Anda di halaman 1dari 47

Banjir &Manajemen Keruangan Penanganannya

Adipandang Y11

Pengertian lainyangmenyangkut Banjir


1. Sungai adalah tempattempat dan wadahwadah serta jaringan pengaliran airmulai dari mata airsampai muara dengan dibatasi kanan dan kirinya serta sepanjang pengalirannya oleh Garis Sempadan (GS) 2.DaerahPengaliran Sungai(DPS) adalah suatu kesatuan wilayah tata air yangterbentuk secara alamiah dimana airmeresap dan/atau mengalir melalui sungai dan anakanak sungai ybs.DPSsering disamakan dengan DaerahAliran Sungai (DAS)/CatchmentArea/Riverbasin 3. WilayahSungai adalah kesatuan wilayah tata pengairan sebagai hasil pengembangan satu atau lebih DPS Bantaran Sungai adalah lahan pada kedua sisi sepanjang palung sungai dihitung dari tepi sampai dengan kakitanggul sebelah dalam Garis Sempadan Sungai adalah garis batas luar pengamanan sungai DaerahManfaat Sungai adalah mata air,palung sungai,dan daerah sempadan yang telah d b b k l h dibebaskan DaerahPenguasaan Sungai adalah dataran banjir,daerah retensi,bantaran atau daerah sempadan yangtidak dibebaskan.

4.

5. 6.

7.

Pengertian lainyangmenyangkut Banjir(sambungan) ( b )


8. Dataran Banjir (FloodPlain) adalah lahan/dataran di kanan kiri sungai yang sewaktuwaktu bisa tergenang banjir Pengendalian Banjir (FloodControl) upaya struktur untuk debitbanjir sampai tingkat tertentu yanglayak,dan bukan untuk debitbanjir yangterbesar 9.

10. Penanggulangan Banjir.(FloodFighting): salah satu kegiatan Satkorlak/Satlak Penaggulangan Bencana. 11.FloodDamageMitigation:upaya menekan besarnya bencana akibat banjir 12.FloodPlainManagement: pembudidayaan dataran banjir (floodplain)sedemikian rupa sehingga genangan banjir yangkemungkinan terjadi menimbulkan masalah yang minimal 13.FloodDamageManagement:pengelolaan banjir sedemikian rupa agar dampak/kerugian yangditimbulkannya minimal /

I.2.BANJIRDANMASALAHBANJIR
Arelativelyhighfloworstageinariver,markedlyhigher

DEFINISI BANJIR(FLOOD) BANJIR (FLOOD)

thantheusual;alsotheinundationoflowlandthatmay resulttherefrom.Abodyofwater,rising,swellingand f y f , g, g overflowingthelandnotusuallythuscovered


(SUMBER:MultilingualTechnicalDictionaryonIrrigationandDrainage,ICID)

BANJIR/FLOOD / OO

TIDAKMENIMBULKANMASALAH BAHKANBISABERMANFAAT BAGIKEHIDUPAN

BUDIDAYADIDATARANBANJIR

TIMBULMASALAH

MASALAHBANJIR MASALAH BANJIR

Banjir adalah dimana suatu daerah dalam keadaan tergenang oleh air dalam jumlah yang begitu besar. airdalam yangbegitu banjir bandang adalah banjir yangdatang secara tibatiba yang disebabkan oleh karena tersumbatnya sungai maupun karena pengundulan hutan disepanjang sungai sehingga merusak rumahrumah penduduk maupun menimbulkan korban jiwa.

Penyebab Banjir bisa dikenali


Curah hujan tinggi Permukaan tanah lebih rendah dibandingkan muka airlaut. Terletak pada suatu cekungan yang dikelilingi yangdikelilingi perbukitan dengan pengaliran airkeiuar sempit. Banyak pemukiman yangdibangun pada dataran sepanjang sungai. d j i Aliran sungai tidak lancar akibat banyaknya sampah serta bangunan di pinggir sungai sungai. Kurangnya tutupan lahan di daerah hulu sungai.

I.3.PROSESTERJADINYAMASALAHBANJIR
KONDISIALAM(STATIS)

KEGIATANMANUSIA(DINAMIS) *PEMBUDIDAYAAN DATARANBANJIR *tataruang/peruntukan dataranbanjirygtdksesuai g/p *tataruang/peruntukandiDAS permukimandibantaran sungai *pembangunandrainase *bangunansungai/silang *b / l *sampahpadat *prasaranapengendali ba j ya g te batas banjiryangterbatas *amblesanpermukaantanah *persepsimasyarakatyang keliruthdbanjir *kenaikanmukaairlaut akibatglobalwarming

Geografi Topografi Geometrialur sungai: kemiringandasar meandering bottleneck sedimentasi ambalalam PERISTIWAALAM (DINAMIS) *curahhujantinggi *pembendungan: darilaut/pasang darisungaiinduk *amblesantanah *pendangkalan

MASALAH BANJIR

FLOOD AND LANDUSE CHANGE

Sutopo,DialogWFE,Bekasi09122004

Beforedevelopment
Retainedinriver basins

Afterdevelopment
Retainedinriver basins

Run offvolume Runoff volume

Run offvolume Runoff volume

Runoffintorivers

Time

Runoffintorivers

Time

PENGARUH URBANISASI TERHADAP PUNCAK DEBIT BANJIR


Q

Rural
Q t

Semi-urban
t Q

City

Eksploitasi sumberdaya lahan yang berlebihan:


Perubahan guna lahan : lahan terbuka / hutan, sawah pemukiman, kawasan industri, dll. tanpa kompensasi pengganti resapan akan mengakibatkan kenaikan debit puncak sampai 25 kali.

Resapan

Misal: / DebitPuncak=10m3/dt Resapan=5m3/dt

Akibat perubahan guna lahan bisa menjadi DebitPuncak=75m3/dt Resapan=0,5m3/dt

Dataran Banjir
Dataran Banjir (FloodPlain)adalah lahan/dataran di kanan kiri sungai yang sewaktuwaktu bisa tergenang banjir. g g j Dataran banjir atau floodplain ini lebarnya bisa ratusan meterhingga puluhan kilometer tergantung besar kilometer,tergantung kecilnya sungai.

Mengamati banjir dapat dilakukan di daerah genangan ataupun lewat angkasa dengan citra satelit. Pengamatan dengan citra satelit ini untuk memperlihatkan bagaimana banjir itu terjadi Peta curah hujan pun diperlukan untuk melihat sebenarnya hujanpundiperlukan daerah mana yangdiguyur airhujan. D Dengan mengetahui guyuran airhujan i i akan l bih t h i i h j ini k lebih mudah diketahui juga tahapdemi tahap kejadian banjir.

Gambar di sebelah kiri ini menunjukkan peta satelit yang yang diambil sebelum banjir.Sedangkan disebalah kanan merupakan peta satelit sesudah (ketika)banjir datang. Setelah Banjir datang kita dapat melihat lokasilokasi genangan airini.Didalam gambar sebelah kanan,airterlihat berwarna biru.Sedangkan warna putih itu adalah awan,dan warna hitam dibawahnya merupakan bayangbayang awan bayang bayang awan.

Ada dua seri gambar laindisebelah ini yangjuga merupakan peta satelit sebelum dan sesudah (ketika)banjir. Sesudah banjir datang,maka tid k seluruh ki i k S d h b ji d t k tidak l h kirikanan sungai i akan kebanjiran.Ada tempattempat tertentu saja yangsering atau lebih berpotensi terkena limpahan airsungai. Kalau menengok gambargambar peta satelit diatas kita dapat melihat dengan jelas bahwa daerah yangbanjir tersebut merupakan daerah disekitar sungai yangberkelokkelok, sering disebut sebagai sungai meander Dataran landai di meander.Dataran sebelah kiri kanan sungai dini disebut floodplain atau dataran banjir.

Coba perhatikan bagaimana banjir itu melimpah akibat kelokan sungai. Danjuga daerah pertemuan dengan anak sungai ini seringkali merupakan titik limpah utama dalam banjir. Titiktitik pinggir sungai tempat melimpahnya airsungai yang menggerus tanggul alami ini sering diseput splay(crevassesplay) atau titik limpah.Jadi harus selalu waspada kalau kebetulan daerah sekitar titik limpah ini.Karena disitulah kecepatan aliran sungai terbesar.

Imaginasi banjir di Malang


Oleh:Adipandang Yudono,S.Si,MURP Ol h di d d S Si

Jika terdapat skenario di hulu Terjadi hujan l b t sehingga T j di h j lebat hi debit air sungai meninggi g gg sedangkan pada wilayah hilir terdapat pemampatan

Malang M l
Mesjid A. Yani Tugu

Spendid Balai Kota

Ketinggian air normal

Malang M l
Mesjid A. Yani Tugu

Spendid Balai Kota

Ketinggian air mencapai 7 Meter

Malang M l
Mesjid A. Yani Tugu

Spendid Balai Kota

Ketinggian air mencapai 12 Meter

Malang M l
Mesjid A. Yani Tugu

Spendid Balai Kota

Ketinggian air mencapai 17 Meter dari rata-rata rata rata permukaan sungai

KOTA-KOTA YANG SEBAGIAN/SELURUHNYA BERADA DI DATARAN BANJIR


NO
1 2 3 4 5 6 7 8 9 10 11 12 13 14

KOTA
JAKARTA SEMARANG BANDUNG SELATAN SURABAYA PALEMBANG PADANG PEKANBARU JAMBI MEDAN BANDA ACEH PONTIANAK BANJARMASIN SAMARINDA MAKASSAR

SUNGAI
Kamal, Tanjungan, Angke, Pesanggrahan, Sekretaris, Grogol, Krukut, Cideng, Ciliwung, Cipinang, Sunter, Buaran, Jatikramat, Cakung C k

Kali Garang/Kali Semarang Sungai Citarum Hulu Kali B K li Brantas t Sungai Musi Batang Arau, Batang Kuranji, Batang Air Dingin, Sungai Siak Sungai Batanghari Sungai Belawan, Deli, Babura, Percut, Kera Krueng Aceh Sungai Kapuas Sungai Barito Sungai Mahakam Sungai Jeneberang

COMPREHENSIVEFLOODDAMAGEMITIGATION
SMALL DAMAGE

NOMEASURE

FLOOD (NATURAL PHENOMENA)

MEASURES EXCEEDED

SMALL DAMAGE

LARGER DAMAGE

HUMANACTIVITY Sumber:ManualESCAP

SKETSASUNGAIDANDATARANBANJIR

SUMBER:
1.PPNO.35/1991TENTANGSUNGAI 2.PERMENPUNO.63/1993 TENTANGGARIS SEMPADANSUNGAI,DAERAHMANFAAT SUNGAI,DAERAHPENGUASAANSUNGAI , DANBEKASSUNGAI

M.A.DEBITBANJIR>50TAHUNAN

DATARANBANJIR (DAERAHPENGUASAAN SUNGAI) GS *)TERLARANGUNTUK:

PALUNG SUNGAI DAERAHSEMPADAN*)/ DAERAHMANFAATSUNGAI GS DATARANBANJIR (DAERAHPENGUASAAN SUNGAI)

a.membuangsampah,limbahpadat&limbahcair b.mendirikanbangunanuntukhuniandantempatusaha

GS

GS KONDISI1

>5M GS

>5M GS KONDISI2

PERMUKIMAN/PERKOTAAN

>3M

GS

GS

>3M

KONDISI3

DPS>500KM2,L>100M DPS 500 KM2 L 100 M DPS<500KM2,L>50M

L
GS

L
GS KONDISI4

H<3M,L>10M 3M<H<20M,L>15M H>20M,L>30M

PERMUKIMAN/PERKOTAAN

SEMPADANSUNGAIMENURUTPERMENPUNO:63/1993

II.5.MASALAHTEKNIS(1)

1.DATARANBANJIRBERKEMBANG/DIKEMBANGKANMENJADIKAWASANBUDIDAYA:

PERMUKIMAN/PERKOTAAN,INDUSTRI,PERTANIAN,DSBTANPAMEMPERTIMBANGKANADANYARESIKO TERGENANGBANJIR. 2.SEHUBUNGANDGNBUTIR1,KAWASANYANGMENGALAMIMASALAHBANJIRMELUASDARITAHUNKE TAHUN (PELITAI:750.000HA,PELITAIII:1.370.000HA,PELITAV:1.750.000HA);DENGANBOBOTMASALAH YANGSEMAKINMENINGKAT. 3.TERJADINYAPERUBAHANWATAKBANJIR (DEBIT BANJIR SEMAKIN MEMBESAR); MENURUNKAN KINERJA 3 TERJADINYA PERUBAHAN WATAK BANJIR (DEBITBANJIRSEMAKINMEMBESAR);MENURUNKANKINERJA SISTEMPENGENDALIBANJIRYANGADA(CONTOH:Q100TAHUNANSUNGAICILIWUNGDIMANGGARAI: 370M3/DTPADATH1973(NEDECO)MENJADI570M3/DTPADATH1996(JICA) 4.UPAYASTRUKTUR/SISTEMPENGENDALIBANJIRDANDRAINASEHANYAUNTUKMENGENDALIKANBANJIRS/D BESARANBANJIRTERTENTU (SISTEMPENGENDALIBANJIRDENGANDEBITBANJIRRENCANA5100 TAHUNAN,DANSISTEMDRAINASE210TAHUNAN),DANBUKANBANJIRYANGTERBESAR.SISTEMYGADA PADAUMUMNYA BELUMDISIAPKANUNTUKMENGANTISIPASITERJADINYADEBITBANJIRYANGLEBIH BESARDALAMRANGKA FLOODDAMAGEMANAGEMENT,TERMASUKSOPNYA 5.PEMBANGUNANBENDUNGANDENGANBANJIRPMFMENSYARATKANADANYADAMBREAKANALYSIS; NAMUN PERSYARATANITUTIDAKBERLAKUUNTUKTANGGUL,PADAHALRESIKOTERJADINYA KERUSAKAN/BOBOLPADATANGGULJAUHLEBIHBESAR

II.5.MASALAHTEKNIS(2)
6.TERDAPATNYAKERANCUANANTARASISTEMPENGENDALIBANJIRDANSISTEMDRAINASE DIKAWASAN PERMUKIMAN/PERKOTAAN 7.PERENCANAANDANPENGOPERASIANSISTEMPENGENDALIBANJIRTERMASUKPRAKIRAANDAN PERINGATANDINITIDAKTEPATDANAKURATAKIBATTERBATASNYADATADANINFORMASIYANGBENARDAN PERINGATAN DINI TIDAK TEPAT DAN AKURAT AKIBAT TERBATASNYA DATA DAN INFORMASI YANG BENAR DAN BERLANJUT 8. TERBATASNYAIPTEK YANGMENUNJANGPEREKAYASAANDIBIDANGSUNGAISEHINGGASERINGTERJADI KESALAHANDANKEGAGALANAKIBATPENDEKATANYANGKELIRU.NAMUNKESALAHANDANKEGAGALAN (PERENCANAAN,PELAKSANAANDANO/P)PADAUMUMNYASELALUDIANGGAPAKIBATALAM(BENCANA (PERENCANAAN PELAKSANAAN DAN O/P) PADA UMUMNYA SELALU DIANGGAP AKIBAT ALAM (BENCANA ALAM);YANGSECARATIDAKLANGSUNGMENGHAMBATBAHKANMENGHENTIKANLAJUPENGEMBANGAN TEKNIKPEREKAYASAANDIBIDANGSUNGAI. PEMBANGUNAN(PERMANEN)PRASARANADANSARANAPENGENDALIBANJIRSERINGKALI MENGGUNAKANMEKANISMEPENANGANANDARURAT/MENDESAKAKIBATTERJADINYABENCANAALAM, SEHINGGAKUALITASPEKERJAANRENDAH.HALTSBTERJADIKARENAMEKANISMEPENANGANAN,KRITERIA DANBATASANBENCANAALAMYANGBELUMJELAS

9.

10.KARAKTERSUNGAIYANGSPESIFIKDANDINAMIS SERTATERBATASNYALITBANGUNTUKMENUNJANG 10. KARAKTER SUNGAI YANG SPESIFIK DAN DINAMIS SERTA TERBATASNYA LITBANG UNTUK MENUNJANG PEREKAYASAANDIBIDANGINIMENIMBULKANHASILREKAYASAYANGKURANGEFEKTIFDANEFISIEN 11.KINERJASISTEMPENGENDALIBANJIRSEMAKINMENURUN AKIBATTERBATASNYAKEGIATANO&P, PEMANTAUAN,SERTATERJADINYAPERUBAHANWATAKBANJIR

DAERAHPENGUASAANSUNGAI

GS
DEBIT>50TAHUNAN

BANJIR

GarisSempadan(GS) Garis Sempadan (GS)

DATARANBANJIR SUNGAI

DATARANBANJIR (FLOODPLAIN)

BANJIRDANMASALAHBANJIR
TRADISIONALOK NOPROBLEM

GS
M.A.B M.A.N

GS

MODEREN

DATARANBANJIR

PALUNGSUNGAI

DATARANBANJIR

DEBIT/ALIRANNORMAL

KONDISIBANJIR
SISWOKO

II.6.MASALAHNONTEKNIS(1)

1.

BELUMTERDAPATKESAMAANPERSEPSI DANPENGERTIANDIKALANGAN STAKEHOLDERS(PEMERINTAH,MASYARAKAT/LSM,SWASTA)MENYANGKUTBANJIR,MASALAHBANJIRDANUPAYA MENGATASINYASEHINGGAMENGAKIBATKANKONTRAPRODUKTIFTERHADAPPENCAPAIANTUJUAN PENANGANANMASALAH. PENANGANAN MASALAH BELUMDIFAHAMINYAFENOMENAALAMYANGDINAMIS MENIMBULKANTERJADINYAKERANCUAN,KESALAH FAHAMAN,SIMPANGSIURDANMISLEADING YANGANTARALAINDAPATMEMICUTIMBULNYACLASSACTION. BEBERAPAISTILAHDANPENGERTIANYANGADADIMASYARAKATRANCUA.L:PERIODAULANGBANJIR,PEILBANJIR, BEBASBANJIR,BANJIRKIRIMAN,DSB. BEBAS BANJIR BANJIR KIRIMAN DSB

2.

3.MASYARAKATDIDATARANBANJIRBELUMMEMAHAMIDANMENYADARIADANYARESIKOTERGENANGBANJIR YANGBISATERJADIKAPANSAJASEHINGGATIDAKSIAPBILASEWAKTUWAKTUTERJADIBANJIR 4.MASYARAKATBELUMMEMAHAMIKINERJASISTEMPENGENDALIBANJIRDANDRAINASEYANGTERBATAS, 4 MASYARAKAT BELUM MEMAHAMI KINERJA SISTEM PENGENDALI BANJIR DAN DRAINASE YANG TERBATAS SEHINGGATERJADIOVERCONFIDENCE DANOVERINVESTMENT PEMBANGUNANDIDATARANBANJIR,SERTA TIDAKSIAPMENGHADAPIBENCANAYANGMASIHBISATERJADI(PADASAATSISTEMTIDAKBERFUNGSIAKIBAT RUSAKDAN/ATAULUMPUHKARENAKAPASITASNYATERLAMPAUI),KAPANSAJA. 5. 5 SOP/MANUALPENANGGULANGANBANJIR(FLOODFIGHTING) TERMASUKTANGGAPDARURAT(EMERGENCY SOP/MANUAL PENANGGULANGAN BANJIR (FLOOD FIGHTING) TERMASUK TANGGAP DARURAT(EMERGENCY ACTIONS)MASIHRANCU;DEMIKIANPULAMEKANISME KOORDINASIDANPERANSETIAPSTAKEHOLDERSBELUMJELAS

II.6.MASALAHNONTEKNIS(2)
6.TERDAPATPOTENSIKONFLIKANTARDAERAH SEHUBUNGANDENGANBATAS ADMINISTRASIYANGBERBEDADENGANBATASDAS/DPSATAUWILAYAHSUNGAI. ADMINISTRASI YANG BERBEDA DENGAN BATAS DAS/DPS ATAU WILAYAH SUNGAI BELUMADAPENGATURANYANGJELASYANGDIKAITKANDENGANPELAKSANAANOTONOMIDAERAH,TERMASUK SISTEM TRADEOFF ANTARAPEMANFAATANDIHILIR DANKONSERVASIDIHULU. 7.PEMBANGUNANPRASARANADANSARANAFISIKPENGENDALIBANJIRBELUMDIIKUTIDENGANPEMBENTUKAN 7 PEMBANGUNAN PRASARANA DAN SARANA FISIK PENGENDALI BANJIR BELUM DIIKUTI DENGAN PEMBENTUKAN INSTITUSIPENGELOLAYANGBERSIFATPERMANEN DENGANSUMBERDANAO&PYANGJELASSEHINGGATERJADI PROYEKYANGNEVERENDING/MENERUS 8.PENGGALIANDANAO&PPRASARANADANSARANAFISIK DARIPENERIMAMANFAAT(BENEFICIARIES)BELUM DILAKUKAN;KEMUNGKINANAKANMENGALAMIKESULITANKARENAPRASARANADANSARANATIDAKDAPAT MENJAMINBEBASBANJIR 9. MASALAHBANJIRSEMAKINMENINGKAT,NAMUNSEBALIKNYASUMBERDAYAMANUSIA YANGSPESIALISDAN PROFESIONALDIBIDANGINISEMAKINLANGKA

10.DOMINASIPEMERINTAH DENGANPENANGANANFISIKNYATELAHMENGIKISBUDAYAKEMANDIRIANDANGOTONG ROYONGDIKALANGANMASYARAKAT,DANSEBALIKNYA TELAHMENIMBULKANAPATISME,KETERGANTUNGANDANBAHKANSERINGMUNCULPERNYATAANTIDAKPUAS DANPROTESDARIMASYARAKAT DAN PROTES DARI MASYARAKAT 11.KESADARANMASYARAKATDALAMIKUTMENGATASIMASALAHBANJIRMASIHRENDAH;CONTOH:RTRW BANDUNGSELATAN,PERMUKIMANDIBANTARAN,PERMUKIMANYANGSEMPITKANSUNGAI,SAMPAH, OPERASI BENDUNGGERAKSEPERTIHALNYAUNTUK BENDUNGTETAP,PEMOTONGANTANGGUL,TANAMAN/RUMAHDITUBUHTANGGUL,DSB. / 12.PENEGAKANHUKUM DANPENGAWASANBELUMBERJALANDENGANBAIK

SINGAPURA
DEBITBANJIR100TAHUNAN

DATARANBANJIR GS GS

THEHOTEL THE HOTEL SETIABUDI AMPIBI REALESTAT TANGGUL

INDONESIA/JAKARTA

DEBITBANJIR>50TAHUNAN

KP.MELAYU,BIDARACINA

DATARANBANJIR GS DEBIT/ALIRANNORMAL DEBIT/ALIRANBANJIR


SISWOKO

GS

II.7.ANALISISMASALAH(1)

1.

MENINGKATNYAMASALAHBANJIRMERUPAKANSALAHSATUDAMPAKNEGATIFDARIKEBIJAKAN PEMBANGUNAN YANGSAMPAISAATINILEBIHMEMENTINGKANASPEKPERTUMBUHANEKONOMI,DAN PERHATIANTERHADAPKELESTARIANLINGKUNGANSANGATKURANG(PEMBANGUNANBERPOLABUSINESS S G G S G G( G O S SS ASUSUAL). TERJADIKETIDAKSERASIAN (COMPATIBILITY)DANKETIDAKSELARASAN (HARMONY)YANGMENGHASILKAN KETIDAKSEIMBANGANEKOSISTEM DIMANAUNSURAIRDANMANUSIAADADIDALAMNYA.RENCANATATA RUANGMASIHKURANGBERPERAN.

2.PENATAANRUANG DALAMRANGKAPEMBUDIDAYAAN DATARANBANJIR BELUMMEMASUKKANAIR SEBAGAIFAKTORPEMBATASSEHINGGAKURANGMENGANTISIPASIADANYARESIKOTERGENANGBANJIR. MASALAHBANJIRSEMAKINMENINGKATSEJALANDENGANTUMBUHDANBERKEMBANGNYALAHANDI DATARANBANJIRMENJADIKAWASANBUDIDAYAANTARALAINBERUPAKOTA KOTABESAR. DATARAN BANJIR MENJADI KAWASAN BUDIDAYA ANTARA LAIN BERUPA KOTAKOTA BESAR PILOTPROJECT PENATAANDATARANBANJIRSUNGAICITARUMHULU(KAWASANBANDUNGSELATAN)BELUM DAPATBERJALANKARENAPIHAKPEMDALEBIHMENGUTAMAKANPENDAPATANDAERAH(PAD) 3.PEMBANGUNANNASIONALYANGSELAMAINIDILAKSANAKANLEBIHMENGUTAMAKANPENCAPAIAN TARGETFISIK,TERMASUKDALAMMENGATASIMASALAHBANJIRBERUPAPEMBANGUNANPRASARANA TARGET FISIK TERMASUK DALAM MENGATASI MASALAH BANJIR BERUPA PEMBANGUNAN PRASARANA DANSARANAFISIKPENGENDALIBANJIRDANSISTEMDRAINASE;ASPEKPEMBINAANDANPENGATURAN YANGMERUPAKANTUGASUMUMPEMERINTAHANSANGATKURANGMENDAPATPERHATIAN

II.7.ANALISISMASALAH(2)
4.UPAYAMENGATASIMASALAHBANJIRSAMPAIKINIMASIHMENGANDALKANUPAYA KONVENSIONAL/TRADISIONALYANGBERUPAREKAYASASTRUKTURDISUNGAI(INSTREAM) YANG MEMPUNYAIKETERBATASAN, BERSIFATREPRESIF DENGANMENERAPKANPOLAPEMADAMAN KEBAKARAN YANGKURANGMENYENTUHAKARPERMASALAHAN,SERTATIDAKDIDASARKANATASKONSEP PENANGANANYANGUTUHDANMENYELURUH. PENANGANAN YANG UTUH DAN MENYELURUH TERBATASNYAIPTEK,LITBANGDANSUMBERDAYAMANUSIA YANGMEMAHAMIMASALAHDIBIDANGINI BERPENGARUHTERHADAPPENETAPANKEBIJAKANTERSEBUT 5. PEMERINTAHSANGATKURANGDALAMMENANGANIASPEKPENGATURAN(REGULASI) YANGMERUPAKAN TUGASPOKOKNYA,DANLEBIHTERFOKUSPADAKEGIATANPEMBANGUNANFISIK SUMBERTERJADINYAMASALAHBANJIRYANGDOMINANADALAHPENGARUHKEGIATANMANUSIABAIKDI DATARANBANJIRMAUPUNDIDAS;NAMUNMASYARAKATDANSWASTABELUMBANYAK TERLIBAT/DILIBATKAN.TERBATASNYAPEMAHAMANMASYARAKATA.LMERUPAKANPENGHAMBATUTAMA TERLIBAT/DILIBATKAN. TERBATASNYA PEMAHAMAN MASYARAKAT A.L MERUPAKAN PENGHAMBAT UTAMA BAGITUMBUHNYAKESADARANUNTUKIKUTBERPERAN.

6.

7.UPAYAMENGATASINYAMASALAHBANJIRSAMPAISAATINITIDAKSEIMBANGDENGANLAJUPENINGKATAN MASALAHYANGTERUSMENINGKATDARITAHUNKETAHUN. UNTUKITUDIPERLUKAN UNTUK ITU DIPERLUKAN PENYEMPURNAAN ATAS KEBIJAKAN STRATEGI DAN UPAYA MENGATASI MASALAH ATASKEBIJAKAN,STRATEGIDANUPAYAMENGATASIMASALAH BANJIRYANGTELAHADA.

I.4.UPAYAPREVENTIFMENGATASIMASALAHBANJIR
1.DAYADUKUNGLINGKUNGANDIUPAYAKANSEIMBANG DENGANBEBANPENDUDUK 1 DAYA DUKUNG LINGKUNGAN DIUPAYAKAN SEIMBANG DENGAN BEBAN PENDUDUK 2.TATARUANG DANPEMBUDIDAYAANDATARANBANJIRDIDISESUAIKANDENGAN ADANYAKEMUNGKINAN/RESIKOTERGENANGBANJIR(FLOODPLAINMANAGEMENT). UNTUKITUDIPERLUKANPETARESIKOBANJIR(FLOODRISKMAP)SERTAPEMBAGIAN ZONA/KLASIFIKASILAHANDIDATARANBANJIR(FLOODPLAINZONING)YANG ( ) DISESUAIKANDENGANTINGKATKERAWANANNYATHDGENANGANBANJIR 2.SEMUAKEGIATANDAN PEMBANGUNANFISIK YANGBERADADIDATARANBANJIR MENYESUAIKAN DENGANTATARUANGYANGTELAHMEMPERHATIKANADANYA RESIKOGENANGANBANJIR.PENYESUAIANA.L.MELIPUTI:JENISPERUNTUKAN LAHAN,JENIS/TIPEBANGUNAN,STRUKTURBANGUNAN,ELEVASIDASARBANGUNAN, LAHAN JENIS/TIPE BANGUNAN STRUKTUR BANGUNAN ELEVASI DASAR BANGUNAN MATERIALBANGUNAN,JENISDANVARIETASTANAMAN,DSB 3.FLOODPROOFING YANGDILAKSANAKANOLEHMASYARAKAT/SWASTASECARA MANDIRIUNTUKMELINDUNGIASETMEREKABAIKSECARAINDIVIDUALMAUPUN KOLEKTIF 4.TATARUANGDANSELURUHKEGIATANPEMBANGUNANDANPEMBUDIDAYAANDAS YANGMENUNJANGKONSERVASIAIRDANTANAH A.LDENGANPENGHIJAUANDAN REBOISASI,TERASERING,SUMURRESAPAN,WADUK/SITU/KOLAMPENAMPUNG AIRHUJAN(WADUKRETENSIMAUPUNWADUKDETENSI) 4.PRAKIRAANBANJIRDANPERINGATANDINI KEPADAMASYARAKATYANGTINGGAL 4 PRAKIRAAN BANJIR DAN PERINGATAN DINI KEPADA MASYARAKAT YANG TINGGAL DIDATARANBANJIR 5.PENETAPANSEMPADANSUNGAI YANGDIIKUTIDENGANPENEGAKANHUKUMDAN POLAHIDUPMASYARAKATYANGMENCINTAILINGKUNGAN/SUNGAI

MENGHINDARKANTERJADINYAMASALAHBANJIR

I.5.UPAYAMENGATASIMASALAHBANJIRSCR.MENYELURUH UPAYASTRUKTUR UPAYA STRUKTUR (conventional)*)


*MENCEGAHMELUAPNYA

UPAYANONSTRUKTUR,a.l: UPAYA NONSTRUKTUR l


*PRAKIRAANBANJIRDAN PERINGATANDINI *PENANGGULANGANBANJIR (FLOODFIGHTING),EVAKUASI *PEMINDAHAN/RELOKASI *PENGELOLAANDATARANBANJIR (FLOODPLAIN/RISKMNAGEMENT), (FLOOD PLAIN / RISK MNAGEMENT) *FLOODPROOFING THD.BANGUNAN * TATARUANG,PENGHIJAUAN, REBOISASIDANDAL.EROSIDAS *RETENTION&DETENTIONPONDS *PENETAPANSEMPADANSUNGAI *INFORMASIPUBLIK&PENYULUHAN *PENEGAKANHUKUM, * PENEGAKAN HUKUM *PENGENTASANKEMISKINAN *MANAJEMENSAMPAH.

BANJIR SAMPAIKETINGGIAN TERTENTU,DENGANTANGGUL *MERENDAHKANELEVASI MUKAAIRBANJIR DENGAN: NORMALISASI,SUDETAN, BANJIRKANAL,INTERKONEKSI BANJIR KANAL INTERKONEKSI *MEMPERKECILDEBITBANJIR DENGAN:WADUK,WADUK RETENSIBANJIR,BANJIRKANAL , INTERKONEKSI, *MENGURANGIGENANGAN DENGAN:POLDER,POMPA DANSISTEMDRAINASE, *)berdasarkandebitbanjirrencana (designflood)

MENGURANGIBESARNYAKERUGIANAKIBATBANJIR (FLOODDAMAGEMITIGATION)

UPAYAMENGATASIMASALAHBANJIRSECARAMENYELURUH NONSTRUCTURALFLOOD MITIGATIONMEASURES


a)LANDUSEMANAGEMENT b)PROPERTYACQUISITIONAND FLOODWAYCLEARANCE c)MODIFICATIONOFCATCHMENT CONDITIONSANDONSITESTORAGE d)FLOODFORECASTINGAND WARNING e)PUBLICINFORMATIONAND EDUCATION f)FLOODPROOFINGOFBUILDINGS g)EVACUATIONFROMENDANGERED AREAS h)FLOODFIGHTING i)FLOODRELIEF j)FLOODINSURANCE k)FLOODADAPTATION

STRUCTURALFLOOD MITIGATIONMEASURES
a)LEVEESANDFLOODWALLS ) LEVEES AND FLOODWALLS b)CHANNELMODIFICATIONS c)BYPASSFLOODWAYS d)RETARDINGBASINSANDFLOOD STORAGEAREAS STORAGE AREAS e)FLOODMITIGATIONRESER VOIRS f)DRAINAGEEVACUATION SYSTEMS

FLOODDAMAGEMITIGATION
SUMBER:MANUALESCAP

NONSRUCTURALAPPROACHTOFLOODMANAGEMENT

PLANNINGMEASURES HydrologicAnalysis y g y FloodForecasting ControlofFloodplainDevelopment FloodInsurance Fl d P fi FloodProofing CatchmentManagement DecisionMaking RESPONSEMEASURES FloodEmergencyResponsePlanning FloodFighting Flood Warning FloodWarning Evacuation EmergencyAssistanceandRelief

SUMBER:MANUALICID

DAERAHPENGUASAANSUNGAI

GS
M.A.B

TANGGUL

GS

M.A.N

DATARANBANJIR

BANTARAN SUNGAI

BANTARAN

DATARANBANJIR (FLOODPLAIN)

PENGENDALIANBANJIRDENGANTANGGUL GS
TANGGUL M.A.B M.A.B M.A.N MASALAHBANJIR MASALAHBANJIR

GS

BUKANKEJADIAN YANGLUARBIASA YANG LUAR BIASA


DATARANBANJIR BANTARAN BANJIRYANGLAYAKDIKENDALIKAN

DATARANBANJIR BANTARAN

PALUNGSUNGAI

DEBIT/ALIRANNORMAL BANJIR>DARIYANGDIKENDALIKAN
SISWOKO

MASALAHGENANGAN

GS

TANGGUL

GS

M.A.N

DATARANBANJIR SUNGAI

DATARANBANJIR (FLOODPLAIN)

GENANGAN GS
TANGGUL MASALAHGENANGAN MASALAHBANJIR

GS
M.A.B M.A.N

DATARANBANJIR BANTARAN

PALUNGSUNGAI BANTARAN

DATARANBANJIR

BANJIRYANGLAYAKDIKENDALIKAN DEBIT/ALIRANNORMAL GENANGAN


SISWOKO

DAERAHPENGUASAANSUNGAI

GS

TANGGUL M.A.B M.A.N

GS

PENGEMBANGAN DIDATARANBANJIR DI DATARAN BANJIR MENINGKAT DATARANBANJIR

BANTARAN SUNGAI

BANTARAN

DATARANBANJIR (FLOODPLAIN)

PEMAHAMANTENTANGPENANGANANMASALAHBANJIRYANGKELIRU PEMAHAMAN TENTANG PENANGANAN MASALAH BANJIR YANG KELIRU


TANGGULDIPASANGITOPI (PARAPET)ATAUDITINGGIKAN M.A.B M.A.B M.A.N MASALAHBANJIR

GS

DATARANBANJIR BANTARAN

PALUNGSUNGAI BANTARAN

DATARANBANJIR

BANJIRYANGLAYAKDIKENDALIKAN DEBIT/ALIRANNORMAL BANJIR>DARIYANGDIKENDALIKAN

DAERAHPENGUASAANSUNGAI

GS
DEBIT>50TAHUNAN

BANJIR

GS

DATARANBANJIR SUNGAI TIDAKLAYAKDAN LEBIHBERBAHAYA TANGGUL

DATARANBANJIR (FLOODPLAIN)

BANJIRTERBESAR(PMF) MASALAHBANJIR MASALAHBANJIR

GS
MAB MAB M.A.N

GS

BEBASBANJIRKAH??

TIDAKDIJAMINMAS,
DATARANBANJIR BANTARAN PALUNGSUNGAI BANTARAN DEBIT/ALIRANNORMAL BANJIRYANGLAYAKDIKENDALIKAN BANJIRTERBESAR(PMF) DATARANBANJIR

TANGGUL(STRUKTUR)TIDAKBISAMENJAMIN DATARANBANJIRTERBEBASDARIBANJIRDAN GENANGANSECARAMUTLAK.SETUJU??

BENCANABANJIRDALAM PERSPEKTIFTATARUANG PERSPEKTIF TATA RUANG

KAWASANRAWAN BENCANABANJIR(1) BENCANA BANJIR (1)


Berdasarkan Pedoman Pengendalian Pemanfaatan Ruang di g g Kawasan Rawan Bencana Banjir, yang dimaksud dengan Daerah Rawan Banjir adalah kawasan yang potensial untuk dilanda banjir yang diindikasikan dengan frekuensi terjadinya banjir (pernah atau berulangkali); Kawasan Rawan Bencana Banjir Meliputi Kawasan Dataran dan Pesisir yang berfungsi sebagai Kawasan Budidaya. Adanya keterkaitan antara pola penanganan kawasan rawan longsor dan rawan banjir karena pola pengelolaan kawasan banjir, rawan longsor di bagian hulu, mempunyai dampak besar terhadap kawasan rawan banjir yang ada di bagian hilir.

KAWASANRAWAN BENCANABANJIR(2) BENCANA BANJIR (2)


Tipologi kawasan rawan banjir dapat dibedakan menjadi 2, yaitu pada kawasan lindung dan kawasan budidaya.

GAMBAR3 TIPOLOGIKAWASANLINDUNGDANRAWANBENCANABANJIR

KAWASANRAWAN BENCANABANJIR(3) BENCANA BANJIR (3)

GAMBAR4 GAMBAR 4 TIPOLOGIKAWASANBUDIDAYARAWANBENCANABANJIR

KESIMPULAN
1.BANJIRMERUPAKANFENOMENAALAMDANMASALAHYANGDITIMBULKANNYATIDAK DAPATDIATASI/DIKENDALIKANSECARAMUTLAK 2.MASALAHBANJIRMENINGKATDARITAHUNKETAHUNSEIRINGDENGAN PERTUMBUHANDANPEMBUDIDAYAANLAHANDIDATARANBANJIR YANGKURANGMEMPERTIMBANGKANADANYARESIKOTERGENANG BANJIR,SERTAPERTUMBUHANDANPEMBUDIDAYAANLAHANDIDAS YANGKURANGDIIMBANGIDENGANUPAYAKONSERVASIAIRDANTANAH 3.UNTUKMENGATASIMASALAHBANJIR,SAMPAISAATINIMASIH MENGANDALKANPADAUPAYASTRUKTURYANGDILAKSANAKANOLEH PEMERINTAH.HASILYANGTELAHDICAPAITIDAKSEIMBANGDANJAUH TERTINGGALDIBANDINGDENGANLAJUPENINGKATANMASALAH. GG G G G S 4.UPAYAMENGATASIMASALAHBANJIRSEHARUSNYAMERUPAKAN DOMAIN BERSAMAANTARAMASYARAKAT,SWASTADANPEMERINTAH. KEBIJAKAN,STRATEGIDANUPAYAMENGATASIMASALAHBANJIRPERLUDITINJAUULANG KEBIJAKAN STRATEGI DAN UPAYA MENGATASI MASALAH BANJIR PERLU DITINJAU ULANG UNTUKMEMBERIPELUANGKEPADASELURUH STAKEHOLDERSBERPERAN;A.LDENGANMENERAPKANUPAYA MENYELURUHBERUPAGABUNGANSTRUKTURDANNONSTRUKTUR YANGDIDUKUNGOLEHBERBAGAIDISIPLINDIBIDANGSOSIAL, YANG DIDUKUNG OLEH BERBAGAI DISIPLIN DI BIDANG SOSIAL LINGKUNGAN,TEKNIS,EKONOMISDANHUKUM.

TerimaKasih