Anda di halaman 1dari 21

BAB II TINJAUAN PUSTAKA

A. Konsep Dasar Pendidikan kesehatan 1. Definisi Pendidikan Kesehatan Istilah pendidikan kesehatan telah di rumuskan oleh para ahli pendidikan kesehatan dalam berbagai pengertian, tergantung pada sudut pandang masing-masing. Stuart (1968) dalam definisi yang dikemukakan, dikutif oleh Staf jurusan PKIP FKMUI 1984 ) mengatakan bahwa pendidikan kesehatan adalah komponen program kesehatan dan kedokteran yang terdiri atas upaya terencana untuk mengubah perilaku individu, kelompok maupun masyarakat yang merupan perubahan cara berfikir, bersikap, dan berbuat dengan tujuan membantu pengobatan, rehabilitasi, pencegahan penyakit, dan promosi hidup sehat. Ahli lain, yaitu Green (1972) yang dikutip oleh Notoatmodjo (1997) menngemukakan bahwa pendidikan kesehatan adalah istilah yang di terapkan pada penggunaan proses pendidikan secara terencana untuk mencapai tujuan kesehatan yang meliputi beberapa kombinasi dan kesempatan pembelajaran. Menurut Craven dan Hirnle (1996), pendidikan kesehatan adalah penambahan pengetahuan dan kemampuan seseorang melalui teknik belajar atau instruksi, degan tujuan untuk mengingat fakta atau kondisi nyata, dengan cara memberi dorongan terhadap pengarahan diri (self direction), aktif memberikan informasi-informasi atau ide baru. Dari definisi yang di kemukakan di atas,pada kesimpulannya pendidikan kesehatan merupakan proses perubahan perilaku secara terencana pada diri individu, kelompok, atau masyarakat untuk dapat lebih mandiri dalam mencapai tujuan hidup

sehat. Pendidikan kesehatan merupakan proses belajar pada individu, kelompok, atau masyarakat dari yang tidak tahu tentang nilai kesehatan menjadi tahu, dan dari tidak mampu mengatasi masalah kesehatan sendiri menjadi mandiri. Dengan demikian pendidikan kesehatan merupakan usaha atau kegiatan untuk membantu individu, kelompok, dan masyarakat untuk meningkatkan kemampuan baik pengetahuan, sikap. Maupun keterampilan untuk mencapai hidup sehat secara optimal. Dalam keperawatan, pendidikan kesehatan merupakan suatu bentuk intervensi keperawatan yang mandiri untuk membantu klien baik individu, kelompok, maupumn masyarakat dalam mengatasi masalah kesehatannya melalui kegiatan pembelajaran, yang didalamnya perawat pendidikan berperan sebagai perawat pendidik. Pelaksanaan pendidikan kesehatan dalam keperawatan merupakan kegiatan pembelajaran dengan langkah-langkah sebagai berikut : pengkajian kebutuhan belajar klien, penegakan diagnose keperawatan, perencanaan pendidikan kesehatan, implementasi pendidikan kesehatan, evaluasi pendidikan kesehatan, dan dokumentasi pendidikan kesehatan. 2. Tujuan Pendidikan Kesehatan Secara umum tujuan dari pendidikan kesehatan ialah mengubah prilaku masyarakat dibidang kesehatan (WHO,1954) yang dikutif oleh Notoatmojo (1997). Tujun ini dapat di perinci lebih lanjut menjadi : a. Menjadikan kesehatan sebagai seseuatu yang bernilai di masyarakat. b. Menolong individu agar mampu secara mandiri atau berkelompok mengadakan kegiatan untuk mencapai hidup sehat. c. Mendorong pengembangan dan penggunaan secara tepat sarana pelayanan kesehatan yang ada. Secara operasional, tujuan pendidikan kesehatan diperinci oleh Wong (1974) yang dikutif Tafal (1974) sebagai berikut :

a. Agar penderita (masyarakat) memiliki tanggung jawab yang besar pada kesehatan (dirinya), keselamatan lingkungan, dan masyarakatnya. b. Agar orang melakukan langkah-langkah positif dalam mencegah terjadinya sakit. c. Agar orang memiliki pengertian yang lebih baik tentang eksistensi dan perubahanperubahan system dan cara memanfaatkannya dengan efisien dan efektif. d. Agar orang dapat mempelajari apa yang dapat dilakukan dia lakukan sendiri dan bagai mana caranya, tanpa selalau pertolongan kepada system pelayanan kesehatan yang formal.

3. Ruang Lingkup Pendidikan kesehatan Ruang lingkup pendidikan kesehatan dapat di lihat dari berbagai dimensi, antara lain dimensi sasaran pendidikan kesehatan, tempat pelaksanaan pendidikan kesehatan, dan tingkat pelayanan pendidikan kesehatan. a. Sasaran pendidikan kesehatan 1) pendidikan kesehatan individual dengan sasaran individu. 2) Pendidikan kesehatan kelompok dengan sasaran kelompok. 3) Pendidikan kesehatan masyarakat dengan sasaran masyarakat. b. Tempat Pelaksanaan Pendidikan Kesehatan 1) Pendidikan kesehatan di sekolah. 2) Pendidikan kesehatan di pelayanan kesehatan. 3) Pendidikan kesehatan di tempat-tempat kerja dengan sasaran buruh atau karyawan. c. Materi / pesan Materi atau pesan yang akan di sampaikan kepada masyarakat hendaknya di sesuaikan dengan kebutuhan kesehatan keperawatan dari individu, keluarga,

kelompok dan masyarakat sehingga materi yang di sampaikan dapat langsung manfaatnya. Materi yang di sampaikan sebaiknya: 1) Menggunakan bahasa yang mudah di menggerti dalam bahasa kesehariannya 2) Materi yang di sampaikan tidak terlalu sulit 3) Dalam penyampaian materi sebaiknya menggunakan alat peraga untuk mempermudah pemahaman dan untuk menarik perhatian sasaran 4) Materi atau pesan yang di sampaikan merupan kebutuhan sasaran dalam masalah kesehatan dan keperawatan yang mereka hadapi. d. Metode pembelajaran Metode adalah tehnik pengajaran yang menggunakan berbagai pendekatan disesuaikan dengan krakteristik sasaran (S. setiawati, 2008). Metode dalam proses pembelajaran memiliki beberapa kedudukan sebagai berikut: 1) Metode sebagai alat motifasi ekstrinsik, menurut Sadirman A.M metode ekstrinsik adalah motif -motif yang aktif dan berfungsi sebagai perangsang. Metode dalam proses pembelajaran dijadikan sebagai bagian dari motifasi agar perserta didik dengan cepat menerima informasi baru, ide, gagasan, pendapat dan hasil temuan dari pembicaran. 2) Metode sebagai strategi pengajaran, menurut Rostiyah N.K mengatakan bahwa seorang pengajar harus memiliki strategi pengajaran supaya peserta didik bisa belajar dengan efektif dan efisien. 3) Metode sebagai alat untuk mencapai tujuan, pembelajaran membutuhkan tujuan yang jelas. Pencapaian tujuan pembelajaran di pengaruhi oleh factor pengajar dan peserta didik. Menurut Syiful Bahri, dalam buku strategi belajar menggajar karangan S.Setiawati,2008, metode pembelajaran terdiri dari :

1) Ceramah, tugas, eksperimen, diskusi,demonstrasi,Tanya jawab, simulasi, dan lain-lain. 2) Metode yang paling tepat di gunakan saat pendidikan kesehatan di masyarakat maupun di rumah sakit adalah dengan metode ceramah karena banyak orang yang dapat mendengar atau memperoleh pengetahuan di bidang

kesehatan,dapat diterima oleh sasaran yang tidak dapat membaca, mudah dilaksanakan, mudah mempersiapkannya. 3) Penyuluhan kesehatan di masyarakat dapat di lakukan melalui pendekatan edukatif terhadap keluarga dan masyarakat binaan secara menyeluruh dan terorganisasi sesui dengan masalah kesehatan dan keperawatan yang di hadapi oleh masyarakat, agar penyuluhan di masyarakat dapat mencapai hasil yang di harapkan diperlukan perencanaan yang matang dan terarah sesuai dengan tujuan program penyuluhan kesehatan masyarakat berdasarkan kebutuhan kesehatan masyarakat setempat. Penyuluhan kesehatan masyarakat di masyarakat biasanya berkaitan dengan pembinaan wilayah binaan puskesmas atau oleh karna kejadian yang luar biasa seperti wabah dan lain sebagainya.

4. Media pembelajaran dalam pendidikan kesehatan Menurut Gerlach & Elly (1971) media di artikan sebagai segala bentuk dan saluran yang di gunakan untuk menyampaikan pesan dan informasi. Gagne & Briggs (1975), mengatakan bahwa media pembelajaran meliputi alat yang secara fisik digunakan untuk menyampaikan isi materi pengajaran.

Fleming (1987), menyatan bahwa media adalh bagian yang ikut dalam interaksi antara peserta didik dan pengajar sehingga pesan yang di sampaikan dapat di terima. Pesan, ide, gagasan atau informasi yang di sampaikan pengajar atau pembicara akan mudah diterima apabila diberikan dengan metode dan media yang benar dan baik (S.SEtiawati,2008).

B. Kecemasan 1. Definisi kecemasan Kecemasan adalah suatu keadaan emosional yang tidak menyenangkan yang di tandai oleh rasa ketakutan serta gejala fisik yang menegangkan serta tudak di inginkan. Gejala tersebut merupakan respon terhadap stress yang normal dan sesuai, tetapi menjadi patologis bila tidak sesuai dengan tingkat keparahan stress, berlanjut setelah stressor menghilang, atau terjadi tanpa adanya stressor eksternal. Kecemasan adalah respon individu terhadap suatu keadaan yang tidak menyenangkan dan di alami oleh semua mahluk hidup dalam kehidupan sehari-hari. Kecemasan ini merupakan pengalaman subyektif dari individu dan tidak dapat diobservasi secara langsung serta merupakan suatu keadan emosi tanpa obyektif yang spesifik. Serta kecemasan ini merupakan kebingungan, kekhawatiran pada sesuatu yang akan tejadi dan dihubungkan dengan perasaan yang tidak menentu dan tidak berdaya (Suliswati,2005) Kecemasan atau dalm bahasa inggrisnya anxiety berasal dari bahasa latin anguistus yag berarti kaku,dan ango anci yang berarti mencekik. Konsep kecemasan memgang yang sangat mendasar dalm teori tentang stress dan penyusuain diri (Lazarus,1961)

Freud (dalam Arndt,1974) mengemukakan bahwa lemahnya ego akan menyebabkan ancaman yang memicu munculnya kecemasan. Freud berpendapat bahwa sumber ancaman ego tersebut berasal dari dorongan yang bersifat insting dari id dan tuntutan-tuntutan dari super ego. Freud (dalam Hall and Lindzay,1995) menyatakan bahwa di sebut sebagai eksekutif kepribadian, karena ego menggontrol pintu-pinyu kearah tindakan, memilih segi-segi lingkungan karena ia akan memmberikan respon,dan memutuskan instinginsting manakah yang akan di puaskan dan bagaimana caranya. Dalam melaksanakan fungsi-fungsi eksekutif ini, ego harus berusaha mengintergrasikan tututn id, superego, dan dunia luar yang bertentangan. Hal ini sering menimbulkan tegangan yang berat pada ego dan menyebabkan timbulnya kecemasan. Lefrancois (1980) juga mengatakan bahwa kecemasan merupakan reaksi emosi yang tidak menyenangkan, yang di tandai dengan ketakutan. Hanya saja menurut Lefrancois, pada kecemasan bahaya bersifat kabur, misalnya ada ancaman, adanya hambatan keingian pribadi, adanya perasaan-perasan tertekan yang muncul dalam kesadaran. Tidak jauh berbeda dengan pendapat Lefrancois adalh pendapat Johnston (1971) menyatakan bahwa kecemasan dapat terjadi karena kekecewaan, ketidak puasan, perasaan tidak aman atau adanya permusuhan dengan orang lain. Kartono (1981) juga mengungkapkan bahwa neurosa kecemasan ialah kondisi phisikis dalam ketakutan dan kecemasan yang kronis, sungguhpun tidak ada (http://creasoft,wordpress,com/category/keperawatan rangsangan yang spesifik.

2. Tingkat kecemasan Menurut Peplau ada empat tingkat kecemasan yang dialami oleh individu yaitu :

a. Kecemasan ringan dihubungkan dengan ketegangan yang di alami sehari-hari. Individu masih waspada dan lapangan persepsinya luas, menajamkan indra. Dapat memotivasi individu untuk belajar dan mampu memecahkan masalah secara efektif dan menghasilkan pertumbuhan dan kreatifitas, contohnya seseorang yang menghadapi ujian akhir, pasangan dewasa yang akan memasuki jenjang

pernikahan, individu yang tiba-tiba dikejar anjing menggonggong b. Kecemasan sedang individu terfokus pada pikiran yang menjadi perhatian, terjadi penyempitan lapangan persepsi, masih dapat melakukan sesuatu dengan arahan orang lain, contohnya : keluarga menghadapi perpecahan dan individu yang mengalami konflik pekerjaan. c. Kecemasan berat yaitu lapangan persepsi yang sangat sempit, pusat perhatiannya pada detail yang spesifik dan tidak dapat berfikir tentang hal-hal yang lain. Seluruh prilaku dimaksudkan untuk mengurangi kecemasan dan perlu banyak perintah untuk terfokus pada area lain, contohnya : individu dalam penyanderaan dan individu kehilangan orang yang disayang karena bencana. d. Panik yaitu individu kehilangan kendali diri dan detail perhatiannya hilang, karena hilangnya control maka tidak dapat melakukan apapun meskipun dengan perintah. Terjadi peningkatan aktifitas motorik, berkurangya kemampuan berhubungan dengan orang lain, penyimpangan persepsi dan hilangnya pikiran rasional, tidak mampu berfungsi secara efektif, contoh : individu dengan kepribadian pecah.

3. Teori Kecemasan

a. Teori Psikoanalitik Menurut Freud, kecemasan timbul karena reaksi psikologis individu terhadap ketidakmampuan mencapai orgasme dalam hubungan seksual. Energy seksual yang diekspresikan menimbulkan rasa cemas. Kecemasan dapat timbul secara otomatis dari stimulus internal dan eksternal yang berlebihan. Ada dua tipe kecemasan yaitu : 1) Kecemasan primer adalah kejadian traumatic yang di alami saat bayi akibat adanya stimulasi tiba-tiba dan trauma saat persalinan, kemudian berlanjutnya tidak tercapainya rasa puas akibat kelaparan atau kehausan. Penyebab kecemasan primer adalh ketegangan atau dorongan akibat factor eksternal. 2) Kecemasan subsekuen merupakan kecemasan akibat konflik emosi diantara dua elemen kepribadian yaitu id dan super ego. Freud menjelaskan bila ada kecemasan maka posisi ego sebagai pengembang id dan super ego pada posisi bahaya. b. Teori Interpersonal Sullivan mengemukakan kecemasan timbul akibat ketidak mampuan untuk berhubungan interpersonal dan sebagai akibat penolakan. Kecemasan pertama dikemukakan pada hubungan ibu-bayi pada awal kehidupannya, bayi berespon bahwa dia dan ibunya adalah satu unit. Dengan bertambahnya usia, anak melihat ketidaknyamanan yang timbul akibat tindakannya sendiri dan diyakini bahwa ibunya setuju dengan perlakuan itu. Adanya trauma seperti perpisahan dengan orang menimbulkan kecemasan pada individu. c. Teori Prilaku Teori ini mengatakan bahwa kecemasan merupakan hasil frustasi akibat berbagai hal yang mempengaruhi individu dalam mencapai tujuan yang diinginkan

misalnya memperoleh pekerjaan, keluarga dan kesuksessan dalam sekolah. Prilaku merupakan hasil belajar dari pengalaman yang di alami. Kecemasan dapat muncul melalaui dua konflik antara dua pilihan yang berlawanan dan individu harus memilih salah satu. Konflik menimbulkan kecemasan akan meningkatkan persepsi terhadap konflik dengan timbul ketidakberdayaan. d. Teori Keluarga Kecemasan selalu ada pada tiap-tiap keluarga dalam berbagai bentuk dan sifatnya heterogen. e. Teori Biologik Otak memiliki reseptor khusus terhadap benzodiazepine, reseptor tersebut berfungsi membantu regulasi kecemasan. Regulasi tersebut berhubungan dengan aktifitas neurotransmitter GABA yang mengontrol aktivitas neuron, dibagai otak yang bertanggung jawab menghasilkan kecemasan. Bila GABA bersentuhan dengan sinaps dan berkaitan dengan reseptor GABA pada membrane post sinaps akan membuka saluran atau pintu reseptor sehingga terjadi perpindahan ion. Perubahan ini akan mengakibatkan eksitasi sel dan memperlambat aktivitas sel. Teori ini menjelaskan bahwa individu yang sedang mengalami kecemasan mempuyai masalah dengan proses neurotransmitter. Mekanisme koping ini juga terganggu karena pengaruh fisik, defisiensi nutrisi, menurunnya suplay darah dan perubahan hormone. Kelelahan mengakibatkan iritabilitas dan perasaan cemas. f. Reaksi kecemasan Kemasan dapat menimbulkan reaksi konstuktif maupun destuktif bagi individu: Konstruktif. Individu termotivasi untuk belajar mengadakan perubahan terutama perubahan terhadap parasaan tidak nyaman dan terfokus pada kelangsungan

hidup. Contohnya : individu yang melanjutkan pendidikan kejenjang yang lebih tinggi karena akan dipromosikan naik jabatan. Destruktif. Individu bertingkah laku maladaptive dan disfungsional. Contohnya : individu menghindari kontak dengan orang lain atau menggurung diri, tidak mau mengurus diri, tidak mau makan. g. Faktor-faktor yang mempengaruhi kecemasan 1) Jenis kelamin Kaaplan dan Saddock (1997), mengemukakan bahwa diperkirakan jumlah mereka yang menderita kecemasan baik akut maupun kronik dengan perbandingan wanita dan laki-laki 2:1, selain itu umunya perempuan dalam merespon stimulus atau rangsangan yang berasal dari luar lebih kuat dan lebih intensif dari pada laki-laki. (Kartono,2002) Menurut Myers (1983) mengatakan bahwa perempuan lebih cemas akan tidak kemampuannya di banding laki-laki lebih aktif, eksfloratif, sedangkan perempuan lebih sesitif. Penelitian lain menunjukan bahwa laki-laki lebih rileks dibanding perempuan.

(http:/creasof.wordpress.com/category/keperawatankesehatanmasyarakatkebid anan/psikologi-dan -jiwa/) 2) Umur Menurut hulcock (1996), menyatakan semakin tua seseorang semakin baik ia dalam mengendalikan emosinya. 3) Tingkat pendidikan Menurut Umar Fahmi Ahmadi (1985), pendidikan sangat berpengaruh pada program peningkatan pengetahuan baik langsung maupun tidak langsung terhadap prilaku. Tingkat pendidikan menurut poerwardamina (1996), adalah

proses pengubahan sikap dari tatalaku seseorang usaha mendewasakan manusia melalui upaya pengajaran dan pelatihan. Jadi semakin tinggi tingkat pendidikan diharapkan mereka dapat berfikir secara rasional danmenahan emosinya dengan baik. (http://tupays,multply.com/journal/item/2/

4. Skala Pengukuran tingkat kecemasan Menurut N. Dadang Hawari (2001) untuk mengetahui derajad kecemasan seseorang, di gunakan alat ukur (instrument) di kenal dengan nama Hamilton Anxiety Rating Scale (HARS) Alat ukur ini terdiri dari 14 kelompok gejala yang masing masing di rinci lagi gejala yang spesifi, 14 komponen kecemasan terdiri dari : a. Perasaan cemas b. Ketegangan c. Ketakutan d. Gangguan tidur e. Gangguan kecerdasan f. Perasaan depresi g. Gejala somatic / fisik h. Gejala sensorik i. Gejala kardiovaskuler j. Gejala pernafasan ( respiratori )

k. Gejala gastrointestinal (pencernaan) l. Gejala urogenital ( perkemihan dan kelamin )

m. Gejala autonom

n. Tingkah laku (sikap) pada wawancara Masing masing kelompok gejala di beri penilaian angka (skore) antara artinya : Nilai 0 = Tidak ada gejala ( tidak ada gejala yang muncul ) Nilai 1 = Gejala ringan ( hanya gejala satu yang muncul) Nilai 2 = Gejala sedang (sebagian gejala yang muncul) Nilai 3 = Gejala berat ( lebih dari sebagian gejala yang muncul ) Nilai 4 = Gejala berat sekali/ panic ( selruh gejala muncul ) Dari masing masing nilai angka (Score) dari ke 14 kelompok gejala tersebut di jumlahkan sehingga dari penjumlahan tersebut dapat diketahui derajat kecemasan seseorang yaitu : a. Kurang dari 14 : tidak ada kecemasan b. 14 20 c. 21 -27 d. 28 41 e. 42 56 : kecemasan ringan : kecemasan sedang : kecemasan berat : kecemasan berat sekali / panic 0 - 5 yang

Diambil dari Azis Alimut Hidayat, Riset Keperawatan dan Tehnik Penulisan Ilmiah Edisi 2.

5. Faktorfaktor yang menyebabkan timbulnya kecemasan pada pasien pre operasi secsio cecarea a. Takut Mati Perasaan takut mati biasanya muncul karena belum menyadari akan nilai hidup dan kematian, kecemasan yang muncul pada intinya adalah disebabkan karena hati dan hidup tidak ada ketentraman, orang yang cemas adalah karena dirinya

tidak mengenal takdir nasib dari Tuhan. Ketakutan terhadap kematian biasanya muncul pada orang yang tidak memiliki kepercayaan dan keyakinan terhadap Tuhan. Ketidaksiapan menghadapi kematian menimbulkan kecemasan saat Ibu menghadapi operasi secsio caesarea. b. Trauma Kelahiran Trauma kelahiran ini berupa ketakutan akan berpisahnya bayi dari rahim Ibunya, ketakutan berpisah ada kalanya menghinggapi seorang Ibu yang merasa amat takut kalau bayinya akan terpisah dari dirinya, seolah-olah Ibu tersebut menjadi tidak mampu menjamin keselamatan bayinya. c. Perasaan berdosa atau bersalah terhadap Ibunya Sejak kecil kita mendapat perawatan orang tua dengan kasih sayang, setelah beranjak dewasa tentu kita ingin membahas budi orang tua, masalah terjadi manakala kita tidak dapat membalas budi orang tua dan apa yang terjadi pada diri kita saat ini tidak sesuai harapan orang tua (Bambang M. 1987-43, 44) d. Ketakutan Melahirkan Ketakutan melahirkan berhubungan dengan proses melahirkan yang berkaitan dengan Ibu, kejadian melahirkan merupakan peristiwa besar yang membawa Ibu berada antara hidup dan mati, menyebabkan Ibu merasa cemas akan keadaannya, dukungan yang penuh dari anggota keluarga penting artinya bagi seorang Ibu bersalin terutama dukungan suami sehingga memberikan support moril terhadap Ibu (Kartini Kartono 1986, 192) 6. Respon Kecemasan Respon fisiologik kecemasan adalah : a. System kardiovaskuler : palpitasi, jantung berdebar, tekanan darah meninggi, rasa mau pingsan, tekanan darah menurun, denyut nadi menurun.

b. System pernapasan : napas cepat, napas pendek, tekana pada dada, pembengkakan pada tenggorokan, sensasi tercekik, terengah-engah. c. System integument : wajah kemerahan, berkeringat setempat, rasa panas dan dingin pada kulit, wajah pucat. d. System gastrointestinal : kehilangan nafsu makan, menolak makan, merasa tidak nyaman pada abdomen, mual, diare. e. System Traktus Urinarius : tidak dapat menahan kencing, sering berkemih. f. System Neuromeskuler : reflex meningkat, reaksi kejutan, mata berkedip-kedip, insomnia, tremor, gelisah, wajah tegang, kelemahan umum.

C. Seksio Caesaria Seksio Caesaria adalah suatu tindakan pembedahan untuk melahirkan janin dengan membuka dinding perut (laparatomi) dan dinding uterus (histerektomi) (dunn j. Leen obstetrics and gynekology). 1. Etiologi Ini biasanya dilakukan jika ada gangguan pada salah satu dari tiga faktor yang terlibat dalam proses persalinan yang menyebabkan persalinan tidak dapat berjalan lancar dan bila dibiarkan maka dapat terjadi komplikasi yang dapat membahayakan ibu dan janin. 3 faktor tersebut adalah : a. Jalan lahir (passage) b. Janin (passanger) c. Kekuatan yang ada pada ibu (power) 2. Indikasi a. Faktor janin 1) Bayi terlalu besar

Berat bayi 4000 gram atau lebih (giant baby), menyebabkan bayi sulit keluar dari jalan lahir. Dengan perkiraan berat yang sama tetapi pada ibu yang berbeda maka tindakan persalinan yang dilakukan juga berbeda. Misalnya untuk ibu yang mempunyai panggul terlalu sempit, berat janin 3000 gram sudah dianggap besar karena bayi tidak dapat melewati jalan lahir. Selain janin yang besar, berat janin kurang dari 2,5 kg, lahir prematur, dan dismatur, atau pertumbuhan janin terlambat , juga menjadi pertimbangan dilakukan seksiocaesarea. 2) Kelainan letak a) Letak sungsang Resiko bayi lahir sungsang dengan presentasi bokong pada persalinan alami diperkirakan 4x lebih besar dibandingkan keadaan normal. Pada bayi aterm, tahapan moulage kepala sangat penting agar kepala berhasil lewat jalan lahir. Pada keadaan ini persalinan pervaginam kurang menguntungkan. Karena ; pertama, persalinan terlambat beberapa menit, akibat penurunan kepala menyesuaikan dengan panggul ibu, padahal hipoksia dan asidosis bertambah berat. Kedua, persalinan yang dipacu dapat menyebabkan trauma karena penekanan, traksi ataupun keduaduanya. Misalnya trauma otak, syaraf, tulang belakang, tulang rangka dan viseral abdomen. b) Letak lintang. Kelainan letak ini dapat disebabkan karena adanya tumor dijalan lahir, panggul sempit, kelainan dinding rahim, kelainan bentuk rahim, plesenta previa, cairan ketuban pecah banyak, kehamilan kembar dan ukuran janin. Keadaan tersebut menyebabkan keluarnya bayi terhenti dan macet dengan

presentasi tubuh janin di dalam rahim. Bila dibiarkan terlalu lama, mengakibatkan janin kekurangan oksigen dan meyebabkan kerusakan otak janin. 3) Gawat janin Diagnosa gawat janin berdasarkan pada keadaan kekurangan oksigen (hipoksia) yang diketahui dari DJJ yang abnormal, dan adanya mekonium dalam air ketuban. Normalnya, air ketuban pada bayi cukup bulan berwarna putih agak keruh, seperti air cucian beras. Jika tindakan seksio caesarea tidak dilakukan, dikhawatirkan akan terjadi kerusakan neurologis akibat keadaan asidosis yang progresif. Janin abnormal, misalnya pada keadaan hidros1efalus, kerusakan Rh dan kerusakan genetik. b. Plasenta 1) Plasenta previa. Posisi plasenta terletak di bawah rahim dan menutupi sebahgian dan atau seluruh jalan lahir. 2) Dalam keadaan ini, plasenta mungkin lahit lebih dahulu dari janin. Hal ni menyebabkan janin kekurangan O2 dan nutrisi yang biasanya diperoleh lewat plasenta. Bila tidak dilakukan SC, dikhawatirkan terjadi perdarahan pada tempat implantasi plasenta sehingga serviks dan SBR menjadi tipis dan mudah robek. 3) Solusio plasenta Keadaan dimana plasenta lepas lebih cepat dari korpus uteri sebelum janin lahir. SC dilakukan untuk mencegah kekurangan oksigen atau keracunan air ketuban pada janin. Terlepasnya plasenta ditandai dengan perdarahan yang banyak, baik pervaginam maupun yang menumpuk di dalam rahim.

4) Plasenta accrete Merupakan keadaan menempelnya sisa plasenta di otot rahim. Jika sisa plasenta yang menempel sedikit, maka rahim tidak perlu diangkat, jika banyak perlu dilakukan pengangkatan rahim.

5) Yasa previa Keadaan dimana adanya pembuluh darah dibawah rahim yang bila dilewati janin dapat menimbulkan perdarahan yang banyak. c. Kelainan tali pusat. Pelepasan tali pusat (tali pusat menumbung). Keadaan dimana tali pusat berada di depan atau di samping bagian terbawah janin, atau tali pusat telah berada dijalan lahir sebelum bayi, dan keadaan bertambah buruk bila tali pusat tertekan. 1) Terlilit tali pusat Lilitan tali pusat ke tubuh janin akan berbahaya jika kondisi tali pusat terjepit atau terpelintir sehinggga aliran oksigen dan nutrisi ketubuh janin tidak lancar. Lilitan tali pusat mengganggu turunnya kepala janin yang sudah waktunya dilahirkan. 2) Bayi kembar Kelahiran kembar mempunyai resiko terjadinya komplikasi yang lebih tinggi misalnya terjadi preeklamsia pada ibu hamil yang stress, cairan ketuban yang berlebihan. d. Faktor ibu 1) Usia Ibu ynag melahirkan untuk pertama kalinya diatas 35th, memiliki resiko

melahirkan dengan seksiocaesarea karena pada usia tersebut ibu memiliki penyakit beresiko seperti hipertensi, jantung, DM, dan preeklamsia. 2) Cephalopevic disspiroprion. Ukuran panggul yang sempit dan tidak proporsional dengan ukuran janin menimbulkan kesulitan dalam persalinan pervaginam. Panggul sempit lebih sering pada wanita dengan tinggi badan kurang dari 145 cm. Kesempitan panggul dapat ditemukan pada satu bidang atau lebih, PAP dianggap sempit bila konjunctiva vera kurang dari 10 cm atau diameter transversal <12>6 minggu solusio plasenta, dan emboli air ketuban.

Retensio plasenta atau plasenta rest, :gangguan pelepasan plasenta menimbulakan perdarahan dari tempat implantasi palsenta. 3) Infeksi Keadaan umum yang kurang baik: anemia saat hamil, sudah terdapat manipulasi intra-uterin, sudah terdapat infeksi.

Perluakaan operasi yang menjadi jalan masuk bakteri.Terdapat retensio plasenta.

D. Penelitian Terkait Penelitian I Wayan Gede Subandita (2009) tentang hubungan pendidikan kesehatan dan pengetahuan tentang ISPA pada masyarakat dengan prilaku pencegahan ISPA pada balita di RW 06 kelurahan krukut kecamatan Limo Depok. Penelitian ini termasuk jenis penelitian deskriptif analitik, dengan desain cross sectional. Populasi penelitian ini adalah warga RW 06 kelurahan krukut kecamatan limo Depok, khususnya yang memiliki balita. Tehnik pengambilan sampel adalah purposive sampling.

Penelitian Hastuti (2005) tentang pengaruh penyuluhan kesehatan terhadap tingkat kecemasan pasien yang akan dioperasi di bangsal rawat inap RSUI Kustati Surakarta. Penelitian ini termasuk jenis penelitian eksperimen. Populasi penelitian adalah pasien di bangsal rawat inap RSUI Kustati Surakarta. Teknik pengambilan sampel adalah purposive sampling. Penelitian Sawitri (2006) tentang pengaruh pemberian informasi pra bedah terhadap tingkat ansietas pada pasien pra bedah mayor di Bangsal Orthopedi RSUI Kustati Surakarta. Penelitian eksperimen ini berjenis one group pre testpost test dengan subjek sebanyak 58 pasien. pendekatan Penelitian Makmuri et.al (2007) tentang hubungan antara tingkat pendidikan pasien terhadap tingkat kecemasan pasien pre operatif fraktur femur diRumah Sakit Prof. Dr. Margono Soekarjo Purwokerto. Penelitian ini menggunakan metode penelitian deskriptif dengan studi korelasi (Correlation study). Populasi dalam penelitian ini adalah semua pasien fraktur femur yang dirawat di ruang orthopaedi rumah sakit Prof. Dr. Margono Soekarjo Purwokerto.

E. Kerangka Teori

Factor predisposisi 1. 2. 3. 4. 5. 6. 7. 8. Umur Pendidikan Status perkawinan Suku Pengetahuan Penghasilan Jenis kelamin pekerjaan

Factor Pemungkin 1. Sarana dan tempat berdoa 2. Ruang operasi 3. Perawat

KECEMASAN PRE OPERASI SEKSIO CAESAREA

Factor Penguat 1. Semangat dari keluarga 2. Jaminan kesehatan 3. Motivasi hidup pribadi

PENDIDIKAN KESEHATAN