindariasamsalisilat,sekaligusmenentukan%rendemenhasilsintesisdandapatmenentukankadaraspirindalam
suatusenyawamenggunakanmetodetitrasiasambasa.

I.Pendahuluan
Pada awal tahun 1800, seorang Egyptologist berkebangsaan Jerman
bernama Georg Ebers membeli papirus dari seorang pedagang jalanan Mesir.
Papirus Ebers, demikian kemudian dikenal, berisi koleksi resepresep obat
sebanyak 877 resep Mesir sejak 2500 SM. Di antara resep tersebut terdapat
sebuah rekomendasi campuran daun pohon myrtle, yang berdaun hijau dan
berbunga putih, untuk penyakit rematik dan sakit punggung. Hippocrates dari
Kos (sekitar 400 SM),yang sering dianggapsebagai Bapak Pengobatanmodern,
merekomendasikan ekstrak the dari kulit pohon willow untuk pengobatan
demam dan sakit penat. Sifat antipyretic (pereda demam) dan analgesic
(penghilangrasasakit)yangditemukandalamtanamaniniberasaldarisenyawa
salicin (dinamakan sesuai dengan nama Latin untuk pohon willow yaitu Salix),
yang diisolasi oleh Johann Bchner pada tahun1828 di University of Munich.
Salicin merupakankelompok senyawa yang dikenal sebagai glikosida. Glikosida
adalah senyawa yang memiliki bagian gula (glikosa) yang terikat pada bagian
nonglikosa (suatu aglikon). Aglikon dalam salisin adalah salicil alkohol yang
merupakan bentuk tereduksi sempurna dari asam salisilat. Pada tahun 1838,
Raffaele Piria, yang bekerja di Sorbonne Paris, memisahkan salicin menjadi
glukosa dan salisilaldehid melalui proses oksidasi dan hidrolisis. Kemudian
beliau mengubah salisilaldehid, secara oksidasi, menjadi suatu asam berwujud
kristal jarum tak berwarna, yang dinamakannya asam salisilat. Asam salisilat
memiliki sifat antipiretik dan analgesik; sayangnya, senyawa ini terlalu keras
terhadap bibir, kerongkongan dan perut. Pada tanggal 10 Agustus 1897, Felix
Hoffmann, seorang kimiawan dari pabrik kimia Bayer, membuat sampel asam
asetilsalisilatmurniuntukpertamakalinya,yangolehBayerdiberinamadagang
aspirin.Senyawainipunmemilikisifatsifatanalgesikdanantipiretik.Walaupun
aspirin lebih ringan terhadap perut daripada asam salisilat, namun dapat
menyebabkan perih lambung dan mual. Semenjak itu, aspirin telah digunakan
untuk membantu pencegahan penyakit stroke dan kelainan jantung. Hal ini
karena aspirin menghambat produksi prostaglandin, yang terlibat dalam
pembentukan zat beku darah dan penimbul rasa sakit. Dalam percobaan ini
Andaakanmencobamelakukansintesisaspirindariasamsalisilatdankemudian
menentukanrendemennya.

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
BagianI:PembuatanAspirin
1. Panaskanairdalamwadahpenangasair.
2. Timbangsekitar1,4gasamsalisilatdalamlabuErlenmeyer125mL.Tambahkan4mLanhidridaasamasetat
dengan cara sedemikian rupa sehingga dapat membilas serbuk asam salisilat yang menempel di dinding
wadah.
3. Tambahkan dengan hatihati (bekerjalah di ruang asam!) 5 tetes larutan 85% H
3
PO
4
. Aduk larutan dengan
batangpengadukkaca.
4. PanaskanlabuErlenmeyerberisicampuranreaksitersebutdalampenangasairyangairnyatelahdipanaskan
selama5menit.SebaiknyalabuErlenmeyerdipegangdenganklem.
5. Setelah5menit,angkatlabuErlenmeyerdaripenangasairdansegeratambahkan2mLaquadm.
6. Setelah 2 atau 3 m3nit, tambahkan lagi 20 mL aqua dm dan biarkan labu berisi campuran reaksi mencapai
suhukamardanmulaimengalamikristalisasi.Pastikanbahwakristaltelahterbentuksebelummelanjutkanke
tahap berikutnya. Anda dapat menggores dinding bagian dalam lagu dengan batang pengaduk kaca untuk
mempercepatpembentukankristal,jikakristaltakjugamuncul.
7. Tambahkan 50 mL aqua dm dingin dan dinginkan labu beserta isinya dalam wadah penangas berisi es
sehinggaprosespembentukankristalsempurna.
8. KumpulkankristalyangdiperolehmenggunakancorongBchneryangtelahdilapisikertassaring.Cucikristal
dengansedikitairdingin.
CH
2
OH
O glukosa
Salisin
CH
2
OH
OH
Salisil alkohol
C
OH
Salisilaldehid
O
H
C
OH
Asam
Salisilat
O
OH
C
O
AsamAsetilsalisilat
(Aspirin)
O
OH
C
O
CH
3
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 57
9. Lakukanrekristalisasiuntukmendapatkankristalyanglebihmurni,dengancaramelarutkankristalyangsudah
terbentuk dalam 5 mL etanol (hatihati alkohol mudah terbakar! Jauhkan dari sumber api!). Kemudian
tambahkan 20 mL air hangat. Panaskan larutan sampai semua kristal tepat larut, dan kemudian biarkan
larutandinginsampaikembaliterbentukkristal.SaringkembalikristaldengancorongBchner.
10. Timbang kristal yang terbentuk sesudah dikeringkan di udara. Kemudian hitung rendemen hasil krstal asam
asetilsalisilat (aspirin) yang diperoleh, dengan membandingkan berat hasil percobaan dengan berat hasil
teoritis(berdasarkanperhitunganstoikiometrik,sesuaipersamaanreaksidibawahini)

Perhitunganpersenrendemenadalahsebagaiberikut:
Hasil yang diperoleh dari percobaan
% Rendemen = x 100
Hasil teoritis berdasarkan stoikiometrik

BagianII:UjiterhadapAspirin
A.UjiReaksiPengkompleksandenganBesi(III)klorida,FeCl
3
1. Siapkan 3 buah tabung reaksi dan beri label masingmasing: asam salisilat, my aspirin yaitu hasil sintesis
yang Anda lakukan, dan komersial aspirin. Tempatkan masingmasing sejumlah sampel dalam tiap tabung
reaksisesuaidenganlabelnya.
2. Tambahkan20tetesaquadmkedalamtiaptabungdangoyangkanuntukmelarutkansampeldalamtabung.
3. Tambahkan 10 tetes larutan 10% FeCl
3
ke dalam tiap tabung. Amati perubahan warna larutan dan catat
hasilnya.Warnaungumenunjukkanadanyaasamsalisilatdalamsampel.

B.PenentuanTitikLelehAsamSalisilatdanAspirin
1. Siapkan dua tabung kapiler. Satu tabung kapiler diisi dengan sampel asam salisilat, tabung kapiler yang lain
diisidenganaspirinhasilsintesis.
2. Pasang salah satu tabung kapiler di lubang pada melting block, kemudian panaskan secara perlahan alat
meltingblock(lihatgambardisamping)diataspemanasbunsen.Janganlupapasangtermometerpadaalat
melting block. Amati perubahan suhu dan catatlah suhu awal ketika padatan kristal dalam tabung kapiler
mulaimeleleh.Catatpulasuhupadasaatsemuapadatantelahberubahseluruhnyamenjadicair.Keduasuhu
ini merupakan trayek titik leleh zat padat yang diukur. Ulangi pengerjaan ini pada tabung kapiler yang lain,
tapi alat melting block harus dibiarkan dingin kembali (suhu kamar). Titik leleh aspirin menurut literatur
adalah 136
o
C. Bandingkan hasil pengukuran titik leleh sampel aspirin Anda dengan data ini. Semakin kecil
trayek titik leleh, semakin murni sampel Anda. Semakin dekat hasil pengukuran titik leleh sampel Anda
dengandataliteratur,menunjukkansemakinbaikdantelitiAndabekerja.

C.AnalisisKandunganAspirindalamTabletAspirinKomersial.
1. Tempatkan dua tablet aspirin dalam sebuah labu Erlenmeyer 125 mL. Hancurkan tablet aspirin dengan
batang pengaduk kaca (atau hancurkan dulu kedua tablet, baru masukkan ke dalam labu Erlenmeyer).
Larutkan serbuk tablet aspirin dalam 10 mL etanol. Setelah larut seluruhnya,tambahkan3 tetes fenoftalein
danaquadmsecukupnyasehinggavolumetotallarutanmenjadi50mL.
2. lakukan titrasi menggunakan larutan baku NaOH 0,1 M sampai tercapai titik akhir titrasi, yaitu ketika terjadi
perubahan warna indikator dalam larutan. Catat volume NaOH yang digunakan. Hitung massa asam
asetilsalisilat(aspirin)pertablet.MenurutPeraturanFDA,kekuatantabletaspirinditentukanolehminimal5
grains asam asetilsalisilat (1 grain = 0.0648 gram). Aspirin (asam asetilsalisilat, HC
9
H
7
O
4
, bereaksi dengan
NaOHdenganperbandinganmol1:1,sehinggajumlahmolNaOHyangdigunakandalamtitrasisamadengan
jumlahmolaspirindalamtablet.ApakahtabletaspirinyangAndaanalisissesuaidenganperaturanFDA?

IV.TugasPendahuluan(PreLab)
1. Hitunglah hasil teoritis asam asetilsalisilat (dalam gram) berdasarkan persamaan reaksi yang terdapat dalam
modulpembuatanAspirin(kerapatananhidridaasetat=1,080g/mL)!
2. Jika Anda memperoleh produk hasil sintesis sebanyak 1,352 g, hitunglah persen rendemen aspirin! Berikan
penjelasanilmiahmengenaihasilnonidealini!
3. Jika Anda memperoleh produk hasl sintesis sebanyak 1,934 g, hitunglah persen rendemen aspirin! Berikan
pulapenjelasanilmiahterhadaphasilnonidealini!
4. Cisplatin[Pt(NH
3
)
2
Cl
2
],suatusenyawayangdigunakanuntukterapikanker,dibuatberdasarkanreaksiamonia
dengan kalium tetrakloroplatinat: K
2
PtCl
4
+ 2 NH
3
2 KCl + Pt(NH
3
)
2
Cl
2
. Berapa gram cisplatin yang akan
terbentukdari55,8gK
2
PtCl
4
dan35,6gNH
3
jikareaksiberlangsungdenganrendemen95%?

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 58
Pustaka
BorerL.L.,andBarry,E.(2000),ExperimentswithAspirin,journalofchemicaleducation.,77(3),p.354
Pasto, D., Johnson, C., Miller, M. (1992) Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,,p.485
Wilcox, C.F., and Wilcox, M.F. (1998), Experimental Organic Chemistry: A Small Scale Approach, PrenticeHall,
EngelwoodCliffs,NewJersey,p.485
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 59
Percobaan11PEMBUATANSIKLOHEKSANON

SasaranPercobaan
Setelah menyelesaikan percobaan ini mahasiswa dapat menjelaskan dan terampil dalam: 1) melakukan
oksidasi alkohol sekunder alisiklik; dan 2) memahami bahwa tidak hanya alkohol sekunder alifatik biasa saja yang
dapatdioksidasi,tetapijugaalkoholsekunderalifatik.

I.Pendahuluan
Pembuatan sikloheksanon ini adalah suatu contoh dari oksidasi alkohol sekunder alisiklik menjadi keton
alisiklikdenganoksidatorkaliumdikromatdalamsuasanaasam.

Walaupun reaksi oksidasi alkohol dengan Cr(VI) paling banyak digunakan, namun dari sudut pandang
lingkungan, senyawa Cr(VI) bersifat karsinogen pada sistem pernafasan dan produk tereduksinya, yaitu Cr(III), juga
berbahayadanberacunbagilingkungan,terutamakaludibuangbebaskeperairan.Olehkarenaitu,sebagaisalahsatu
alternatifyanglebihamanbagilingkungan,padapercobaaninioksidasialkoholsekundermenggunakanlarutan5,25%
(0,75 M) natrium hipoklorit, NaOCl, di samping lebih murah harganya dan mudah ditemui di pasaran bebas.
Mekanisme reaksi menggunakan natrium hipoklorit ini tidak begitu jelas. Tetapi yang jelas bukan merupakan reaksi
radikalbebas;reaksiakanberlangsunglebihcepatdalamsuasanaasamdaripadadalambasa;molekulklor,Cl
2
,yang
bertidak sebagai oksidator; dan asam hipoklorit harus ditambahkan dalam reaksi ini. Pada reaksi ini kemungkinan
dapat membentuk senyawa antara ester alkil hipoklorit, dan melalui reaksi eliminasi E
2
menghasilkan keton dan ion
klorida.Hipokloritberlebihdenganmudahdapatdihilangkandenganpenambahansenyawabisulfit;produkakhirnya
adalahionkloridayangjauhkurangtoksikdibandingkanCr(III).

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
A.SintesisSikloheksanaondariSikloheksanol
Ke dalam labu Erlenmeyer 250 mL di dalam ruang asam, masukkan 8 mL (0,075 mol) sikloheksanol.
Masukkan termometer, dan secara perlahan tambahkan ke dalam labu, sambil digoyangkan pelan, campuran 4 mL
asamasetatdengan115mLlarutanpemutihkomersial,misalnyaBayklin
(R)
(ataularutan5,25%beratNaOCldalamair,
0,75M).Larutanhipoklorityangdigunakanharuslahdalamkeadaansegar.

Penambahancampuraninibisadilakukan
denganmenggunakancorongpisahyangdiklempadaringnya.Hatihatijangansampaireagenmengenaikulitatau
mata Anda! Uji dengan kertas lakmus, dan kalau perlu tambahkan sedikit asam asetat sampai Anda yakin larutan
dalamsuasanaasam.Selamapenambahan,jagasuhusekitar4050
o
C.Siapkansebelumnyawadahberisiesuntuk
berjagajaga apabila suhu reaksi melewati 50
o
C, tapi jangan biarkan suhu menjadi di bawah 40
o
C, karena reaksi
oksidasi tidak berlangsung sempurna. Waktu penambahan campuran reaksi berkisar antara 15 20 menit.
Goyangkan Erlenmeyer secara berkala selama 20 menit berikutnya agar reaksi berlangsung sempurna (total waktu ~
40 menit). Tambahkan beberapa tetes indikator timol biru ke dalam campuran reaksi, dan secara perlahan sambil
digoyangkan,tambahkan1520mLlarutanNaOH6Msampailarutannetral(ditunjukkandenganperubahanwarna
indikator). Pindahkan campuran reaksi ke dalam labu bundar 250 mL, tambahkan batu didih atau masukkan batang
pengaduk magnet lalu lakukan pengadukan, dan lakukan distilasi sederhana dalam penangas air, sampai tidak ada
sikloheksanon yang keluar bersamasama air (perhatikan suhu; sebanyak 40 mL distilat seharusnya terkumpul yang
terdiridaridaridualapisan,lapisanairdanlapisansikloheksanol(organik)).Masukkandistilatkedalamcorongpisah
yang bersih. Jenuhkancampuran reaksi (distilat) dengangaram NaCl (bersih) kirakira diperlukan10g kemudian
tambahkan1520mLpelaruteter,pisahkanlapisansiklohesanon(atas)daricorongpisah.Lakukanekstraksidengan
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 60
2x15mLeter.Kumpulkanfraksisikloheksanondalameter,tambahkan3gnatriumataumagnesiumsulfatanhidratke
dalam lapisan sikloheksanon (?). Saring larutan kering ini ke dalam labu distilasi kecil, keluarkan pelarutnya (eter)
dengan cara distilasi di atas penangas air (tanpa api! Ingat: Eter mudah sekali terbakar!!). Akhirnya, residu
sikloheksanon didistilasi di atas penangas udara atau langsung di atas pemanas listrik. Kumpulkan fraksi didih pada
154156
0
C.Tentukankemurniannyadenganmengukurindeksbiasnya.Daridataini,hitunglah%rendemennya!

SimpansebagiansikloheksanonuntukPercobaan12!

B.OksidasiSikloheksanonmenjadiAsamAdipat
Masukkan 2,5 g sikloheksanon dan 7,7 g KMnO
4
dalam labu Erlenmeyer 250 mL, tambahkan 32 mL air, lalu
goyangkan.Pertahankansuhusampai30
o
C,sampaitidakadalagikenaikansuhu,kemudiantambahkan1mLlarutan
NaOH3M.Kenaikansuhudiamatipadatermometer.Padasaatsuhumencapai45
o
C(15menit),pelankanlajuproses
oksidasidenganpendinginanlabudalamairessebentar,jagasuhupada45
o
Cselama20menit.Tunggusampaiada
sedikit kenaikan suhu (47
o
C) dan suhu turun kembali (25 menit). Kemudian panaskan campuran reaksi sambil
digoyangkan di atas pemanas untuk menyempurnakan reaksi dan mengendapkan mangan dioksida (warna coklat).
Jika permanganat masih ada, tambahkan sedikit natrium bisulfit. Kemudian saring campuran reaksi dengan
pengisapan(corongBuchner),cuciendapancoklatdengansedikitair.Pindahkanfiltratkedalamgelaskimia100mL,
tambahkanbatudidihkedalamfiltratdanuapkanpelarutdiatasapisampaivolumemencapai8mL.Apabilalarutan
masih berwarna, tambahkan sedikit karbon aktif, lalu saring kembali, cuci dengan sedikit air. Filtratnya diuapkan
kembali sampai volume sekitar 8 mL. Asamkan larutan dengan penambahan HCl pekat sampai pH 1 2 (gunakan
kertaspHuniversal),tambahkansedikitasamberlebihsampaiterbentukkristal.SaringkristaldengancorongBuchner,
cucidengansedikitairdingin/es,biarkanmengering.Tentukantitiklelehasamadipat(t.l.152153
o
C),beratsekitar
0,875g.

IV.TugasPendahuluan(PreLab)

1. BagaimanakahAndabisamenerangkanbahwareaksidiatasadalahsuatureaksiredoks?
2. Apakahsebabnyasuhureaksitidakbolehlebihdari60
o
C?
3. Daricarakerjadiatas,sebutkandanjelaskantigamacamteknikpemisahanpercobaankimiaorganik!
4. Tuliskanmekanismereaksioksidasisikloheksanolmenjadisikloheksanonmenggunakanoksidatordikromat,Cr(VI)!
Jelaskanperubahanbilanganoksidasimasingmasingspesinya!
5. Tuliskanreaksioksidasisikloheksanolmenjadiasamadipat!Jelaskanbeberapacaraidentifikasiyangmembedakan
sikloheksanondanasamadipat?

Pustaka

Pasto, D., Johnson, C., Miller, M., Experiments and Techniques in Organic Chemisty, Prentice Hall Inc., New Jersey,
1992,p.438439
Williamson,MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,1999,p.302314
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 61
Percobaan12AldehiddanKeton:SifatdanReaksiKimia

SasaranPercobaan
Padaakhirpercobaanmahasiswadiharapkandapatmenjelaskanmengenai:
1. perbedaansifatsifatsenyawaaldehiddanketon
2. jenisjenispereaksiuntukmembedakansenyawasenyawaaldehiddanketon.

I.Pendahuluan
Aldehid dan keton memiliki gugus fungsi karbonil (C=O), yaitu atom karbon yang berikatan rangkap dua
denganoksigen.Padaketon,terdapat2atomkarbonlainyangterikatpadaguguskarbonil.Karbonyangterikatpada
gugus karbonil dapat merupakan rantai alifatik (bukan merupakan bagian dari cincin aromatik) atau aromatik
(merupakan bagian dari cincin aromatik). Aldehid dan keton samasama mengalami reaksi yang disebut adisi
nukleofilik.Padakondisikurangasam,padareaksiinisuatunukleofil(suatuspesiyangdapatmendonorkansepasang
elektron, atau disebut sebagai basa Lewis) memberikan pasangan elektronnya kepada karbon karbonil untuk
membentuk suatu ikatan tunggal seiring dengan bergeraknya sepasang elektron pada ikatan rangkap menjadi
sepasangelektronbebaspadaoksigen.Akibatnya,oksigendapatmengambilsebuahprotondaritempatlain(bisajadi
dari salah satu yang terikat pada atom nukleofil yang menyerang karbon karbonil) dan menjadi gugus OH. Pada
kondisiyanglebihasam,hasilnyasama,namunpadakondisiinisebuahproton(darisuatuasam)mengikatkandiripada
salah satu dari pasangan elektron bebas pada oksigen. Gugus karbonil sekarang bermuatan + 1 dan dapat
mengundang nukleofil yang lemah sekalipun (nukleofil kuat tidak dapat berada di dalam larutan yang sangat asam
karenanukleofilkuatbiasanyamerupakanbasayangkuatdantakbisaberkeliaranbebasdidalamlarutanasam).Jadi,
ketika nukleofil menyerang karbon karbonil dan membentuk ikatan, maka ikatan rangkap pada karbonil berubah
menjadigugusOH.Keduakondisireaksitersebutdapatdilihatpadareaksiberikut.

Kondisipertamadalamlarutanyangsedikitasam:reaksi2,4dinitrofenilhidrazindenganaseton.

aseton
H
3
C
C
O
CH
3
2,4-dinitrofenilhidrazin
HN
H
2
N
N
+
O
O
-
N
+
O
O
-
+
HN
N
NO
2
O
2
N
C
O
CH
3
H
3
C
H
H
H
N N NO
2
O
2
N
C
OH
CH
3
H
3
C
H
Reaksi adisi nukleofilik
2,4-dinitrofenilhidrazin
pada aseton. Tanda
panah lengkung
menunjukkan
pergerakan elektron
ketika ikatan terbentuk
dan putus.

Padareaksidiatasdapatdilihatbahwaterkadangprodukyangdihasilkantidakselaluyangdapatdiisolasi.Produkini
dapatmengalamireaksieliminasidenganmelepaskangugusOHyangtelahterbentuk,kemudianatomhidrogenpada
nitrogen lepas dan terbentuklah ikatan rangkap antara C dan N disertai pelepasan molekula air. Produk akhirnya
seringdikenalsebagai2,4dinitrofenilhidrazon.
H
N N NO
2
O
2
N
C
OH
CH
3
H
3
C
H
+ H
3
O
H
N N NO
2
O
2
N
C
O
CH
3
H
3
C
H
H H
H
N N NO
2
O
2
N
C
CH
3
H
3
C
H
H
2
O
H
N N NO
2
O
2
N
C
CH
3
H
3
C
- H
3
O
- H
2
O

Perhatikanbahwaasam,H
3
O
+
,dibutuhkansebagaikatalisuntukreaksipertamadiatasyangakanmembentukmolekul
airpadatahappertama.Padatahapkedua,molekulairyangkeduadihasilkan,namunmolekulairiniterprotonasidan
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 62
membentuk H
3
O
+
pada tahap ketiga, sehingga secara keseluruhan hanya dihasilkan satu molekul air. Ini adalah ciri
H
3
O
+
sebagaikatalis,mempercepatlajureaksitetapitidakikutterpakaihabisdalamreaksi.

Kasuskeduadalamlarutanyanglebihasam:reaksimetanoldenganasetaldehid.

Padatahappertamamekanisme,katalisasam,H
3
O
+
,memprotonasioksigenpadaguguskarbonilsehinggamuatannya
+1.Padatahapkedua,protonatesoksigenpadametanolyangbersifatsebagainukleofillemahmendonorkansepasang
elektronnya kepada karbon karbonil membentuk ikatan baru. Pada tahap ketiga, hemiasetal yang terprotonasi
memberikan proton pada molekul air yang terbentuk pada tahap pertama membentuk ion hidronium. Reaksi ini
dikatalisis oleh asam. Jika asetaldehid tidak diprotonasi oleh asam pada tahap pertama, reaksinya dengan metanol
akan berlangsung sangat lambat karena metanol adalah nukleofil lemah. Hemiasetal, produk yang terbentuk dari
reaksi antara alkohon dengan aldehid atau keton, berperan penting dalam kimia karbohidrat. Gula, adalah senyawa
polihidroksialdehiddanketon,sehinggagulamemilikiduagugsfungsi(karbonildanhidroksi)yangdapatbereaksisatu
sama lain membentuk hemiasetal. Hemiasetal ternyata dapat bereaksi dengan alkohol menghasilkan senyawa yang
disebutasetal.Asetalmemilikisuatukarbontetrahedralyangterikatterikatpada2atomoksigen,dimanakeduaatom
oksigeninimasingmasingterikatpadaatomkarbonyanglain.Reaksiinijugapentingdalamkimiakarbohidrat.
Mekanismemanapunyangsebenarnyaberlangsung,reaksiinibiasanyasecaraumumdikatakansebagaireaksi
adisinukleofilik.
Aldehid dapat dioksidasi oleh asam kromat, sedangkan keton tidak. Ketika aldehid teroksidasi, akan terjadi
perubahan warna dari coklat kemerahan menjadi hijau, karena kromat tereduksi menjadi Cr +3. Inilah yang
membedakanaldehiddariketon.

R C H
O
Aldehid
+ 2 H
2
CrO
4
+ 3 H
2
SO
4
3
+ Cr
2
(SO
4
)
3
+ 5 H
2
O
Cr
3+
hijau
R C OH
O
asam karboksilat
asam kromat
coklatjingga
3

Gugus fungsi lain, seperti alkohol primer dan sekunder juga dapat teroksidasi oleh asam kromat. Aldehid juga dapat
teroksidasiolehreagenTollens,suatuzatyangmengandungAg
+
.Ionperakakantereduksimenjadilogamperak.Ion
logam adalah pengoksidasi yang lemah; aldehid sangat mudah teroksidasi dan hasilnya akan terbentuk logam perak
hasilreduksidariionAg
+
.

Senyawa metil keton, tetapi bukan koton yang lain, akan teroksidasi oleh iod di dalam larutan natrium hidroksida.
Metil keton akan teroksidasi menjadi asam karboksilat; juga akan terbentuk iodoform yang berwarna kuning, yang
menjadi indikasi uji yang positif. Asetaldehid, tetapi bukan aldehid yang lain, akan memberikan hasil positif juga
terhadap uji ini, karena memiliki kemiripan dalam struktur dengan metal keton. Di samping itu, etanol (teroksidasi
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 63
menjadiasetaldehid)danalkoholsekunderyangdapatteroksidasimenjadimetalketondapatjugamemberikanhasil
positifterhadapujiini.

II.Peralatandanzat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja

Untuk uji1 sampai dengan4,beri label 5buah tabung reaksi Andadengan senyawaturunanaldehid danketon yang
tersediadilaboratoriumditambahdengansampelzattakdikenalyangdiberikanolehasisten.Untuktiapujiberikut,
mulailahdengan5tetessetiapsampelyangakandiujididalamtabungreaksi.

1.UjiAsamKromat
Tambahkan4teteslarutanasamkromat,goyangkantabung,lalubiarkanselama10menit.Perhatikanterjadi
tidaknyaperubahanwarnadancatatberapalamaperubahanituterjadi.

2.UjiTollens
SiapkanreagenTollensdidalamlabuErlenmeyer25mLdenganmencampurkan5mLlarutanperaknitrat9%
dalam5mLlarutanNaOH10%.Terhadapcampuranreaksi,tambahkanlarutanamoniak10%tetesdemitetessambil
digoyang,sampaiterbentukendapancoklatdariperakoksidamulaimelarut;janganmenambahkanamoniakberlebih!
(DibuatolehAnalis)
Larutkan 5 tetes senyawa yangtelahada di dalam tabung reaksidengan bis(2etoksietil)eter secaratetes demi tetes.
Lalutambahkan2mLreagenTollens,kemudiantabungdigoyang/diaduk.Tempatkantabungreaksididalampenangas
air 60
o
C selama 5 menit. Uji positif bagi aldehid adalah terbentuknya cermin perak pada tabung reaksi (jika tabung
reaksi bersih); jika tabung reaksinya kotor, akan terbentuk endapan hitam. Catat pengamatan Anda! Cuci tabung
reaksisegeradenganasamnitrat1M,lalubilasdenganairyangbanyak.

3.UjiIodoform
Ke dalam tiap tabung reaksi yang mengandung sampel yang akan diuji, tambahkan 2 mL air, lalu goyang
tabung reaksinya. Jika senyawanya tak larut, tambahkan dioksan tetes demi tetes sambil diaduk sampai campuran
homogen. Tambahkan 2 mL larutan NaOH 6 M. Aduk. Kemudian tempatkan tabung reaksi di dalam penangas air
60oCselama3atau4menit,dansambiltabungreaksimasihdidalampenangasair,tambahkanlahlarutanI
2
/KItetes
demitetessambildigoyang/diaduk(untukhalini,keluarkansebentartabungreaksi,lalumasukkankembalikedalam
penangas), sampai warna coklatnya bertahan selama 2 menit di dalam tabung. Tambahkan larutan NaOH 6 M tetes
demitetessambildigoyang,sampaiwarnacoklatmenghilang.Tetapsimpantabungreaksidalampenangasairselama
5menit.Lalukeluarkantabungreaksidaripenangasdanamatiisinya,apakahterdapatendapankuningdariiodoform,
yangmenunjukkankeberadaanasetaldehidatausuatumetalketon.Catathasilnya.

4.Uji2,4Dinitrofenilhidrazin
Tambahkan 20 tetes 2,4dinitrofhenilhidrazin ke dalam setiap tabung reaksi yang mengandung sampel yang
diuji.Jikaendapantidaksegeramuncul,panaskanselama5menitdidalampenangasair60
0
C.Catathasilpengamatan
Anda.

TUGAS DI LABORATORIUM: lakukan identifikasi sampel tak dikenal yang Anda uji, berdasarkan data yang Anda
peroleh,apakahsenyawatersebuttermasukaldehidatauketon,berikanpenjelasannya!

Perhatian!!
Asamkromatsangatkorosif!JikaAndaterkenazatini,segerabilasanggotatubuhAndayangterkontaminasi
olehairyangbanyak!SegeracucitabungreaksiAndadenganairyangbanyaksetelahselesaimelakukanuji
Tollens,jangandibiarkanbegitusajadalamwaktulamakarenadapatmenimbulkanledakan/letupan!
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 64
IV.TugasPendahuluan(PreLab)

1. Tulispersamaanreaksiuntukreaksireaksiberikut:
a.reaksiTollensdenganformaldehid d.pembuatanbenzaldehidfenilhidrazon
b.reaksiFehlingdenganheptaldehid e.pembuatansikloheksanoloksim
c.pembuatansenyawaadisiasetonbisulfitf.pengujianiodoformterhadap2pentanon
2. Tulismekanismereaksikondensasiasetondenganbenzaldehidyangdikatalisadenganbasa!
3. Dapatkahpengujianiodoformmembedakan:metanoldarietanol,dan
isopropanoldarinbutanol?Jelaskan.
4. Apakahperanandarinatriumasetatdidalampembuatanoksim?

Pustaka
Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.642643
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 65
Percobaan13REAKSISIKLOADISIDIELSALDERDANRETRODIELSALDER

SasaranPercobaan
Padaakhirpercobaanmahasiswaharusdapat:
1. menjelaskanprinsipreaksisikloadisi.
2. melakukanpemisahandanpemurnianadduct,danujikemurniannya
3. melakukananalisisspektroskopiUV,IRsenyawaadductdibandingkandenganreagenawal.

I.Pendahuluan
Satudarireaksisintesisyangpalingmenarikdarisenyawatakjenuhadalahadisi1,4daridienaterkonyugasi
terhadap molekul yang mengandung ikatan etilen atau asetilen aktif (dienofil), membentuk adduct yang memiliki
cincin lingkar 6 tak jenuh, melalui sikloadisi 4 + 2. Proses siklisasi ini dikenal dengan reaksi DielsAlder yang meliputi
bidangyangsangatluasdandigunakanuntuksintesisobatobatpenting,insektisida,turunanterpen,danintermediet
untukbahanbahankimiaindustri.

CH
2
CH
2
C H
3
H COOH
COOH
H
H
COOH
COOH C H
3
H
H
H
+

Diena Dienofil Adduct

Reaksi DielsAlder adalah stereospesifik. Hampir semua diena akan melakukan reaksi DielsAlder. Dienofil
yang paling spesifik adalah senyawa o,|unsaturated karbonil dan nitril. Dienofil aktif adalah reagen yang berguna
untuk mendeteksi adanya sistem diena terkonjugasi dan untuk maksud analitik. Adduct DielsAlder berguna dalam
penetapan struktur dari1,3dienadan karakterisasi diena yang diketahui. Dengandiena siklik seperti siklopentadiena
danjugaturunanfuran,produksikloadisi4+2dapatmemilikiduakemungkinankonfigurasi.Sistemcincindaridienofil
dapat memiliki hubungan disposisi trans (endo) atau cis (exo) terhadap jembatan metilen (oksigen) yang terbentuk.
PadaumumnyakonfigurasiendolebihdisukaidalamreaksiDielsAlder.
O
O
O
O
O
O
H
H
O
O
O
H
H
+ +

EndoExo

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.CaraKerja
A.ReaksiDielsAlder
Ke dalam labu bundar 100 mL masukkan 3 g antrasen, 8 g anhidrida maleat dan 50 mL benzen kering.
Lakukan refluks dengan penangas uap selama paling sedikit 1 jam. Dinginkan larutan dan saring hasil reaksi dengan
penyaringanvakum.Kristalyangterkumpuldirekristalisasidenganetilasetat.Kristalmemilikititikleleh262
o
263
o
C.
Tentukanrendemendantitiklelehnya.

B.ReaksiRetroDielsAlder
Hasil DielsAlder yang telah dimurnikan digerus dalam mortar dengan 1 g soda lime (?). Campuran yang
terbentukdimasukkankedalamgelaskimia100mL,yangdiatasnyaditempatkanlabubundar250mLyangberisiair
dingin. Kemudian campuran dipanaskan di ruang asam sehingga antrasen menyublim. Kumpulkan dan timbang
antrasen yang menyublim. Tentukan titik lelehnya. Bandingkan titik leleh dan wujud hasil ini dengan titik leleh dan
wujudantrasensemula.

C.PenentuanstrukturDielsAlderAdduct
Tentukan spektrum UV dan IR antrasen dan DielsAlder adduct dalam etanol. Kesimpulan apa yang dapat
andatarikdarispektrumyangdiperoleh?

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 66
IV.TugasPendahuluan(PreLab)

1. Gambarkan reaksi dan struktur adduct DielsAlder yang terbentuk dari sikloadisi 4+2 dari senyawasenyawa:
(a). etil propunoat dan 2etoksi1,3butadiena; (b). 2,5dimetilfuran dan akrilonitril; (c). 1,4dimetoksi1,3
butadienadan1,4naftakuinon.
2. Caridantuliskandienadandienofilyangpalingreaktifdanjelaskanmengapabersifatdemikian!
3. Dari diena dan dienofil yang anda peroleh pada no.(2), tuliskan reaksi sikloadisi DielsAlder yang mungkin
terjadi!
4. GambarkanstrukturdimmeryangterbentukmelaluiselfadditiondarireaksisikloadisiDielsAlder4+2berikut
:(a)isoprene;(b).siklopentadiena;(c)akrolein.

Pustaka
Pasto, D.J., Johnson, C.R., Miller, M.J., Experimental Organic Chemistry, Prentice Hall, Engelwood Cliffs, New Jersey,
1992,p.483
Wilcox,C.F.danWilcox,M.F.,ExperimentalOrganicChemistry.ASmallScaleApproach,PrenticeHall,Englewood
Cliffs,NewJersey,1998,p.428
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 67
Percobaan14ISOLASIETILpMETOKSISINAMATDARIKENCUR
(KaemferiagalangaL.)DANSINTESISASAMp
METOKSISINAMAT:SintesisTurunannyadanPenetapan
Struktur

Sasaranpercobaan:
Setelahmelakukanpercobaaninimahasiswaharusdapat:
1. Menjelaskanprinsipdasardanteknikisolasidengancaraperkolasi.
2. Melakukanpemisahandanpemurnianhasilisolasidaribahantumbuhan.
3. MahirdalammenganalisisdataspektroskopiUV&IRdandatafisiksenyawayangdihasilkandibandingkanstandar.

I.Pendahuluan
Kencur (Kaemferia galanga L.) merupakan tanaman tropis yang banyak tumbuh di kebun dan pekarangan,
digunakan sebagai bumbu dapur dan termasuk salah satu tanaman obat tradisional Indonesia. Senyawa kimia yang
terkandung didalamnya antara lain etil pmetoksi sinamat (II) sebagai komponen utama, etil sinamat (I), p
metoksistiren(III)dll.Kadaretilpmetoksisinamatdalamkencurcukuptinggi(tergantungspesiesnya)bisasampai10
%,karenaitudenganmudahbisadiisolasidaribagianumbinyamenggunakanpelarutpetroleumeteratauetanol.
OC
2
H
5
O
(I)
OC
2
H
5
O
(II)
H
3
CO
H
3
CO
(III)

Salah satu reaksi yang mudah dilakukan terhadap etilpmetoksi sinamat adalah menghidrolisisnya
menghasilkanasampmetoksisinamat.Sedangkantransformasigugusesterdapatdilakukanmelaluihalidaasamyang
jauhlebihreaktifuntukditransformasikanmenjadiguguslainyangditargetkan.

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.CaraKerja
A.Isolasietilpmetoksisinamat
Ke dalam labu bundar 250 mL masukkan sekitar 15 g serbuk kencur, kemudian tambahkan sekitar 100 mL
heksana hingga selapis heksana terdapat di atas permukaan serbuk kencur. Pasang kondensor refluks pada labu
bundar dan lakukan refluks dalam penangas air selama 30 menit. Saring campuran kencur yang telah direfluks ke
dalamlabubundar100mL,lakukandistilasisederhanaterhadapfiltratdalamlabubundartersebutdalampenangasair
sampaitersisasekitar10mLlarutandalamlabu.Dinginkanlabupadasuhukamarhinggaterbentukkristalberwarna
putih,jikabelumterbentukkristaljuga,dinginkanlabudalampenangases.Saringpadatankristalputihyangterbentuk
dengancorongBuchner.Timbangkristaldanhitungrendemennya.Rekristalisasidilakukandalampetroleumeteratau
nheksana,kemudiandiukurtitiklelehnyadanbandingkandenganliteratur.(Lit.4850
o
C)


B.Hidrolisisetilpmetoksisinamat
2,5gEtilpmetoksisinamatdilarutkandalam5mletanoldalamlabubundar100mL.Tambahkan1,25gNaOH
dan20 mLair, campuran reaksi direfluks selama 30 menit kemudian dinginkan dalamsuhukamar. Netralkandengan
HCl encer menghasilkan kristal putih, saring dengan corong Buchner dan kristal yang diperoleh dicuci dengan air.
Rekristalisasidilakukandenganpelarutmetanol.ukurtitiklelehnyadanbandingkandenganliteratur(Lit.174
o
C).

C.Pembuatanasamsinamat
Panaskancampuranyangterjadidari2gbenzaldehid,3gasammalonat,6mLpiridindan4tetespiperidin,di
dalam penangas air selama 1 jam. Selama pemanasan ini karbondioksida akan dibebaskan. Pendidihan campuran
tersebutdilanjutkanselamabeberapamenit.Dinginkandantambahkankedalamnya40gbutiranesdan20mLlarutan
HCl5M.Saringhasilreaksi,cucidenganairesdanrekristalisasidenganairatauetanolataucampuranairetanol.Ukur
titiklelehsertaspektrumUVdanIRnya.

D.Pemeriksaankromatografilapistipis(KLT)
Sampelkristalhasilisolasidanhasilhidrolisismasingmasingdilarutkandalampetroleumeterataunheksan,
menggunakankapilertotolkanpadapelatKLTukuran2x5cm,padajarak0,5cmdaribawah,gunakanetilpmetoksi
sinamat dan asam pmetoksi sinamat standar sebagai pembanding. Masukan dalam chamber yang telah dijenuhkan
dengan eluen kloroform, pengamatan bercak dilakukan dengan melihatnya dibawah lampu UV atau dimasukkan
kedalamchamberiodium.HitungRfdanbandingkandenganstandar.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 68
TUGASDILABORATORIUM:
1. Kristal hasil isolasi dan hasil hidrolisis masingmasing dilarutkan dalam metanol kemudian dibuat spektrum
ultravioletnyapadadaerahpanjanggelombang200350nm.
2. KristalhasilisolasidanhasilhidrolisisdibuatpeletdenganKBrkering,kemudiandibuatspektruminframerahnya.

IV.TugasPendahuluan
1. Cariinformasimengenaisenyawasenyawayangdapatdiisolasidaritumbuhankencurbesertamanfaatyang
sudahdiketahui!
2. Tuliskancaracaratransformasisenyawasenyawayangdapatditurunkandariminimal3senyawahasilisolasi
kencur!
3. Cari dan lampirkan spektrum UV dan IR standar dari etilpmetoksisinamat. Jelaskan analisis anda terhadap
spektrumtersebut!

Pustaka
Skripsi,Tesis,DisertasimengenaiisolasisenyawasenyawadaritumbuhanKaempferiagalangaL.
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 69
Percobaan15IsolasiKafeindariTeh

Sasaranpercobaan:
Setelahmelakukanpercobaaninimahasiswaharusdapat:
1. Menjelaskanprinsipdasardanteknikisolasidengancaraekstraksi.
2. Melakukanpemisahandanpemurnianhasilisolasidaribahantumbuhan.
3. MahirdalammenganalisisdataspektroskopiUV&IRdandatafisiksenyawayangdihasilkandibandingkanstandar.

I.Pendahuluan
Kafeinadalahsenyawayangtermasukdalamgolonganalkaloid.Alkaloidadalahsenyawayangmengandung
atom nitrogen dalam strukturnya dan banyak ditemukan dalam tanaman. Senyawa alkaloid umumnya memiliki rasa
pahit dan seringkali memiliki sifat fisilogis aktif bagi manusia. Beberapa senyawa yang termasuk alkaloid dan sering
Anda dengar di antaranya: nikotin, morfin, striknin dan kokain. Senyawa ini di dalam tumbuhan peranannya bisa
bermacammacam, di antaranya sebagai pestisida, misalnya nikotin dalam tembakau bisa digunakan sebagai
insektisida. Struktur kafein (Gambar 1) terbangun dari sistem cincin purin, yang secara biologis penting dan di
antaranyabanyakditemukandalamasamnukleat.

Gambar1StrukturKafein

Kafeindapatdicernaolehmanusia.Tabel2menunjukkanbeberapasampelyangmengandungkafein.Kafein
bertindak sebagai stimulant, yang dapat menstimulasi kerja jantung, pernafasan, sistem syaraf pusat dan sebagai
diuretik. Kafein dapat menyebabkan kegelisahan, insomnia dan sakit kepala dan secara fisik bersifat sebagai candu.
Seseorangyangmeminum4cangkirkopiperharidapatmengalamisakitkepala,insomniadankemungkinannausea.
Kafein cukup banyak terkandung dalam teh. Teh telah dikonsumsi sebagai minuman selama hamper 2000
tahun,dimulaidiCina.Minumaninidibuatdenganmenyeduhdaundankuncupmudapohonteh,Camelliasinensis,di
dalam air panas. Sekarang, terdapat dua varietas utama pohon teh yang digunakan, yaitu pohon teh Cina berdaun
kecil(C.sinensissinensis)danpohontehAssamberdaunlebar(C.sinensisassamica).Hibriddarikeduavarietasinijuga
elah dibudidayakan. Daun teh bisa difermentasi ataupun tanpa fermentasi sebelum digunakan. Daun teh yang
difermentasi sering disebut teh hitam, sedangkan daun teh yang tidak difermentasi disebut teh hijau, dan dauh teh
yang difermentasi sebagian disebut teh oolong. Daun teh sebagian besar mengandung selulosa, suatu polimer dari
glukosa (monomer dari selulosa, disebut monosakarida) yang tak larut dalam air. Selulosa di dalam tumbuhan
berfungsi hampir sama dengan serat protein dalam hewan, yaitu sebagai material pembangun struktur tanaman. Di
sampingselulosa,didalamdauntehterdapatbeberapasenyawalain,termasukkafein,tannin(senyawafenolik,yaitu
senyawayangmemilikisuatugugusOHyangterikatpadacincinaromatik)dansejumlahkecilklorofil.

Tabel1KandunganKafeindalambeberapasampel
Kopi 80 125mgpercangkir
Kopi,decaf 24mgpercangkir
Teh 30 75mgpercangkir
Kokoa 5 40mgpercangkir
Susucoklat 6mgperons
Coklatkue 35mgperons
CocaCola 46mgper12ons
Excedrin,extrastrength 65mgpertablet
NoDoz 100mgpertablet

Tujuandaripercobaaninidiantaranyaadalahuntukmengekstrakmaterialyanglarutairdidalamdauntehke
dalamairpanas.[Kelarutankafeindalamairadalah22mg/mLpada25
o
C;180mg/mLpada80
o
C,dan670mg/mLpada
100
o
C]. Kemudian larutan panas dibiarkan dingin dan kafein diekstraksi dari air dengan diklorometana (metilen
klorida), yangmerupakanpelarut organikyang tak larut air. Karena kelarutan kafeindalam diklorometana lebihbaik
(140mg/mL)daripadadalamair(22mg/mL),makakafeinlarutdenganmudahdidalamdiklorometana.Namun,tannin
juga sedikit larut dalam diklorometana, padahal kafein yang diekstraksi sebaiknya dapat dipisahkan dari kandungan
tannin, jadi tannin harus tetap berada dalam fasa air. Oleh karena tannin merupakan senyawa fenolik yang bersifat
cukup asam, maka senyawa ini dapat diubah dulu menjadi garam (deprotonasi gugus OH) menggunakan natrium
karbonat,sehinggatanninberubahmenjadianionfenolikyang tidaklarutdalamdiklorometana,tetapilarutdidalam
air. Namun ada kekurangan dari pengubahan tannin menjadi garamnya, yaitu garam tannin ini berfungsi sebagai
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 70
surfaktan anion yang menyebabkan material lain dalam sampel seperti minyak dan diklorometna dapat membentuk
emulsidenganair.Agardapatmemisahkanfasaairdarifasadiklorometana(fasaorganik),makaprosespembentukan
emulsi ini bisa dicegah dengan tidak mengguncangkan corong pisah dengan terlalu kuat! Diagram alir berikut
menunjukkanprosesekstraksipadatcairkafeindaridaunteh.

Gambar2Diagramalirprosesekstraksipadatcairkafeindaridaunteh

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
A.Ekstraksipadat/cair:ekstraksikafeindariteh
Masukkan 25 g daun teh kering (atau 10 kantong teh celup) dan 20 g natrium karbonat ke dalam labu
Erlenmeyer 250 mL, lalu tambahkan 225 mL air mendidih. Biarkan campuran selama 7 menit, kemudian dekantasi
campuranreaksikedalamlabuErlenmeyerlain.Kedalamdaunteh/kantongtehtambahkanlagi50mLairpanaslalu
segera dekantasi ekstrak teh dan gabungkan dengan ekstrak teh sebelumnya. Untuk mengekstrak sisia kafein yang
mungkinada,didihkanairberisidaunteh/kantongtehselama20menit,laludekantasiekstraknya.Dinginkanekstrak
tehhinggasuhukamar,lalulakukanekstraksididalamcorongpisahdenganpenambahan30mLdiklorometana.Kocok
corong pisah secara perlahan selama 5 menit (supaya tidak terbentuk emulsi), sambil membuka kran corong pisah
untuk mengeluarkan tekanan udara/gas dari dalam corong pisah Ulangi ekstraksi dengan menambahkan 30 mL
diklorometana ke dalam corong pisah. Gabungkan ekstrak diklorometana dan semua fraksi yang berwujud emulsi di
dalam labu Erlenmeyer 125 mL (atau 250 mL kalau tidak ada), lalu tambahkan kalsium klorida anhidrat ke dalam
gabungan ekstrak dan emulsi, sambil diaduk/digoyang selama 10 menit. Secara hatihati, dekantasi ekstrak
diklorometana jangan sampai gumpalan kalsium klorida anhidrat ikut terbawa. Atau Anda dapat menyaring ekstrak
diklorometana menggunakan penyaringan biasa. Bilaslah Erlenmeyer dan kertas saring dengan 5 mL diklorometana.
Gabungkan filtrat dan lakukan distilasi menggunakan penangas air untuk menuapkan diklorometana (hatihati dalam
pemakaian api! Jangan lupa menggunakan batu didih/potongan gabus!). Timbang produk yang terbentuk (akan
diperoleh kristal putih kehijauan sebanyak 0,25 g). Lakukan rekristalisasi menggunakan 5 mL aseton panas, lalu
pindahkandenganpipetlarutaninikedalamlabuErlenmeyerkecil,dandalamkeadaanpanas,tambahkanligroin(atau
nheksan) tetes demi tetes sampai terbentuk kekeruhan. Dinginkan perlahan labu Erlenmeyer sampai dengan suhu
kamar. Kristal yang terbentuk disaring dengan penyaringan isap (vakum). Cuci kristal dengan beberapa tetes ligroin
(nheksan)dingin.Lakukanujititiklelehterhadapkristalkafein.

Perhatian:Simpankristalkafeinhasilekstraksipadat/cairuntukdilakukananalisissecarakromatografilapistipis!
Catatan: proses pemurnian kristal kafein dapat juga dilakukan dengan cara sublimasi. Cobalah Anda lakukan
pemurnian sampel kafein di atas dengan cara sublimasi, lalu bandingkan hasil uji titik lelehnya dengan cara
rekristalisasi!

B.Ujikromatografilapistipis(TLC)
Larutkan sedikit sampel kristal kafein hasil ekstraksi dari daun teh dengan sedikit diklorometana atau
kloroform.KemudianlarutansampeliniditotolkandiataspelatTLCsampainodanyacukuptebal.LakukanelusiTLC
menggunakan eluen etil asetat : metanol = 3 : 1 dan lakukan elusi juga dengan eluen kloroformmetanol = 9 : 1.
Lakukan elusi sampai batas atas pelat, keluarkan dan keringkan di udara. Semprot pelat yang telah dikembangkan
dengan pereaksi semprot Dragendorff (atau celupkan dengan cepat ke dalam larutan Dragendorff dan segera
keluarkan)dansetelahitudipanaskandiataspemaaslistrikhinggakering.Adanyaalkaloidakanditunjukkanolehnoda
padapelatyangberwarnajingga.TentukanR
f
masingmasingnoda,bandingkan!

C.UjiAlkaloid
Kafein termasuk senyawa alkaloid. Salah satu cara untuk menguji sifat alkaloid adalah dengan uji berikut:
Larutkan kristal kafein dalam air. Teteskan 12 tetes pereaksi Meyer. Apabila larutan tersebut mengandung alkaloid,
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 71
maka akan terjadi endapan kuning muda. Ke dalam larutan kafein lainnya masukkan 12 tetes pereaksi Dragendorff;
pengujianpositifakanditunjukkandenganterjadinyaendapanjingga.

IV.TugasPendahuluan(PreLab)
1. Kelarutan kafein dalam air adalah 2,5 g/100 mL pada suhu kamar dan 45 g/100 mL pada 60
o
C. Kelarutan
kafein dalam kloroform adalah 20 g/100 mL pada suhu kamar dan 90 g/100 mL pada suhu 60
o
C. Pada suhu
berapakahfraksikafeinyangterekstrakkedalamfasakloroformlebihbesar?Tunjukkanperhitungannya!
2. Apakah alkaloid itu? Jelaskan ciricirinya dengan memberikan contoh! Mengapa kafein termasuk alkaloid?
Jelaskandenganmenggambarkanstrukturnya!
3. Buatlahdiagramalircarapemisahan:asambenzoat,fenol,anilindannaftalenpadapercobaanekstraksicair
cair di atas! Jelaskan prinsip dasar pemisahan keempat senyawa tersebut dan fungsi penambahan reagen
reagenpadawaktuekstraksi!
4. Gambarkanstrukturtrimiristinyangdiisolasidaripala!

Pustaka

Mayo,D.W.,Pike,R.M.,Forbes,D.C.(2011),MicroscaleOrganicLaboratory:withMultistepandMultiscaleSynthesis,
5
th
edition,JohnWiley&Sons,NewYork,p.229236
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.5659;399404
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.127155
Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 72
Percobaan16IsolasiKurkumindariKunyit(Curcumalonga)

Sasaranpercobaan:
Setelahmelakukanpercobaaninimahasiswaharusdapat:
1. Menjelaskanprinsipdasardanteknikisolasidengancaraekstraksi,refluksdankromatografilapistipispreparatif.
2. Melakukanpemisahandanpemurnianhasilisolasidaribahantumbuhan.
3. MahirdalammenganalisisdataspektroskopiUV&IRdandatafisiksenyawayangdihasilkandibandingkanstandar.

I.Pendahuluan
Kunyit merupakan salah satu tumbuhan yang sudah sangat akrab dengan masyarakat Indonesia. Rimpang
(Rhizoma) dari tumbuhan ini biasa digunakan sebagai bahan warna kuning dalam industri tekstil tradisional serta
digunakan sebagai bumbu masakan, di samping kegunaannya dalam obat tradisional. Nama latin dari kunyit adalah
CurcumalongayangtermasukdalamfamiliZingeberaceae(temutemuan).
Komponen aktif dari rimpang kunyit adalah kurkumin (E,E)1,7bis(4hidroksi3metoksifenil)1,6heptadien
3,5on) yang biasanya terdapat 1,52% dari berat rimpang kunyit kering. Struktur senyawa ini ditentukan tahun 1910
oleh V. Lampe dan merupakan diarilheptanoid yang pertama ditemukan. Kurkumin juga dapat disintesis di
laboratorium. Kurkumin dilaporkan memiliki sifat antikanker dan antitumor. Analog kurkumin telah dilaporkan pula
mampumenghambatenzimHIV1integrase.
O OH
HO
OCH
3
OCH
3
OH
Kurkumi n

II.PeralatandanZat
Caridansusunlahsendiriperalatandanzatyangdigunakansesuaidenganeksperimenyangdilakukan.

III.Carakerja
20 g rimpang kunyit kering dalam 50 mL diklorometana direfluks selama 1 jam. Campuran kemudian segera
disaring dengan saringan vakum hingga diperoleh larutan kuning. Larutan lalu dipekatkan melalui distilasi pada
penangas air 50
0
C. Residu kuning kemerahan yang diperoleh kemudian dicampurkan dengan 20 mL nheksana dan
diaduksecaramerata.Campurankemudiandisaringlagidenganpenyaringvakum.Padatanyangdihasilkanselanjutnya
dianalisis dengan Kromatografi lapis tipis (TLC) menggunakan eluen CH
2
Cl
2
: MeOH = 97:3 yang akan menunjukkan 3
komponenutama.
Proses pemisahan dilakukan pula dengan menggunakan KLT preparatif. Ekstrak kasar (0,1 g) dilarutkan
dengansesedikitmungkinpelarutCH
2
Cl
2
:MeOH=99:1,kemudianditeteskansecaramenyebarpadabatasawalpelat
KLT preparatif dengan menggunakan pipet tetes secara perlahan. Lakukan beberapa kali hingga semua sampel
tersepatpadapelat silika untuk KLT preparatif. Catatan:setiap kali pengulanganpenetesansampel, tunggu sampai
kering dahulu penetesan yang sebelumnya, baru lakkukkan penetesan ulang tepat pada penetesan sampel
sebelumnya. Setelah noda kering, lakukan elusi dengan eluen CH
2
Cl
2
: MeOH = 97 : 3. Hasil elusi dilihat di bawah
lampuUV,kemudianpitakomponenutamanyadiberitandadenganujungtumpulpipakapiler.Bagianpitayangdipilih
kemudiandipisahkandarikomponenlainnyadengancaramengeroklapisansilikatersebutdanditampungpadakertas.
Pindahkan silika tersebut ke dalam gelas kimia, larutkan dengan diklorometana, kemudian saring dan cuci dengan
pelarutyangsama.Filtratkemudiandiuapkandenganrotaryevaporator(ataudistilasibiasadenganpenagasairpada
suhu 60
o
C). Lakukan uji kemurnian fraksi yang diperoleh dengan KLT (eluen CH
2
Cl
2
: MeOH = 97 : 3). Bandingkan
kemurniannyadenganfraksihasilpemisahansecarakromatografikolom!

IV.TugasPendahuluan
1. Cari dan jelaskan prinsip dasar kromatografi beserta jenisjenis kromatografi yang biasa digunakan dalam
prosespemisahan,pemurniandanidentifikasisenyawaorganik!
2. Carisenyawalainyangdapatdiisolasidaritumbuhankunyitdantumbuhangenuscurcumalainnya!
3. Caricarasintesissenyawakurkuminyangtelahdilakukandilaboratorium!
4. Apakahsenyawadiarilheptanoiditudanberikancontohsenyawadiarilheptanoidlainnya!
5. Cari senyawasenyawa lain berikut dengan asalnya yang memiliki aktivitas sebagai antiHIV atau antikanker
sepertisenyawaturunankurkumin!

Praktikum Kimia Organik Laboratorium Kimia Organik Program Studi Kimia FMIPA - ITB
ByDW2011 73
Pustaka
Anderson, A.M., Mitchell, M.S., and Mohan, R.S. (2000), Isolation of Curcumin from Turmeric, Journal of Chemical
Education,77(3),p.359360
Pasto, D., Johnson, C., Miller, M. (1992), Experiments and Techniques in Organic Chemistry, Prentice Hall Inc., New
Jersey,p.6081;404406
Williamson(1999),MacroscaleandMicroscaleOrganicExperiments,3
rd
edition,Boston,p.160166;704706
Skripsi,Tesis,DisertasimengenaiisolasisenyawadariCurcumalongaataugenuscurcumalainnya.

Anda mungkin juga menyukai