Anda di halaman 1dari 4

Percobaan2a:OsmosispadaSayuran TinjauanTeori Osmosisadalahdifusiairmelaluimembransemipermeabel,darilarutanyangbanyak airkelarutanyangsedikitair.Definisipalingsederhananyaadalahdifusiairmelalui membransemipermeabel(permeabelhanyakepadapelarut,tidakkepadaterlarut). Osmosismelepaskanenergi,danbiasmelakukankerja,sebagaimanaakarpohonyang biasmembelahbatu. Pelarut(dalambanyakkasusadalahair)bergerakdarilarutanberkonsentrasilebih rendah(hipotonik)kelarutanberkonsentrasilebihtinggai(hipertonik)yangbertujuan menyamakankonsentrasikedualarutan.Efekinidapatdilihatdaribertambahnya tekananpadalarutanhipertonikrelatifterhadaplarutanhipotonik.Sehinggatekanan osmotikdidefinisikansebagaitekananyangdiperlukanuntukmenjagakesetimbangan, dengantidakadanyaaliranpelarut.Tekananosmotikmerupakanpropertikoligatif,yaitu propertiyanggayutterhadapkonsentrasimolarzatterlarutdanbukanterhadapjenis zatnya.

Osmosismerupakanfenomenayangpentingdidalamsistembiologiskarena kebanyakanmembranbiologisbersifatsemipermeabel.Secaraumum,membran membrantersebuttidakpermeableterhadapbahanorganikdenganmolekulbesar, sepertipolisakarida,akantetapipermeabelterhadapairdanzatzatkecildantidak bermuatan.Permeabilitasjugagayutterhadappropertikelarutan,muatanatausifat kimiawisertaukuranzatterlarut.Molekulair,misalnya,dapatbergerakmelewati dindingsel,tonoplast(vakuola)atauprotoplastdenganduacara,yaitudenganberdifusi melaluilapisangandafosfolipidasecaralangsung,ataumelaluiaquaporin(protein transmembrankecilyangmemfasilitasidifusidanmembentukkanalion).Osmosis memberikancarayangmudahbagitransporairkeluarataumasuksel.Tekananturgor seldijagadenganosmosispadamembransel,antarabagiandalamseldanlingkungan luarnyayangrelativelebihhipotonik. Tujuan Percobaaninibertujuanmemberikanpemahamankepadamahasiswaakanfenomena osmosisyangterjadididalamsistembiologis. AlatdanBahan Alatdanbahanyangdiperlukandidalampercobaaniniadalah: 3buahgelas Air Garam

Gula sebuahkentang sebuahpisau kertas pensilataupena

ProsedurPercobaan: 1. Isimasingmasinggelasdenganairsetengahpenuhdanletakandiatasmeja.Buat labeluntukmasingmasinggelas,masingmasingberbunyi"Airmurni","Airgaram" dan"Airgula."MasukkankedalamgelasyangberlabelAirgaramdengangaram danaduk.Tambahkangaramsedikitdemisedikitsambiltetapdiaduksampaitidak adalagigaramyangbisalarut.LakukanhalyangsamauntukgelasberlabelAirgula dengandiisigula. 2. Irisbagiantengahkentangtipistipis(tebalkirakira5mm)sebanyaktigairis. Semakintipissemakinbaik.Masukkansatuiriskentangkedalamsetiapgelas. Biarkanselamakuranglebih30menit. 3. Setelah30menit, 4. KeluarkanirisankentangdarigelasberlabelAirguladanamati.Apayangada lihat?Deskripsikan.Kembalikan. 5. CucitanganAnda,kemudiankeluarkanirisankentangdarigelasberlabelAirmurni danamati.Apayangadalihat?Deskripsikan.Kembalikan. Pertanyaan: 1. Didalamkehidupanseharihari,ketikamanusiabanyakmengeluarkankeringat (misalnyaatletolahraga)sangatdianjurkanuntukminurair(garam).Jelaskan mengapa? 2. Hewanyangbanyakbergerakakanmengonsumsiairlebihbanyakdibandingkan denganhewanyangtidakaktif.Mengapa?

Percobaan2b:OsmosispadaUsus TinjauanTeori Osmosisadalahdifusiairmelaluimembransemipermeabel,darilarutanyangbanyak airkelarutanyangsedikitair.Definisipalingsederhananyaadalahdifusiairmelalui membransemipermeabel(permeabelhanyakepadapelarut,tidakkepadaterlarut). Osmosismelepaskanenergi,danbiasmelakukankerja,sebagaimanaakarpohonyang biasmembelahbatu. Pelarutatausolvent(dalambanyakkasusadalahair)bergerakdarilarutan berkonsentrasilebihrendah(hipotonik)kelarutanberkonsentrasilebihtinggai (hipertonik)yangbertujuanmenyamakankonsentrasikedualarutan.Efekinidapat dilihatdaribertambahnyatekananpadalarutanhipertonikrelatifterhadaplarutan hipotonik.Sehinggatekananosmotikdidefinisikansebagaitekananyangdiperlukan untukmenjagakesetimbangan,dengantidakadanyaaliranpelarut.Tekananosmotik merupakanpropertikoligatif,yaitupropertiyanggayutterhadapkonsentrasimolarzat terlarut(solute)danbukanterhadapjeniszatnya. (a) Osmosismerupakanfenomenayangpentingdidalamsistembiologiskarena kebanyakanmembranbiologisbersifatsemipermeabel.Secaraumum,membran membrantersebuttidakpermeableterhadapbahanorganikdenganmolekulbesar, sepertipolisakarida,akantetapipermeabelterhadapairdanzatzatkecildantidak bermuatan.Permeabilitasjugagayutterhadappropertikelarutan,muatanatausifat kimiawisertaukuranzatterlarut.Molekulair,misalnya,dapatbergerakmelewati dindingsel,tonoplast(vakuola)atauprotoplastdenganduacara,yaitudenganberdifusi melaluilapisangandafosfolipidasecaralangsung,ataumelaluiaquaporin(protein transmembrankecilyangmemfasilitasidifusidanmembentukkanalion).Osmosis memberikancarayangmudahbagitransporairkeluarataumasuksel.Tekananturgor (b)

seldijagadenganosmosispadamembransel,antarabagiandalamseldanlingkungan luarnyayangrelativelebihhipotonik. Tujuan Percobaaninibertujuanmemberikanpemahamankepadamahasiswaakanfenomena osmosisyangterjadididalamsistembiologis. AlatdanBahan Alatdanbahanyangdiperlukandidalampercobaaniniadalah: Sebuahbejanaosmosis Air Sirupberwarna Usushalusbinatang(ayam,kambingatausapi) 2buahgelasbeaker

ProsedurPercobaan: 1. Pasangusushalusbinatangyangtelahdisediakanpadatempatnya.Yakinkanbahwa usustidaksobekdantidakadalubang. 2. IsitabungApadabejanapercobaandenganair,dantabungBdengansirup. 3. denganairsetengahpenuhdanletakandiatasmeja.Buatlabeluntukmasing masinggelas,masingmasingberbunyi"Airmurni","Airgaram"dan"Airgula." MasukkankedalamgelasyangberlabelAirgaramdengangaramdanaduk. Tambahkangaramsedikitdemisedikitsambiltetapdiaduksampaitidakadalagi garamyangbisalarut.LakukanhalyangsamauntukgelasberlabelAirguladengan diisigula. 4. Irisbagiantengahkentangtipistipis(tebalkirakira5mm)sebanyaktigairis. Semakintipissemakinbaik.Masukkansatuiriskentangkedalamsetiapgelas. Biarkanselamakuranglebih30menit. 5. Setelah30menit, 6. KeluarkanirisankentangdarigelasberlabelAirguladanamati.Apayangada lihat?Deskripsikan.Kembalikan. 7. CucitanganAnda,kemudiankeluarkanirisankentangdarigelasberlabelAirmurni danamati.Apayangadalihat?Deskripsikan.Kembalikan.