Anda di halaman 1dari 224

PEMBINAANDANPENGEMBANGANPROFESIGURU BUKU2

PEDOMANPELAKSANAAN
PENILAIANKINERJAGURU (PKGURU)

DIREKTORATJENDERALPENINGKATANMUTU PENDIDIKDANTENAGAKEPENDIDIKAN KEMENTERIANPENDIDIKANNASIONAL 2010

http:\\www.bermutuprofesi.org

KATAPENGANTAR Pembelajaran merupakan jiwa institusi pendidikan yang mutunya wajib ditingkatkan secara terus menerus. Hal ini dapat dimengerti, karena peserta didik mendapatkan pengalaman belajar fomal terbanyak selama mengikuti proses pembelajaran di sekolah. Kondisi ini menuntut semua pihak untuk menyadari pentingnya peningkatan kualitas pembelajaran secara berkelanjutan, dimana guru adalah ujung tombaknya. Oleh sebab itu, profesi guru harus dihargai dan dikembangkan sebagai profesi yang berkualitas dan bermartabat. Profesi guru mempunyai fungsi, peran, dan kedudukan yang sangat penting dalam mencapai visi pendidikan,yaitumenciptakaninsanIndonesiayangcerdas,komprehensifdankompetitif. Masyarakat dan pemerintah mempunyai kewajiban untuk mewujudkan kondisi yang memungkinkan guru dapat melaksanakan pekerjaannya secara profesional, bukan hanya untuk kepentingan guru, namun juga untuk pengembangan peserta didik dan demi masa depan bangsa Indonesia. Dalam rangka membangun profesi guru sebagai profesi yang bermartabat, yakni untuk mencapai visi pendidikan nasional melalui proses pembelajaran yang berkualitas, maka perlu dilaksanakan penilaian kinerja guru (PK GURU) secara berkelanjutan dan teratur. Buku ini memberikan informasi tentang PK GURU, manfaatnya, danpelaksanaannyadisekolah. Ucapan terima kasih disampaikan kepada Tim Direktorat Profesi Pendidik di Direktorat Jenderal Peningkatan Mutu Pendidik dan Tenaga Kependidikan (PMPTK) yang telah memungkinkan terbitnya buku ini. Semoga buku ini dapat menjadi sumber acuan bagi semua pihakyangterlibatdalampelaksanaanPKGURU. Jakarta,Desember2010 DirekturJenderalPeningkatanMutuPendidik danTenagaKependidikan, Prof.Dr.Baedhowi,M.Si. NIP194908281979031001

DAFTARISI

KATAPENGANTAR......................................................................................................................i DAFTARISI .................................................................................................................................ii BABIPENDAHULUAN................................................................................................................1 A. LatarBelakang......................................................................................................................... 1 B. DasarHukum........................................................................................................................... 2 C. Tujuan......................................................................................................................................2 BABIIKONSEPPENILAIANKINERJAGURU.................................................................................3 A. PengertianPKGURU................................................................................................................ 3 B. SyaratSistemPKGURU........................................................................................................... 4 C. PrinsipPelaksanaanPKGURU................................................................................................. 4 D. AspekyangDinilaidalamPKGURU......................................................................................... 5 E. PerangkatPelaksanaanPKGURU............................................................................................ 8 BABIIIPROSEDURPELAKSANAANPKGURUDANKONVERSIHASILPKGURUKEANGKA KREDIT .....................................................................................................................................13 A. ProsedurdanWaktuPelaksanaanPKGURU.........................................................................13 B. KonversiNilaiHasilPKGURUkeAngkaKredit......................................................................19 C. PenilaidalamPKGURU.......................................................................................................... 28 D. Sanksi.....................................................................................................................................29 BABIVTUGASDANTANGGUNGJAWABPIHAKTERKAIT.........................................................31 A. TugasdanTanggungJawabTingkatPusat:KementerianPendidikanNasional...................32 B. TugasdanTanggungJawabTingkatProvinsi:DinasPendidikanProvinsidanLPMP............32 C. TugasdanTanggungJawabTingkatKabupaten/Kota:DinasPendidikanKabupaten/Kota.32 D. TugasdanTanggungJawabTingkatKecamatan:UPTDDinasPendidikan...........................33 E. TugasdanTanggungJawabTingkatSekolah.........................................................................33 BABVPENJAMINANMUTU,MONITORINGDANEVALUASIPELAKSANAANPKGURU ..............35 A. Penjaminanmutu.................................................................................................................. 35 B. MonitoringdanEvaluasiProgram........................................................................................ 35 C. LaporanMonitoringdanEvaluasiProgramPKGURU...........................................................36 PENUTUP.................................................................................................................................39 LAMPIRAN1:InstrumenPKGuruKelas/MataPelajaran..........................................................41 LAMPIRAN2:InstrumenPKGuruBimbingandanKonseling/Konselor.....................................89 LAMPIRAN3:InstrumenPKGurudenganTugasTambahanyangRelevandenganFungsi Sekolah/Madrasah..........................................................................................137 LAMPIRAN4:FormatPerhitunganAngkaKreditTugasTambahan........................................213 LAMPIRAN5:LaporanKendaliKinerjaGuru..........................................................................219

ii

BABI PENDAHULUAN A. LatarBelakang Guru adalah pendidik profesional yang mempunyai tugas, fungsi, dan peran penting dalam mencerdaskan kehidupan bangsa. Guru yang profesional diharapkan mampu berpartisipasi dalam pembangunan nasional untuk mewujudkan insan Indonesia yang bertakwakepadaTuhanYME,ungguldalamilmupengetahuandanteknologi,memiliki jiwa estetis, etis, berbudi pekerti luhur, dan berkepribadian. Tidaklah berlebihan kalau dikatakan bahwa masa depan masyarakat, bangsa dan negara, sebagian besar ditentukan oleh guru. Oleh sebab itu, profesi guru perlu dikembangkan secara terus menerusdanproporsionalmenurutjabatanfungsionalguru.Selainitu,agarfungsidan tugas yang melekat pada jabatan fungsional guru dilaksanakan sesuai dengan aturan yang berlaku, maka diperlukan Penilaian Kinerja Guru (PK GURU) yang menjamin terjadinyaprosespembelajaranyangberkualitasdisemuajenjangpendidikan. Pelaksanaan PK GURU dimaksudkan bukan untuk menyulitkan guru, tetapi sebaliknya PK GURU dilaksanakan untuk mewujudkan guru yang profesional, karena harkat dan martabat suatu profesi ditentukan oleh kualitas layanan profesi yang bermutu. Menemukan secara tepat tentang kegiatan guru di dalam kelas, dan membantu mereka untuk meningkatkan pengetahuan dan keterampilannya, akan memberikan kontribusi secara langsung pada peningkatan kualitas pembelajaran yang dilakukan, sekaligus membantu pengembangan karir guru sebagai tenaga profesional. Oleh karena itu, untuk meyakinkan bahwa setiap guru adalah seorang profesional di bidangnya dan sebagai penghargaan atas prestasi kerjanya, maka PK GURU harus dilakukan terhadap guru di semua satuan pendidikan formal yang diselenggarakan oleh pemerintah, pemerintah daerah, dan masyarakat. Guru yang dimaksud tidak terbatas pada guru yang bekerja di satuan pendidikan di bawah kewenangan Kementerian Pendidikan Nasional, tetapi juga mencakup guru yang bekerja di satuan pendidikandilingkunganKementerianAgama. Hasil PK GURU dapat dimanfaatkan untuk menyusun profil kinerja guru sebagai input dalam penyusunan program Pengembangan Keprofesian Berkelanjutan (PKB). Hasil PK GURU juga merupakan dasar penetapan perolehan angka kredit guru dalam rangka pengembangankarirgurusebagaimanadiamanatkandalamPeraturanMenteriNegara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009 tentang Jabatan Fungsional Guru dan Angka Kreditnya. Jika semua ini dapat dilaksanakandenganbaikdanobyektif,makacitacitapemerintahuntukmenghasilkan insanyangcerdaskomprehensifdanberdayasaingtinggilebihcepatdirealisasikan. Memperhatikan kondisi jabatan guru sebagai profesi dan kebijakan pemerintah dalam pengembangan profesi guru maka diperlukan pedoman pelaksanaan PK GURU yang menjelaskan tentang apa, mengapa, kapan, bagaimana dan oleh siapa PK GURU dilaksanakan. Penyusunan pedoman ini mengacu pada Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi di atas sebagai acuan pelaksanaanPKGURUdisekolahuntukmempermudahprosespenilaian.

B. DasarHukum 1. UndangUndangNomor20Tahun2003tentangSistemPendidikanNasional. 2. UndangUndangNomor14Tahun2005tentangGurudanDosen. 3. PeraturanPemerintahNomor74tahun2008tentangGuru. 4. Peraturan Menteri Pendidikan Nasional Nomor 16 Tahun 2007 tentang Standar KualifikasiAkademikdanKompetensiGuru. 5. Peraturan Menteri Pendidikan Nasional Nomor 27 Tahun 2008 tentang Standar KualifikasidanKompetensiKonselor. 6. Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009 tentang Jabatan Fungsional Guru dan Angka Kreditnya. 7. Peraturan Menteri Pendidikan Nasional Nomor 28 Tahun 2010 tentang Penugasan GurusebagaiKepalaSekolah/Madrasah. 8. Peraturan Bersama Menteri Pendidikan Nasional dan Kepala Badan Kepegawaian Negara Nomor 14 Tahun 2010 dan Nomor 03/V/PB/2010 tentang Petunjuk PelaksanaanJabatanFungsionalGurudanAngkaKreditnya. 9. Peraturan Menteri Pendidikan Nasional Nomor 35 tahun 2010 tentang Petunjuk TeknisPelaksanaanJabatanFungsionalGurudanAngkaKreditnya. C. Tujuan Pedoman pelaksanaan PK GURU ini disusun untuk memperluas pemahaman semua pihak terkait tentang prinsip, proses, dan prosedur pelaksanaan PK GURU, sebagai suatusistempenilaiankinerjayangberbasisbukti(evidencebasedappraisal).

BABII KONSEPPENILAIANKINERJAGURU A. PengertianPKGURU Menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009, PK GURU adalah penilaian dari tiap butir kegiatan tugas utama guru dalam rangka pembinaan karir, kepangkatan, dan jabatannya. Pelaksanaan tugas utama guru tidak dapat dipisahkan dari kemampuan seorang guru dalam penguasaan pengetahuan, penerapan pengetahuan dan keterampilan, sebagai kompetensi yang dibutuhkan sesuai amanat Peraturan Menteri Pendidikan Nasional Nomor 16 Tahun 2007 tentang Standar Kualifikasi Akademik dan Kompetensi Guru. Penguasaan kompetensi dan penerapan pengetahuan serta keterampilan guru, sangat menentukan tercapainya kualitas proses pembelajaran atau pembimbingan peserta didik, dan pelaksanaan tugas tambahan yang relevan bagi sekolah/madrasah, khususnya bagi guru dengan tugas tambahan tersebut. Sistem PK GURU adalah sistem penilaian yang dirancang untuk mengidentifikasi kemampuan guru dalam melaksanakantugasnyamelaluipengukuranpenguasaankompetensiyangditunjukkan dalamunjukkerjanya. Secaraumum,PKGURUmemiliki2fungsiutamasebagaiberikut. 1. Untuk menilai kemampuan guru dalam menerapkan semua kompetensi dan keterampilan yang diperlukan pada proses pembelajaran, pembimbingan, atau pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Dengan demikian, profil kinerja guru sebagai gambaran kekuatan dan kelemahan guru akan teridentifikasi dan dimaknai sebagai analisis kebutuhan atau audit keterampilan untuk setiap guru, yang dapat dipergunakan sebagai basis untuk merencanakanPKB. 2. Untuk menghitung angka kredit yang diperoleh guru atas kinerja pembelajaran, pembimbingan, atau pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang dilakukannya pada tahun tersebut. Kegiatan penilaian kinerja dilakukan setiaptahun sebagai bagian dari proses pengembangan karir dan promosiguruuntukkenaikanpangkatdanjabatanfungsionalnya. Hasil PK GURU diharapkan dapat bermanfaat untuk menentukan berbagai kebijakan yang terkait dengan peningkatan mutu dan kinerja guru sebagai ujung tombak pelaksanaan proses pendidikan dalam menciptakan insan yang cerdas, komprehensif, dan berdaya saing tinggi. PK GURU merupakan acuan bagi sekolah/madrasah untuk menetapkan pengembangan karir dan promosi guru. Bagi guru, PK GURU merupakan pedoman untuk mengetahui unsurunsur kinerja yang dinilai dan merupakan sarana untuk mengetahui kekuatan dan kelemahan individu dalam rangka memperbaiki kualitaskinerjanya. PK GURU dilakukan terhadap kompetensi guru sesuai dengan tugas pembelajaran, pembimbingan, atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Khusus untuk kegiatan pembelajaran atau pembimbingan, kompetensi yang dijadikan dasar untuk penilaian kinerja guru adalah kompetensi pedagogik, profesional, sosial dan kepribadian, sebagaimana ditetapkan dalam Peraturan Menteri Pendidikan

Nasional Nomor 16 Tahun 2007. Keempat kompetensi ini telah dijabarkan menjadi kompetensi guru yang harus dapat ditunjukkan dan diamati dalam berbagai kegiatan, tindakan dan sikap guru dalam melaksanakan pembelajaran atau pembimbingan. Sementara itu, untuk tugas tambahan yang relevan dengan fungsi sekolah/madrasah, penilaian kinerjanya dilakukan berdasarkan kompetensi tertentu sesuai dengan tugas tambahan yang dibebankan tersebut (misalnya; sebagai kepala sekolah/madrasah, wakil kepala sekolah/madrasah, pengelola perpustakaan, dan sebagainya sesuai dengan Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi BirokrasiNomor16Tahun2009). B. SyaratSistemPKGURU PersyaratanpentingdalamsistemPKGURUadalah: 1. Valid Sistem PK GURU dikatakan valid bila aspek yang dinilai benarbenar mengukur komponenkomponen tugas guru dalam melaksanakan pembelajaran, pembimbingan,dan/atautugaslainyangrelevandenganfungsisekolah/madrasah. 2. Reliabel SistemPKGURUdikatakanreliabelataumempunyaitingkatkepercayaantinggijika proses yang dilakukan memberikan hasil yang sama untuk seorang guru yang dinilaikinerjanyaolehsiapapundankapanpun. 3. Praktis Sistem PK GURU dikatakan praktis bila dapat dilakukan oleh siapapun dengan relatif mudah, dengan tingkat validitas dan reliabilitas yang sama dalam semua kondisitanpamemerlukanpersyaratantambahan. Salah satu karakteristik dalam desain PK GURU adalah menggunakan cakupan kompetensidan indikator kinerjayang sama bagi 4 (empat) jenjang jabatan fungsional guru(GuruPertama,GuruMuda,GuruMadya,danGuruUtama). C. PrinsipPelaksanaanPKGURU PrinsipprinsiputamadalampelaksanaanPKGURUadalahsebagaiberikut. 1. Berdasarkanketentuan PKGURUharusdilaksanakansesuaidenganprosedurdanmengacupadaperaturan yangberlaku. 2. Berdasarkankinerja AspekyangdinilaidalamPKGURUadalahkinerjayangdapatdiamatidandipantau, yang dilakukan guru dalam melaksanakan tugasnya seharihari, yaitu dalam melaksanakan kegiatan pembelajaran, pembimbingan, dan/atau tugas tambahan yangrelevandenganfungsisekolah/madrasah. 3. BerlandaskandokumenPKGURU Penilai, guru yang dinilai, dan unsur yang terlibat dalam proses PK GURU harus memahami semua dokumen yang terkait dengan sistem PK GURU. Guru dan penilai harus memahami pernyataan kompetensi dan indikator kinerjanya secara utuh, sehingga keduanya mengetahui tentang aspek yang dinilai serta dasar dan kriteriayangdigunakandalampenilaian.

4. Dilaksanakansecarakonsisten PK GURU dilaksanakan secara teratur setiap tahun diawali dengan penilaian formatifdiawaltahundanpenilaiansumatifdiakhirtahundenganmemperhatikan halhalberikut. a) Obyektif Penilaiankinerjagurudilaksanakansecaraobyektifsesuaidengankondisinyata gurudalammelaksanakantugasseharihari. b) Adil Penilai kinerja guru memberlakukan syarat, ketentuan, dan prosedur standar kepadasemuaguruyangdinilai. c) Akuntabel Hasilpelaksanaanpenilaiankinerjagurudapatdipertanggungjawabkan. d) Bermanfaat Penilaiankinerjagurubermanfaatbagigurudalamrangkapeningkatankualitas kinerjanyasecaraberkelanjutandansekaliguspengembangankarirprofesinya. e) Transparan Prosespenilaiankinerjagurumemungkinkanbagipenilai,guruyangdinilai,dan pihak lain yang berkepentingan, untuk memperoleh akses informasi atas penyelenggaraanpenilaiantersebut. f) Praktis Penilaian kinerja guru dapat dilaksanakan secara mudah tanpa mengabaikan prinsipprinsiplainnya. g) Berorientasipadatujuan Penilaiandilaksanakandenganberorientasipadatujuanyangtelahditetapkan. h) Berorientasipadaproses Penilaian kinerja guru tidak hanya terfokus pada hasil, namun juga perlu memperhatikanproses,yaknibagaimanagurudapatmencapaihasiltersebut. i) Berkelanjutan Penilaian kinerja guru dilaksanakan secara periodik, teratur, dan berlangsung secaraterusmenerusselamaseseorangmenjadiguru. j) Rahasia Hasil PK GURU hanya boleh diketahui oleh pihakpihak terkait yang berkepentingan. D. AspekyangDinilaidalamPKGURU Guru sebagai pendidik profesional mempunyai tugas utama mendidik, mengajar, membimbing, mengarahkan, melatih, menilai, dan mengevaluasi peserta didik pada pendidikan anak usia dini jalur pendidikan formal, pendidikan dasar, dan pendidikan menengah. Selain tugas utamanya tersebut, guru juga dimungkinkan memiliki tugas tugas lain yang relevan dengan fungsi sekolah/madrasah. Oleh karena itu, dalam penilaiankinerjagurubeberapasubunsuryangperludinilaiadalahsebagaiberikut. 1. Penilaian kinerja yang terkait dengan pelaksanaan proses pembelajaran bagi guru mata pelajaran atau guru kelas, meliputi kegiatan merencanakan dan melaksanakan pembelajaran, mengevaluasi dan menilai, menganalisis hasil penilaian, dan melaksanakan tindak lanjut hasil penilaian dalam menerapkan 4 (empat)domainkompetensiyangharusdimilikiolehgurusesuaidenganPeraturan Menteri Pendidikan Nasional Nomor 16 Tahun 2007 tentang Standar Kualifikasi

Akademik dan Kompetensi Guru. Pengelolaan pembelajaran tersebut mensyaratkan guru menguasai 24 (dua puluh empat) kompetensi yang dikelompokkan ke dalam kompetensi pedagogik, kepribadian, sosial, dan profesional. Untuk mempermudah penilaian dalam PK GURU, 24 (dua puluh empat) kompetensi tersebut dirangkum menjadi 14 (empat belas) kompetensi sebagaimana dipublikasikan oleh Badan Standar Nasional Pendidikan (BSNP). RincianjumlahkompetensitersebutdiuraikandalamTabel1.
Tabel1.KompetensiGuruKelas/GuruMataPelajaran No 1 2 3 4 RanahKompetensi Pedagogik Kepribadian Sosial Profesional Total Jumlah Kompetensi Indikator 7 45 3 18 2 6 2 9 14 78

2. Penilaian kinerja dalam melaksanakan proses pembimbingan bagi guru Bimbingan Konseling (BK)/Konselor meliputi kegiatan merencanakan dan melaksanakan pembimbingan, mengevaluasi dan menilai hasil bimbingan, menganalisis hasil evaluasi pembimbingan, dan melaksanakan tindak lanjut hasil pembimbingan. Berdasarkan Peraturan Menteri Pendidikan Nasional Nomor 27 Tahun 2008 tentang Standar Kualifikasi Akademik dan Kompetensi Konselor terdapat 4 (empat) ranah kompetensi yang harus dimiliki oleh guru BK/Konselor. Penilaian kinerja guru BK/konselor mengacu pada 4 domain kompetensi tersebut yang mencakup17(tujuhbelas)kompetensisepertidiuraikandalamTabel2.
Tabel2.KompetensiGuruBimbinganKonseling/Konselor No 1 2 3 4 RanahKompetensi Pedagogik Kepribadian Sosial Profesional Total Jumlah Kompetensi 3 4 3 7 17 Indikator 9 14 10 36 69

3. Kinerja yang terkait dengan pelaksanaan tugas tambahan yang relevan dengan fungsisekolah/madrasah.Pelaksanaantugastambahaninidikelompokkanmenjadi 2,yaitutugastambahanyangmengurangijammengajartatapmukadanyangtidak mengurangi jam mengajar tatap muka. Tugas tambahan yang mengurangi jam mengajartatapmukameliputi:(1)menjadikepalasekolah/madrasahpertahun;(2) menjadi wakil kepala sekolah/madrasah per tahun; (3) menjadi ketua program keahlian/program studi atau yang sejenisnya; (4) menjadi kepala perpustakaan; atau(5)menjadikepalalaboratorium,bengkel,unitproduksi,atauyangsejenisnya. Tugas tambahan yang tidak mengurangi jam mengajar tatap muka dikelompokkan menjadi 2 juga, yaitu tugas tambahan minimal satu tahun (misalnya menjadi wali kelas, guru pembimbing program induksi, dan sejenisnya) dan tugas tambahan kurang dari satu tahun (misalnya menjadi pengawas penilaian dan evaluasi pembelajaran,penyusunankurikulum,dansejenisnya). 6

Penilaiankinerjagurudalammelaksanakantugastambahanyangmengurangaijam mengajar tatap muka dinilai dengan menggunakan instrumen khusus yang dirancangberdasarkankompetensiyangdipersyaratkanuntukmelaksanakantugas tambahan tersebut. Rincian jumlah kompetensi dan jumlah indikator pelaksanaan tugastambahandisampaikandalamTabel3,4,5,6,dan7. a) Tugastambahansebagaikepalasekolah/madrasah
Tabel3.Kompetensikepalasekolah/madrasah No 1 2 3 4 5 6 Kompetensi KepribadiandanSosial Kepemimpinan PengembanganSekolah/Madrasah PengelolaanSumberDaya Kewirausahaan SupervisiPembelajaran Total Kriteria 7 10 7 8 5 3 40

b) Tugastambahansebagaiwakilkepalasekolah/madrasah
Tabel4:Kompetensiwakilkepalasekolah/madrasah

No

Kompetensi

Kriteria

1 KepribadiandanSosial 7 2 Kepemimpinan 10 3 PengembanganSekolah/ 7 Madrasah 4 Kewirausahaan 5 JumlahKriteria 29 Jumlahkriteriakeempatkompetensitersebutkemudian ditambahkandenganbanyaknyakriteriabidangtugastertentu yangdiampuolehwakilkepalasekolah/madrasahyang bersangkutan 5 Akademik 4 Kesiswaan 3 Saranadanprasarana 3 Hubungan masyarakat Contoh:jikaseorangwakilkepalasekolah/madrasahmengampubidang akademik,makatotalkriteriapenilaiankompetensinyaadalah29+5=34

c) Tugastambahansebagaikepalaperpustakaan
Tabel5.Kompetensikepalaperpustakaan No 1 2 3 4 5 6 Kompetensi Perencanaankegiatanperpustakaan Pelaksanaanprogramperpustakaan Evaluasiprogramperpustakaan Pengembangankoleksiperpustakaan Pengorganisasianlayananjasa informasi perpustakaan Penerapanteknologiinformasidankomunikasi Kriteria 8 9 8 8 8 4

No 7 8 9 10

Kompetensi Promosiperpustakaandanliterasiinformasi Pengembangankegiatanperpustakaan sebagaisumberbelajarkependidikan Kepemilikanintegritasdanetoskerja Pengembanganprofesionalitas kepustakawanan Total

Kriteria 4 4 8 4 65

d) Tugastambahansebagaikepalalaboratorium/bengkel/sejenisnya
Tabel6.Kompetensikepalalaboratorium/bengkel/sejenisnya No 1 2 3 4 5 6 7 Kompetensi Kepribadian Sosial Pengorganisasianguru,laboran/teknisi Pengelolaanprogramdan administrasi Pengelolaanpemantauandan evaluasi Pengembangandaninovasi LingkungandanK3 Total Kriteria 11 5 6 7 7 5 5 46

e) Tugastambahansebagaiketuaprogramkeahlian
Tabel7:Kompetensiketuaprogramkeahlian No 1 2 3 4 5 6 7 8 Kompetensi Kepribadian Sosial Perencanaan PengelolaanPembelajaran PengelolaanSumberDayaManusia PengelolaanSaranadanPrasarana PengelolaanKeuangan EvaluasidanPelaporan Total Kriteria 6 4 5 6 4 4 4 4 37

Tugas tambahan lain yang tidak mengurangi jam mengajar guru dihargai langsung sebagaiperolehanangkakreditsesuaiketentuanyangberlaku. E. PerangkatPelaksanaanPKGURU Perangkat yang harus digunakan oleh penilai untuk melaksanakan PK GURU agar diperoleh hasil penilaian yang obyektif, akurat, tepat, valid, dan dapat dipertanggung jawabkanadalah: 1. PedomanPKGURU Pedoman PK GURU mengatur tentang tata cara penilaian dan normanorma yang harus ditaati oleh penilai, guru yang dinilai, serta unsur lain yang terlibat dalam prosespenilaian. 8

2. Instrumenpenilaiankinerja Instrumenpenilaiankinerjayangrelevandengantugasguru,terdiridari: a. Instrumen1: PelaksanaanPembelajaranuntukgurukelas/matapelajaran(Lampiran1); b. Instrumen2: Pelaksanaan Pembimbingan untuk guru Bumbingan dan Konseling/Konselor (Lampiran2);dan c. Instrumen3: Pelaksanaan Tugas Tambahan yang relevan dengan fungsi sekolah/madrasah (Lampiran 3). Instrumen3 terdiri dari beberapa instrumen terpisah sesuai dengantugastambahanyangdiembanguru. Instrumen penilaian kinerja pelaksaaan pembelajaran atau pembimbingan terdiri dari: 1) Lembarpernyataankompetensi,indikator,dancaramenilai Lembar ini berisi daftar dan penjelasan tentang ranah kompetensi, kompetensi, dan indikator kinerja guru yang harus diukur melalui pengamatan danpemantauan(Lampiran1AatauLampiran2A). 2) Formatlaporandanevaluasiperkompetensi Format catatan dan evaluasi penilaian kinerja per kompetensi digunakan untuk mencatat semua hasil pengamatan dan pemantauan yang telah dilakukan, sebagai bukti pelaksanaan penilaian kinerja guru. Catatan ini harus dilengkapi dengan buktibukti fisik tertentu, misalnya dokumen pembelajaran dan penilaian, alat peraga dan media pembelajaran, atau dokumen lain yang menguatkan bukti kinerja guru. Berdasarkan catatan hasil pengamatan dan pemantauansertabuktifisikyangada,penilaidisekolahmemberikanskor0,1, 2, pada setiap indikator kinerja guru pada tabel yang disediakan. Persentase perolehan skor per kompetensi kemudian dikonversikan ke nilai 1, 2, 3, 4, (Lampiran1BatauLampiran2B). 3) FormatrekaphasilPKGURU Nilai per kompetensi kemudian direkapitulasi ke format rekap hasil PK GURU untuk mendapatkan nilai total PK GURU (Lampiran 1C atau Lampiran 2C). Nilai inilah yang selanjutnya dikonversi ke skala nilai kinerja menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009 untuk diperhitungkan sebagai perolehan angka kredit guru di tahun tersebut. Format rekap hasil PK GURU dipergunakan untuk merekapitulasi hasil PK GURU formatif dan sumatif. Format ini juga dipergunakanuntukmemantaukemajuanguruyanghasilPKGURUformatifnya mempunyai nilai di bawah standar (1 dan/atau 2), lihat panduan program PKB. Ketiga format rekap hasil PK GURU (formatif, sumatif, dan kemajuan) akan dipergunakan sebagai masukan untuk menyusun laporan kendali kinerja guru. Fomat rekap hasil PK GURU sumatif dipergunakan sebagai dasar penghitungan angkakreditbagitimpenilaijabatanfungsionalguruditingkatkabupaten/kota, provinsi,ataupusatsesuaikewenangannya. 4) Formatperhitunganangkakredit Setelah memperoleh nilai total PK GURU untuk pembelajaran, pembimbingan atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah, penilai

dapat melakukan perhitungan angka kredit. Perhitungan angka kredit hasil PK GURU dapat dilakukan di sekolah tetapi sifatnya hanya untuk keperluan estimasi perolehan angka kredit. Bagi tim penilai di tingkat kabupaten/kota, angka kredit hasil perhitungan tim penilai tersebut akan dipergunakan sebagai dasar penetapan perolehan angka kredit guru (Lampiran 1D atau Lampiran 2D). Instrumen penilaian kinerja pelaksaaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah (Lampiran 3) secara umum terdiri dari bagianbagian berikut. 1) PetunjukPenilaian Petunjuk penilaian berisi penjelasan tentang cara menilai, teknik pengumpulan data, pemberian skor, penilai dan persyaratannya, pelaksanaan penilaian dan hasil penilaian. Petunjuk pengisian ini harus dipahami oleh para penilai kinerja gurudengantugastambahanyangrelevandenganfungsisekolah/madrasah. 2) FormatIdentitasDiri Format ini harus diisi dengan identitas diri guru yang dinilai sesuai dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Selain itu, formatinijugaperludiisidenganidentitaspenilai.Guruyangdinilaidanpenilai harusmenandatanganiformatidentitasdiriini. 3) FormatPenilaianKinerja Format ini terdiri dari beberapa tabel menurut banyaknya kompetensi yang akan dinilai sesuai dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang ditugaskan kepada guru. Setiap tabel berisi penjelasan tentang kriteria/indikator penilaian untuk masingmasing kompetensi, catatan buktibukti yang teridentifikasi selama penilaian, skor yang diberikan, perhitunganjumlahskor,skorrataratauntuksetiapkompetensi,sertadiskripsi penilaian kinerja yang dilakukan oleh penilai. Format ini diisi oleh penilai di sekolahsesuaidenganhasilpengamatan,wawancara,dan/ataustudidokumen yangdilakukanolehpenilaiselamaprosespenilaiankinerja. 4) FormatRekapitulasiPenilaianKinerja Perolehan skor ratarata untuk setiap kompetensi kemudian direkap oleh penilaipadaformatrekapitulasipenilaiankinerja.Skorrataratamasingmasing kompetensi dicantumkan dan dijumlahkan dalam format tersebut untuk selanjutnya dikonversikan ke skala nilai 0 100 sesuai dengan Permenneg PAN & RB No. 16 Tahun 2009. Jika kedua penilai dan guru yang dinilai telah mencapai kesepakatan terhadap hasil penilaian, maka penilai dan guru yang dinilaiharusmenandatanganiformatrekapitulasipenilaiankinerjatersebut. 5) FormatTambahan Dalam beberapa instrumen tugas tambahan yang relevan dengan fungsi sekolah/madrasah, terdapat beberapa format tambahan. Misalnya untuk penilaian kinerja guru dengan tugas tambahan sebagai kepala perpustakaan, memiliki format tambahan hasil penilaian dan rincian kegiatan guru sehubungan dengan tugastugas pengelolaan perpustakaan. Format tambahan guru dengan tugas tambahan sebagai kepala laboratorium/bengkel dilengkapi dengan format pendalaman terhadap teman sejawat dan/atau peserta didik

10

dari guru yang dinilai. Format tambahan ini berupa formatformat yang harus diisiolehpenilaisesuaidengandatadaninformasiyangdiperolehnya. 3. Laporankendalikinerjaguru Hasil PK GURU untuk masingmasing individu guru (guru pembelajaran, guru bimbingandankonseling/konselor,maupunguruyangdiberitugastambahanyang relevandenganfungsisekolah/madrasah)kemudiandirekapdalamformatlaporan kendali kinerja guru (Lampiran 4). Pada format ini dicantumkan hasil PK GURU formatif, sasaran nilai PK GURU yang akan dicapai setelah guru mengikuti proses PKB, dan hasil PK GURU sumatif untuk beberapa tahun ke depan. Dengan demikian, kinerja guru akan dapat dipantau dan dapat diarahkan dalam upaya peningkatan kinerja guru yang bersangkutan agar mampu memberikan layanan pendidikanyangberkualitaskepadapesertadidik.

11

12

BABIII PROSEDURPELAKSANAANPKGURU DANKONVERSIHASILPKGURUKEANGKAKREDIT A. ProsedurdanWaktuPelaksanaanPKGURU 1. WaktuPelaksanaan PK GURU dilakukan 2 (dua) kali setahun, yaitu pada awal tahun ajaran (penilaian formatif)danakhirtahunajaran(penilaiansumatif). a. PKGuruFormatif PK GURU formatif digunakan untuk menyusun profil kinerja guru dan harus dilaksanakan dalam kurun waktu 6 (enam) minggu di awal tahun ajaran. Berdasarkan profil kinerja guru ini dan hasil evaluasi diri yang dilakukan oleh gurusecaramandiri,sekolah/madrasahmenyusunrencanaPKB. Bagi guruguru dengan PK GURU di bawah standar, program PKB diarahkan untuk pencapaian standar kompetensi tersebut. Sementara itu, bagi guruguru dengan PK GURU yang telah mencapai atau di atas standar, program PKB diorientasikan untuk meningkatkan atau memperbaharui pengetahuan, keterampilan,dansikapdanperilakukeprofesiannya. b. PKGuruSumatif PK GURU sumatif digunakan untuk menetapkan perolahan angka kredit guru pada tahun tersebut. PK GURU sumatif juga digunakan untuk menganalisis kemajuan yang dicapai guru dalam pelaksanaan PKB, baik bagi guru yang nilainya masih di bawah standar, telah mencapai standar, atau melebihi standar kompetensi yang ditetapkan. PK Guru sumatif harus sudah dilaksanakan6(enam)minggusebelumpenetapanangkakreditseorangguru. 2. ProsedurPelaksanaan Secara spesifik terdapat perbedaan prosedur pelaksanaan PK GURU pembelajaran atau pembimbingan dengan prosedur pelaksanaan PK GURU untuk tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Meskipun demikian, secaraumumkegiatanpenilaianPKGURUditingkatsekolahdilaksanakandalam4 (empat)tahapan,sebagaimanatercantumpadaGambar1.
Persiapan Sekolah/Dinas Pendidikan

Pelaksanaan

Pemberian Nilai

Moderator

Setuju
Ya

Tidak

Pelaporan (Pengusulan PAK)

Gambar1.TahapanPelaksanaanPKGURUditingkatSekolah/Madrasah

13

a. TahapPersiapan Dalamtahappersiapan,halhalyangharusdilakukanolehpenilaimaupunguru yangakandinilai. 1) memahami Pedoman PK GURU, terutama tentang sistem yang diterapkan danposisiPKGURUdalamkerangkapembinaandanpengembanganprofesi guru; 2) memahami pernyataan kompetensi guru yang telah dijabarkan dalam bentukindikatorkinerja; 3) memahami penggunaan instrumen PK GURU dan tata cara penilaian yang akan dilakukan, termasuk cara mencatat semua hasil pengamatan dan pemantauan, serta mengumpulkan dokumen dan bukti fisik lainnya yang memperkuathasilpenilaian;dan 4) memberitahukan rencana pelaksanaan PK GURU kepada guru yang akan dinilaisekaligusmenentukanrentangwaktujadwalpelaksanaannya. b. TahapPelaksanaan Beberapa tahapan PK GURU yang harus dilalui oleh penilai sebelum menetapkannilaiuntuksetiapkompetensi,adalahsebagaiberikut. 1) SebelumPengamatan Pertemuan awal antara penilai dengan guru yang dinilai sebelum dilakukan pengamatan dilaksanakan di ruang khusus tanpa ada orang ketiga. Pada pertemuanini,penilaimengumpulkandokumenpendukungdanmelakukan diskusi tentang berbagai hal yang tidak mungkin dilakukan pada saat pengamatan. Semua hasil diskusi, wajib dicatat dalam format laporan dan evaluasi per kompetensi (Lampiran 1B bagi PK Guru Pembelajaran dan Lampiran2BbagiPKGuruBK/Konselor)sebagaibuktipenilaiankinerja. Untuk pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah dapat dicatat dalam lembaran lain karena tidak ada formatkhususyangdisediakanuntukprosespencatatanini. 2) SelamaPengamatan Selama pengamatan di kelas dan/atau di luar kelas, penilai wajib mencatat semua kegiatan yang dilakukan oleh guru dalam pelaksanaan proses pembelajaran atau pembimbingan, dan/atau dalam pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Dalam konteks ini,penilaiankinerjadilakukandenganmenggunakaninstrumenyangsesuai untuk masingmasing penilaian kinerja. Untuk menilai guru yang melaksanakan proses pembelajaran atau pembimbingan, penilai menggunakan instrumen PK GURU pembelajaran atau pembimbingan. Pengamatan kegiatan pembelajarandapat dilakukan di kelasselama proses tatap muka tanpa harus mengganggu proses pembelajaran. Pengamatan kegiatanpembimbingandapatdilakukanselamaprosespembimbinganbaik yang dilakukan dalam kelas maupun di luar kelas, baik pada saat pembimbingan individu maupun kelompok. Penilai wajib mencatat semua hasil pengamatan pada format laporan dan evaluasi per kompetensi tersebut(Lampiran1BbagiPKGuruPembelajarandanLampiran2BbagiPK Guru Pembimbingan, BK/Konselor) atau lembar lain sebagai bukti penilaian kinerja. Jika diperlukan, proses pengamatan dapat dilakukan lebih dari satu

14

kali untuk memperoleh informasi yang akurat, valid dan konsisten tentang kinerja seorang guru dalam melaksanakan kegiatan pembelajaran atau pembimbingan. Dalam proses penilaian untuk tugas tambahan yang relevan dengan fungsi sekolah/madrasah, data dan informasi dapat diperoleh melalui pencatatan terhadap semua bukti yang teridentifikasi di tempat yang disediakan pada masingmasing kriteria penilaian. Buktibukti ini dapat diperoleh melalui pengamatan, wawancara dengan pemangku kepentingan pendidikan (guru, komite sekolah, peserta didik, DU/DI mitra). Buktibukti yang dimaksud dapatberupa: a) Buktiyangteramati(tangibleevidences)seperti: dokumendokumentertulis; kondisi sarana/prasarana (hardware dan/atau software) dan lingkungansekolah; foto,gambar,slide,video;dan produkproduksiswa. b) Buktiyangtakteramati(intangibleevidences)seperti: sikapdanperilakukepalasekolah;dan budayadaniklimsekolah 3) SetelahPengamatan Pada pertemuan setelah pengamatan pelaksanaan proses pembelajaran, pembimbingan, atau pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah, penilai dapat mengklarifikasi beberapa aspek tertentu yang masih diragukan. Penilai wajib mencatat semua hasil pertemuan pada format laporan dan evaluasi per kompetensi tersebut (Lampiran 1B bagi PK Guru Pembelajaran dan lampiran 2B bagi PK Guru Pembimbingan, BK/Konselor) atau lembar lain sebagai bukti penilaian kinerja. Pertemuan dilakukan di ruang khusus dan hanya dihadiri oleh penilai dan guru yang dinilai. Untuk penilaian kinerja tugas tambahan, hasilnya dapat dicatat pada Format Penilaian Kinerja sebagai deskripsi penilaiankinerja(lihatLampiran3). c. Tahappemberiannilai 1) Penilaian Pada tahap ini penilai menetapkan nilai untuk setiap kompetensi dengan skalanilai1,2,3,atau4.Sebelumpemberiannilaitersebut,penilaiterlebih dahulu memberikan skor 0, 1, atau 2 pada masingmasing indikator untuk setiap kompetensi. Pemberian skor ini harus didasarkan kepada catatan hasil pengamatan dan pemantauan serta buktibukti berupa dokumen lain yang dikumpulkan selama proses PK GURU. Pemberian nilai untuk setiap kompetensidilakukandengantahapansebagaiberikut. a) Pemberian skor 0, 1, atau 2 untuk masingmasing indikator setiap kompetensi.Pemberianskorinidilakukandengancaramembandingkan rangkuman catatan hasil pengamatan dan pemantauan di lembar format laporan dan evaluasi per kompetensi dengan indikator kinerja masingmasing kompetensi (lihat contoh di Tabel 8). Aturan pemberian skoruntuksetiapindikatoradalah: 15

Skor 0 menyatakan indikator tidak dilaksanakan, atau tidak menunjukkanbukti, Skor 1 menyatakan indikator dilaksanakan sebagian, atau ada bukti tetapitidaklengkap Skor 2 menyatakan indikator dilaksanakan sepenuhnya, atau ada buktiyanglengkap.
Tabel8.ContohPemberianNilaiKompetensitertentupadaprosesPKGURU Kelas/MataPelajaran/BimbinganKonseling/Konselor

PenilaianKompetensi1:Mengenalkarakteristikpesertadidik Indikator 1. 2. Gurudapatmengidentifikasikarakteristikbelajar setiappesertadidikdikelasnya. Gurumemastikanbahwasemuapesertadidik mendapatkankesempatanyangsamauntuk berpartisipasiaktifdalamkegiatanpembelajaran. Gurudapatmengaturkelasuntukmemberikan kesempatanbelajaryangsamapadasemuapeserta didikdengankelainanfisikdankemampuanbelajar yangberbeda. Gurumencobamengetahuipenyebabpenyimpangan perilakupesertadidikuntukmencegahagarperilaku tersebuttidakmerugikanpesertadidiklainnya. Gurumembantumengembangkanpotensidan mengatasikekuranganpesertadidik. Gurumemperhatikanpesertadidikdengan kelemahanfisiktertentuagardapatmengikuti aktivitaspembelajaran,sehinggapesertadidik tersebuttidaktermarginalkan(tersisihkan,diolok olok,minder,dsb.). 0 0 Skor 1 1 2 2

3.

4.

5. 6.

0 0

1 1

2 2

Totalskoryangdiperoleh SkorMaksimumKompetensi=banyaknyaindikator dikalikandenganskortertinggi Persentaseskorkompetensi=totalskoryangdiperoleh dibagidenganSkorMaksimumKompetensidikalikan 100% KonversiNilaiKompetensi(0%<X25%=1;25%<X 50%=2;50%<X75%=3;dan75%<X100%=4)

1+2+2+0+0+2=7 6x2=12 7/12x100%=58.33%

58.33% berada pada rentang 50 % < X 75 %, jadi kompetensi 1 ini nilainya3

Perolehan skor untuk setiap kompetensi tersebut selanjutnya dijumlahkan dan dihitung persentasenya dengan cara: membagi total skor yang diperoleh dengan total skor maksimum kompetensi dan mengalikannya dengan 100%. Perolehan persentase skor pada setiap kompetensi ini kemudian dikonversikan ke skala nilai 1, 2, 3, atau 4. Konversi skor 0, 1 dan 2 ke dalam nilai kompetensi dilakukan sesuai Tabel9.

16

Tabel9.Konversiskorkenilaikompetensi RentangTotalSkorX 0% < X 25% 25% <X50% 50% <X 75% 75% < X 100% NilaiKompetensi 1 2 3 4

Untuk guru dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah, penilaian dilakukan langsung dengan memberikan nilai 1, 2, 3, dan 4 untuk setiap kriteria/indikator pada kompetensi tertentu (lihat contoh Tabel 10). Kemudian, nilai setiap kriteria/indikator dijumlahkan dan hitung rataratanya. Nilai ratarata inimerupakannilaibagisetiapkompetensiterkait.
Tabel10.ContohPemberianNilaiKompetensitertentupadaprosesPKGURU dengantugastambahansebagaikepalasekolah Kompetensi6 :SupervisiPembelajaran(PKKS6) KRITERIA 1. Menyusunprogramsupervisiakademik dalamrangkapeningkatan profesionalismeguru. Melaksanakansupervisiakademik terhadapgurudenganmenggunakan pendekatandantekniksupervisiyang tepat. Menilaidanmenindaklanjutikegiatan supervisiakademikdalamrangka peningkatanprofesionalismeguru. BUKTIYANG TERIDENTIFIKASI SKOR 12 3 4

2.

12 3 4

3.

12 3 4

JumlahSkor SkorRataRata=JumlahSkor:3=8:3 DeskripsiKinerjayangTelahDilakukan:

8 2,7

Dengan demikian, penilaian kinerja guru dengan tugas tambahan tersebuttidakperlulagimengkonversikannyakenilai1,2,3,dan4. b) Nilai setiap kompetensi tersebut kemudian direkapitulasi dalam format hasil penilaian kinerja guru (Lampiran 1C bagi PK Guru Kelas/Mata Pelajaran atau 2C bagi PK Guru Bimbingan dan Konseling/Konselor) untuk mendapatkan nilai total PK GURU. Untuk penilaian kinerja guru dengan tugas tambahanyang relevan dengan fungsi sekolah/madrasah, nilai untuk setiap kompetensi direkapitulasi ke dalam format rekapitulasi penilaian kinerja untuk mendapatkan nilai PK GURU. Nilai total ini selanjutnya dikonversikan ke dalam skala nilai sesuai Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi

17

Birokrasi No. 16 Tahun 2009. Konversi ini dilakukan dengan menggunakanrumussebagaiberikut. Keterangan:
Nilai PKG (skala 100) maksudnya nilai PK Guru Kelas/Mata Pelajaran, Bimbingan dan Konseling/Konselor atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah dalam skala 0 100 menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor16Tahun2009. Nilai PKG adalah nilai PK GURU Kelas/Mata Pelajaran, Bimbingan dan Konseling/Konselor atau pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang diperoleh dalam proses PK GURU sebelum diubah dalam skala 0 100 menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009. NilaiPKGTertinggiadalahnilaitertinggiPKGURUyangdapatdicapai,yaitu56 (=14x4)bagiPKGURUpembelajaran(14kompetensi),dan68(=17x4)bagi PK Guru pembimbingan (17 kompetensi). Nilai tertinggi PK GURU dengan tugas tambahan disesuaikan dengan instrumen terkait untuk masingmasing tugastambahanyangsesuaidenganfungsisekolah/madrasah.
Nilai PKG (skala 100) = Nilai PKG Nilai PKG Tertinggi 100

c) Berdasarkan hasil konversi nilai PK GURU ke dalam skala nilai sesuai dengan PermenegPAN dan RB Nomor 16 tahun 2010 tentang Jabatan Fungsional Guru dan Angka Kreditnya, selanjutnya dapat ditetapkan sebutandanpersentaseangkakreditnyasebagaimanatercantumdalam tabel11. Tabel11.KonversiNilaiKinerjaHasilPKGURUkepersentaseAngkaKredit
NilaiHasilPKGURU 91 100 76 90 61 75 51 60 50 Sebutan Amatbaik Baik Cukup Sedang Kurang PersentaseAngka kredit 125% 100% 75% 50% 25%

d) Setelah melaksanakan penilaian, penilai wajib memberitahukan kepada guru yang dinilai tentang nilai hasil PK GURU berdasarkan bukti catatan untuk setiap kompetensi. Penilai dan guru yang dinilai melakukan refleksi terhadap hasil PK GURU, sebagai upaya untuk perbaikan kualitaskinerjagurupadaperiodeberikutnya. e) Jika guru yang dinilai dan penilai telah sepakat dengan hasil penilaian kinerja,makakeduanyamenandatanganiformatlaporanhasilpenilaian kinerja guru tersebut (Lampiran 1C untuk Guru Pembelajaran atau Lampiran 2C untuk Guru Pembimbingan BK/Konselor). Format ini juga ditandatanganiolehkepalasekolah. f) Khusus bagi guru yang mengajar di 2 (dua) sekolah atau lebih (guru multi sekolah/madrasah), maka penilaian dilakukan di sekolah/ madrasah induk. Meskipun demikian, penilai dapat melakukan pengamatan serta mengumpulkan data dan informasi dari sekolah/madrasahlaintempatgurumengajarataumembimbing. 18

2) PernyataanKeberatanterhadapHasilPenilaian Keputusan penilai terbuka untuk diverifikasi. Guru yang dinilai dapat mengajukan keberatan terhadap hasil penilaian tersebut. Keberatan disampaikan kepada Kepala Sekolah dan/atau Dinas Pendidikan, yang selanjutnya akan menunjuk seseorang yang tepat untuk bertindak sebagai moderator. Dalam hal ini moderator dapat mengulang pelaksanaan PK GURU untuk kompetensi tertentu yang tidak disepakati atau mengulang penilaian kinerja secara menyeluruh. Pengajuan usul penilaian ulang harus dicatat dalam laporan akhir. Dalam kasus ini, nilai PK GURU dari moderator digunakan sebagai hasil akhir PK GURU. Penilaian ulang hanya dapat dilakukan satu kali dan moderator hanya bekerja untuk kasus penilaian tersebut. d. Tahappelaporan SetelahnilaiPKGURUformatifdansumatifdiperoleh,penilaiwajibmelaporkan hasil PK GURU kepada pihak yang berwenang untuk menindaklanjuti hasil PK GURU tersebut. Hasil PK GURU formatif dilaporkan kepada kepala sekolah/koordinator PKB sebagai masukan untuk merencanakan kegiatan PKB tahunan. Hasil PK GURU sumatif dilaporkan kepada tim penilai tingkat kabupaten/kota, tingkat provinsi, atau tingkat pusat sesuai dengan kewenangannya. Laporan PK Guru sumatif ini digunakan oleh tim penilai tingkat kabupaten/kota, provinsi, atau pusat sebagai dasar perhitungan dan penetapan angka kredit (PAK) tahunan yang selanjutnya dipertimbangkan untuk kenaikan pangkat dan jabatan fungsional guru. Laporan mencakup: (1) Laporan dan evaluasi per kompetensi sesuai format; (ii) Rekap hasil PK GURU sesuaiformat;dan(iii)dokumenpendukunglainnya. Guru dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah dan mengurangibebanjammengajartatapmuka,dinilaidenganmenggunakan2(dua) instrumen, yaitu: (i) instrumen PK GURU pembelajaran atau pembimbingan; dan (ii) instrumen PK GURU pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Hasil PK GURU pelaksanaan tugas tambahan tersebut akan digabungkan dengan hasil PK GURU pelaksanaan pembelajaran atau pembimbingansesuaipersentaseyangditetapkandalamaturanyangberlaku. B. KonversiNilaiHasilPKGURUkeAngkaKredit Nilai kinerja guru hasil PK GURU perlu dikonversikan ke skala nilai menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009 tentang Jabatan Fungsional Guru dan Angka Kreditnya. Hasil konversi ini selanjutnya digunakan untuk menetapkan sebutan hasil PK GURU dan persentase perolehan angka kredit sesuai pangkat dan jabatan fungsional guru. Sebelum melakukan pengkonversian hasil PK GURU ke angka kredit, tim penilai harus melakukan verifikasi terhadap hasil PK GURU. Kegiatan verifikasi ini dilaksanakan dengan menggunakan berbagai dokumen (Hasil PK GURU yang direkapitulasi dalam Format Rekap Hasil PK GURU, catatan hasil pengamatan, studi dokumen, wawancara, dan sebagainya yang ditulis dalam Format Laporan dan Evaluasi per kompetensi beserta dokumen pendukungnya) yang disampaikan oleh sekolah untuk pengusulan

19

penetapanangkakredit.Jikadiperlukandandimungkinkan,kegiatanverifikasihasilPK GURU dapat mencakup kunjungan ke sekolah/madrasah oleh tim penilai tingkat kabupaten/kota,provinsi,ataupusat. Pengkonversian hasil PK GURU ke Angka Kredit adalah tugas Tim Penilai Angka Kredit kenaikan jabatan fungsional guru di tingkat kabupaten/kota, provinsi, atau pusat. Penghitungan angka kredit dapat dilakukan di tingkat sekolah, tetapi hanya untuk keperluan estimasi perolehan angka kredit guru. Angka kredit estimasi berdasarkan hasil perhitungan PK GURU yang dilaksanakan di sekolah, selanjutnya dicatat dalam formatpenghitunganangkakredityangditandatanganiolehpenilai,guruyangdinilai dan diketahui oleh kepala sekolah. Bersamasama dengan angka angka kredit dari unsur utama lainnya (pengembangan diri, publikasi ilmiah dan karya inovatif) dan unsur penunjang, hasil perhitungan PK GURU yang dilakukan oleh tim penilai tingkat kabupaten/kota, provinsi, atau pusat akan direkap dalam daftar usulan penetapan angka kredit (DUPAK) untuk proses penetapan angka kredit kenaikan jabatan fungsionalguru. 1. Konversi nilai PK GURU bagi guru tanpa tugas tambahan yang relevan dengan fungsisekolah/madrasah Konversi nilai PK GURU ke angka kredit dilakukan berdasarkan Tabel 11 di atas. Selanjutnya, berdasarkan Permenneg PAN dan RB Nomor 16 Tahun 2009, perolehan angka kredit untuk pembelajaran atau pembimbingan setiap tahun bagi gurudiperhitungkandenganrumussebagaiberikut: (AKK AKPKB AKP) JM NPK JWM Angka kredit per tahun = 4
Keterangan: AKKadalahangkakreditkumulatifminimalyangdipersyaratkanuntukkenaikanpangkat. AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri, karya ilmiah,dan/ataukaryainovatif). AKPadalahangkakreditunsurpenunjangsesuainketentuanPermenegPANdanRBNomor 16Tahun2009. JM adalah jumlah jam mengajar (tatap muka) guru di sekolah/madrasah atau jumlah konseliyangdibimbingolehguruBK/Konselorpertahun. JWM adalah jumlah jam wajib mengajar (24 40 jam tatap muka per minggu) bagi guru pembelajaran atau jumlah konseli (150 250 konseli per tahun) yang dibimbing oleh guru BK/Konselor. NPKadalahpersentaseperolehanangkakreditsebagaihasilpenilaiankinerja. 4adalahwakturataratakenaikanpangkatreguler,(4tahun). JM/JWM = 1 bagi guru yang mengajar 2440 jam tatap muka per minggu atau membimbing150250konselipertahun. JM/JWM = JM/24 bagi guru yang mengajar kurang dari 24 jam tatap muka per minggu atau JM/150 bagi guru BK/Konselor yang membimbing kurang dari 150 konseli per tahun.

AKK, AKPKB dan AKP yang dipersyaratkan untuk guru dengan jenjang/pangkat tertentu ditetapkan berdasar Pasal 18 Peraturan Menteri Negara Pendayagunaan AparaturNegaradanReformasiBirokrasiNo.16Tahun2009. Menurut peraturan ini, jenjang jabatan fungsional guru terdiri dari; Guru Pertama, GuruMuda,GuruMadya,danGuruUtama.SeorangGuruyangakandipromosikan 20

naik jenjang pangkat dan jabatan fungsionalnya setingkat lebih tinggi, dipersyaratkanharusmemilikiangkakreditkumulatifminimalsebagaiberikut:
Tabel12.PersyaratanAngkaKredit untukKenaikanPangkatdanJabatanFungsionalGuru PersyaratanAngkaKredit kenaikanpangkatdan jabatan JabatanGuru PangkatdanGolonganRuang Kumulatif Kebutuhan Perjenjang minimal 1 2 3 4 GuruPertama PenataMuda,III/a 100 50 PenataMudaTingkatI,III/b 150 50 GuruMuda Penata,III/c 200 100 PenataTingkatI,III/d 300 100 GuruMadya Pembina,IV/a 400 150 PembinaTingkatI,IV/b 550 150 PembinaanUtamaMuda,IV/c 700 150 GuruUtama PembinaUtamaMadya,IV/d 850 200 PembinaUtama,IV/e 1.050 200 Keterangan: (1) Angka kredit kumulatif minimal pada kolom 3 adalah jumlah angka kredit minimal yang dimiliki untuk masingmasing jenjang jabatan/pangkat; dan (2) Angka kredit pada kolom 4 adalah jumlah peningkatan minimal angka kredit yang dipersyaratkan untuk kenaikan pangkat/jabatansetingkatlebihtinggi.

Persyaratan angka kredit yang diperlukan untuk kenaikan pangkat dan jabatan fungsional dari satu jenjang ke jenjang berikutnya yang lebih tinggi terdiri dari unsur utama paling kurang 90% dan unsur penunjang paling banyak 10%. Unsur utama terdiri dari unsur pendidikan, pembelajaran dan tugas tambahan yang relevan dengan fungsi sekolah/madrasah, serta pengembangan keprofesian berkelanjutan (PKB). Unsur PKB terdiri dari pengembangan diri, publikasi ilmiah, dan karya inovatif. Angka kredit dari unsur PKB yang harus dipenuhi untuk naik pangkat dan jabatan fungsional dari jenjang tertentu ke jenang lain yang lebih tinggiadalahsebagaiberikut. a. Guru Pertama, pangkat Penata Muda, golongan ruang III/a yang akan naik pangkat menjadi Guru Pertama, pangkat Penata Muda Tingkat I, golongan ruang III/b mensyaratkan paling sedikit 3 (tiga) angka kredit dari subunsur pengembangandiri. b. Guru Pertama, pangkat Penata Muda Tingkat I, golongan ruang III/b yang akan naik jabatan/pangkat menjadi Guru Muda, pangkat Penata, golongan ruang III/cmensyaratkanpalingsedikit4(empat)angkakreditdarisubunsurpublikasi ilmiah dan/atau karya inovatif, dan paling sedikit 3 (tiga) angka kredit dari subunsurpengembangandiri. c. Guru Muda, pangkat Penata, golongan ruang III/c yang akan naik pangkat menjadi Guru Muda, pangkat Penata Tingkat I, golongan ruang III/d mensyaratkan paling sedikit 6 (enam) angka kredit dari subunsur publikasi ilmiah dan/atau karya inovatif, dan paling sedikit 3 (tiga) angka kredit dari subunsurpengembangandiri. d. Guru Muda, pangkat Penata Tingkat I, golongan ruang III/d yang akan naik jabatan/pangkat menjadi Guru Madya, pangkat Pembina, golongan ruang IV/a mensyaratkan paling sedikit 8 (delapan) angka kredit dari subunsur publikasi

21

e.

f.

g.

h.

ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka kredit dari subunsurpengembangandiri. Guru Madya, pangkat Pembina, golongan ruang IV/a yang akan naik pangkat menjadi Guru Madya, pangkat Pembina Tingkat I, golongan ruang IV/b mensyaratkanpalingsedikit12(duabelas)angkakreditdarisubunsurpublikasi ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka kredit dari subunsurpengembangandiri. Guru Madya, pangkat Pembina Tingkat I, golongan ruang IV/b yang akan naik pangkatmenjadiGuruMadya,pangkatPembinaUtamaMuda,golonganruang IV/c mensyaratkan paling sedikit 12 (dua belas) angka kredit dari subunsur publikasi ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka kreditdarisubunsurpengembangandiri. Guru Madya, pangkat Pembina Utama Madya, golongan ruang IV/c yang akan naik jabatan/pangkat menjadi Guru Utama, pangkat Pembina Utama Madya, golongan ruang IV/d, mensyaratkan paling sedikit 14 (empat belas) angka kreditdarisubunsurpubliksiilmiahdan/ataukaryainovatif,danpalingsedikit5 (lima)angkakreditdarisubunsurpengembangandiri. Guru Utama, pangkat Pembina Utama Madya, golongan ruang IV/d yang akan naik pangkat menjadi Guru Utama, pangkat Pembina Utama, golongan ruang IV/e mensyaratkan paling sedikit 20 (dua puluh) angka kredit dari subunsur publikasiilmiahdan/ataukaryainovatif,danpalingsedikit5(lima)angkakredit darisubunsurpengembangandiri.

Contoh1:GuruMataPelajaran Budiman, S.Pd. adalah guru Bahasa Indonesia dengan jabatan Guru Pertama pangkat dan golongan ruang Penata Muda III/a TMT 1 April 2012. Budiman, S.Pd. yang mengajar 24 jam tatap muka dan telah mengikuti PK GURU pada Desember 2012mendapatnilai50.Makauntukmenghitungangkakredityangdiperoleholeh Budiman, S.Pd. dalam tahun tersebut digunakan langkahlangkah perhitungan sebagaiberikut. 1) KonversihasilPKGURUkeskalanilai0100sesuaiPeraturanMenteriNegara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009denganmenggunakanformulamatematikaberikut: Nilai PKG Nilai PKG (skala100) = 100
Nilai PKG Tertinggi

Keterangan: Nilai PKG skala 100 adalah nilai PK Guru Kelas/Mata Pelajaran atau Bimbingan dan Konseling/Konselor dalam skala 0 100 menurut Peraturan Menteri Negara PendayagunaanAparaturNegaradanReformasiBirokrasiNomor16Tahun2009. Nilai PKG adalah nilai PK GURU Kelas/Mata Pelajaran atau Bimbingan dan Konseling/Konselor yang diperoleh dalam proses PK GURU sebelum diubah ke dalam skala 0 100 menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara danReformasiBirokrasiNomor16Tahun2009. Nilai PKG Tertinggi adalah nilai tertinggi PK GURU yang dapat dicapai, yaitu 56 (=14 x 4)bagiPKGURUKelas/MataPelajaran(14kompetensi),dan68(=17x4)bagiPKGuru BimbingandanKonseling/Konselor(17kompetensi).

Nilai PK GURU tertinggi untuk pembelajaran adalah 56, maka dengan formula matematikatersebutdiperolehNilaiPKGskala100=50/56x100=89. 22

2) Berdasarkan Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan ReformasiBirokrasiNo.16Tahun2009,nilai89beradadalamrentang7690, sehinggaBudiman,S.Pd.memperolehnilaiBaik(100%). 3) Bila Budiman, S.Pd. mengajar 24 jam per minggu maka berdasarkan rumus tersebut angka kredit yang diperoleh Budiman, S.Pd. untuk subunsur pembelajaranpadatahun2012(dalamperiode1tahun)adalah: AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 AngkaKreditsatutahun={(5035)x24/24x100%}=10,5 4 4) Angka kredit yang diperoleh Budiman, S.Pd. selama tahun 2012 adalah 10.5 per tahun. Apabila Budiman, S.Pd. memperoleh nilai kinerja tetap Baik, selama 4 tahun, maka angka kredit untuk unsur pembelajaran yang dikumpulkanadalah10.5x4=42. 5) Apabila Budiman, S.Pd. melaksanakan kegiatan Pengembangan Keprofesian Berkelanjutan dan memperoleh 3 angka kredit dari pengembangan diri, dan 5 angka kredit dari kegiatan penunjang, maka Sdr. Budiman, S.Pd. memperoleh angka kredit kumulatif sebesar : 42 + 3 + 5 = 50. Karena angka kredit yang dipersyaratkan untuk naik pangkat/jabatan dari Guru Pertama pangkat Penata Muda, golongan ruang III/a ke Guru Muda pangkat Penata Muda Tingkat I, golongan ruang III/b adalah 50, maka Budiman, S.Pd. dapat naik pangkat/jabatantepatdalam4tahun. Contoh2:GuruBimbingandanKonseling/Konselor Rahayu, S.Pd. adalah guru Bimbingan dan Konseling pada MTs Negeri 2 Pamulang denganjabatanGuruMudapangkatPenatagolonganruangIII/cTMT1April2013. Sebagai guru BK, Rahayu S.Pd. membimbing 150 peserta didik per tahun dan selama empat tahun telah mengikuti program pengembangan diri dengan angka kredit 3 serta menghasilkan publikasi ilmiah dan/atau karya inovatif dengan angka kredit 6. Rahayu juga telah memperoleh angka kredit 10 untuk unsur penunjang. Pada Desember 2013 yang bersangkutan dinilai kinerjanya dan memperoleh hasil nilai PK GURU sebesar 58. Penilaian kinerja terhadap Rahayu, S.Pd. pada tiga tahun berikutnya selalu memberikan hasil Baik. Langkahlangkah untuk menghitungangkakredityangdiperolehRahayu,S.Pd.adalahsebagaiberikut. 1) Konversi hasil PK GURU Rahayu, S.Pd. tahun 2013 ke skala nilai 0 100 menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan ReformasiBirokrasiNomor16Tahun2009adalah=58/68x100=85,29. 2) Berdasarkan Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi No. 16 Tahun 2009 rentang nilai 85,29 berada dalam rentang7690dandisebutBaik(100%),. 3) Angka kredit yang diperoleh Rahayu, S.Pd. untuk subunsur pembimbingan padatahun2013(dalamperiode1tahun)adalah:

23

AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 AngkaKreditsatutahun=[{100(3+6)10}x150/150x100%]=20,25 4 4) Angka kredit yang diperoleh Rahayu, S.Pd. pada tahun 2013 adalah 20,25. Karena Rahayu, S.Pd. memperoleh nilai kinerja tetap Baik, selama 4 tahun, maka angka kredit untuk subunsur pembimbingan yang dikumpulkan adalah 20,25x4=81,0. 5) Selama 4 (empat) tahun tersebut, Rahayu, S.Pd. melaksanakan kegiatan Pengembangan Keprofesian Berkelanjutan dan memperoleh 3 angka kredit daripengembangandiri,6angkakreditdaripublikasiilmiahdankaryainovatif, dan10angkakreditdarikegiatanpenunjang,makaRahayu,S.Pd.memperoleh angka kredit kumulatif sebesar : 81,5 + 3 + 6 + 10 = 100. Karena angka kredit yang dipersyaratkan untuk naik pangkat/jabatan dari Guru Muda pangkat Penata,golonganruangIII/ckeGuruMudapangkatPenataTingkatI,golongan ruang III/d adalah 100 maka Rahayu, S.Pd. dapat naik pangkat/jabatan dalam dari4tahun. 2. Konversi nilai PK GURU dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasahyangmengurangijammengajartatapmukaguru Hasil akhir nilai kinerja guru dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah (Kepala Sekolah, Wakil Kepala Sekolah, Kepala Laboratorium, Kepala Perpustakaan, dan sejenisnya) yang mengurangi jam mengajar tatap muka diperhitungkan berdasarkan prosentase nilai PK GURU pembelajaran/pembimbingan dan prosentase nilai PK GURU pelaksanaan tugas tambahantersebut. 1) Untuk itu, nilai hasil PK GURU Kelas/Mata Pelajaran atau PK GURU Bimbingan dan Konseling/Konselor, atau PK GURU dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah perlu diubah terlebih dahulu ke skala 0 100 denganformulamatematikaberikut: Nilai PKG Nilai PKG (skala 100) = 100
Nilai PKG maksimum

Keterangan: Nilai PKG skala 100 adalah nilai PK GURU Kelas/Mata Pelajaran atau Bimbingan dan Konseling/Konselor atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah dalam skala 0 100 (sesuai Peraturan Menteri Negara PendayagunaanAparaturNegaradanReformasiBirokrasiNo.16Tahun2009) Nilai PKG adalah total nilai PK Guru Kelas/Mata Pelajaran atau Bimbingan dan Konseling/Konselor, atau tugas tambahan yang relevan dengan fungsi sekolah/madrasahyangdiperolehsebelumdiubahkedalamskala0100. Nilai PKG maksimum adalah nilai tertinggi PK GURU. Untuk guru Kelas/Mata Pelajaran adalah 56 (= 14 x 4), untuk guru Bimbingan dan Konseling/Konselor adalah 68 (= 17 x 4),atautugastambahanyangrelevandenganfungsisekolah/madrasahsesuaidengan instrumenmasingmasing.

2) Masingmasing hasil konversi nilai kinerja guru untuk unsur pembelajaran/ pembimbingan dan tugas tambahan yang relevan dengan fungsi 24

sekolah/madrasah, kemudian dikategorikan ke dalam Amat Baik (125%), Baik (100%), Cukup (75%), Sedang (50%), atau Kurang (25%) sebagaimana diatur dalam Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan ReformasiBirokrasiNo.16Tahun2009. 3) Angkakreditpertahunmasingmasingunsurpembelajaran/pembimbingandan tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang diperoleh olehgurudihitungmenggunakanrumusberikutini. a) Untuk menghitung AK subunsur pembelajaran/pembimbingan digunakan rumusberikut.
Angka kredit per tahun = (AKK AKPKB AKP) JM 4 JWM NPK

Keterangan: AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikan pangkat. AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri, karya ilmiah,dan/ataukaryainovatif). AKP adalah angka kredit unsur penunjang sesuai dengan ketentuan menurut PermenegPANdanRBNomor16Tahun2009. JM adalah jumlah jam mengajar (tatap muka) guru di sekolah/madrasah atau jumlah konseliyangdibimbingolehguruBK/Konselor. JWM adalah jumlah jam wajib mengajar (24 40 jam tatap muka per minggu) bagi guru pembelajaran atau jumlah konseli (150 250 konseli per tahun) yang dibimbing olehguruBK/Konselor. NPKadalahprosentaseperolehanangkakreditsebagaihasilpenilaiankinerja 4adalahwakturataratakenaikanpangkatreguler(4tahun). JM/JWM = 1 bagi guru yang mengajar 2440 jam tatap muka per minggu atau yangmembimbing150250konselipertahunbagiguruBK/Konselor. JM/JWM = JM/24 bagi guru yang mengajar kurang dari 24 jam tatap muka per minggu atau JM/150 bagi guru BK/Konselor yang membimbing kurang dari 150 konselipertahun.

b) Untuk menghitung angka kredit subunsur tugas tambahan yang relevan denganfungsisekolah/madrasahdigunakanrumusberikutini. (AKK - AKPKB - AKP) NPK Angka kredit per tahun =
4 Keterangan: AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikan pangkat. AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri, karya ilmiah,dan/ataukaryainovatif). AKP adalah angka kredit unsur penunjang yang diwajibkan sesuai dengan ketentuan menurutPermenegPANdanRBNomor16Tahun2009. NPKadalahprosentaseperolehanangkakreditsebagaihasilpenilaiankinerja 4adalahwakturataratakenaikanpangkat(reguler),4tahun.

4) Selanjutnya angka kredit unsur pembelajaran/pembimbingan dan angka kredit tugas tambahan yang relevan dengan fungsi sekolah/madrasah dijumlahkan sesuai prosentasenya untuk memperoleh total angka kredit dengan perhitungansebagaiberikut: 25

a. GurudenganTugasTambahansebagaiKepalaSekolah TotalAngka Kredit=25%AngkaKreditPembelajaran/Pembimbingan+75% AngkaKreditTugasTambahansebagaiKepalaSekolah. b. GurudenganTugasTambahansebagaiWakilKepalaSekolah TotalAngka Kredit=50%AngkaKreditPembelajaran/Pembimbingan+50% AngkaKreditTugasTambahansebagaiWakilKepalaSekolah. c. Guru dengan Tugas Tambahan sebagai Kepala Perpustakaan/ Laboratorium/Bengkel,atauKetuaProgramKeahlian; TotalAngka Kredit=50%AngkaKreditPembelajaran/Pembimbingan+50% AngkaKreditTugasTambahansebagaiPustakawan/Laboran Contoh 3: Guru yang mendapat tugas tambahan yang mengurangi jam mengajar tatapmuka(misalnyaKepalaSekolah/Madrasah) Ahmad Sumarna, S.Pd. jabatan Guru Madya pangkat Pembina golongan ruang IV/a TMT 1 April 2014 mengajar mata pelajaran Fisika, diberi tugas tambahan sebagai kepalasekolah,danmemperolehhasilpenilaiankinerjasebagaiguruadalah48dan sebagai kepala sekolah mendapat jumlah skor ratarata 18 pada Desember 2014. Langkahlangkahperhitunganangkakreditnyaadalahsebagaiberikut. Perhitunganangkakreditsubunsurpembelajaran: 1) KonversihasilpenilaiankinerjatugaspembelajaranAhmadSumarna,S.Pd.ke skala nilai Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan ReformasiBirokrasiNomor16Tahun2009adalah:48/56x100=85,7. 2) Nilai kinerja guru untuk subunsur pembelajaran/pembimbingan, kemudian dikategorikan ke dalam Amat Baik (125%), Baik (100%), Cukup (75%), Sedang (50%), atau Kurang (25%) sebagaimana diatur dalam Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi No. 16 Tahun 2009. Nilai PK Guru subunsur pembelajaran Ahmad Sumarna, S.Pd. yangmendapattugastambahansebagaiKepalaSekolah=85,7masukdalam rentang7690dengankategoriBaik(100%). 3) Angka kredit per tahun subunsur pembelajaran yang diperoleh Ahmad Sumarna,S.Pd.adalah: AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 AngkaKreditsatutahun=[{150(4+12)15}x6/6x100%]=29,75. 4 PerhitunganangkakredittugastambahansebagaiKepalaSekolah: 1) Konversi hasil penilaian kinerja Ahmad Sumarna, S.Pd. dalam melaksanakan tugas tambahan sebagai Kepala Sekolah, ke skala nilai Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun2009adalah18/24x100=75. 2) Nilai kinerja guru untuk subunsur tugas tambahan sebagai Kepala Sekolah, kemudian dikategorikan ke dalam Amat Baik (125%), Baik (100%), Cukup (75%),Sedang(50%),atauKurang(25%)sebagaimanadiaturdalamPeraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi No. 16 Tahun 2009. Nilai PK Guru tugas tambahan Ahmad Sumarna, S.Pd. sebagai Kepala Sekolah = 75 masuk dalam rentang 61 75 dengan kategori Cukup(75%). 26

3)

4)

5)

6)

Angka kredit per tahun unsur tugas tambahan sebagai Kepala Sekolah yang diperolehAhmadSumarna,S.Pd.adalah: AngkaKreditsatutahun=(AKKAKPKBAKP)xNPK 4 AngkaKreditsatutahun={150(4+12)15}x75%=22,31. 4 Total angka kredit yang diperoleh Ahmad Sumarna, S.Pd. untuk tahun 2014 sebagai guru yang mendapat tugas tambahan sebagai Kepala Sekolah adalah =25%(29,75)+75%(22,31)=7,44+16,73=24,17. Jika selama 4 (empat) tahun terus menerus Ahmad Sumarna, S.Pd. mempunyai nilai kinerja yang sama, maka nilai yang diperoleh Ahmad Sumarna, S.Pd. sebagai guru dengan tugas tambahan sebagai kepala sekolah selama4tahunadalah4x24,17=96,68. Apabila Ahmad Sumarna, S.Pd. melaksanakan kegiatan pengembangan keprofesian berkelanjutan dan memperoleh 4 angka kredit dari kegiatan pengembangandiri,12angkakreditdaripublikasiilmiah,dan15angkakredit dari kegiatan penunjang, maka Ahmad Sumarna, S.Pd. memperoleh angka kreditkumulatifsebesar96,68+4+12+15=127,68.Jadiyangbersangkutan tidak dapat naik pangkat dari golongan ruang IV/a ke golongan ruang IV/b dengan jabatan Guru Madya dalam waktu 4 tahun, karena belum mencapai persyaratan angka kredit yang diperlukan untuk naik pangkat dan jabatan fungsionalnyasebesar150.

Catatan: Perolehan angka kredit guru dengan tugas tambahan lain yang relevan dengan fungsi sekolah/madrasah selain kepala sekolah diperhitungkan dengan cara yang sama (perbedaannyahanyapadarumuspenjumlahannya)

3. Konversi nilai PK GURU dengan tugas tambahan lain yang relevan dengan fungsi sekolah/madrasahtetapitidakmengurangijammengajartatapmukaguru Angka kredit tugas tambahan bagi guru dengan tugas tambahan lain yang tidak mengurangijammengajartatapmuka,langsungdiperhitungkansebagaiperolehan angka kredit guru pada periode tahun tertentu. Banyaknya tugas tambahan untuk seorang guru maksimum 2 (dua) tugas per tahun. Angka kredit kumulatif yang diperolehdiperhitungkansebagaiberikut. 1) Tugas yang dijabat selama satu tahun (misalnya menjadi wali kelas, tim kurikulum,pembimbinggurupemula,dansejenisnya). Angka kredit kumulatif yang diperoleh = Angka Kredit Hasil PK GURU selama setahun + 5% Angka Kredit Hasil PK GURU selama setahun x banyaknya tugas temporer yang diberikan selamasetahun. 2) Tugas yang dijabat selama kurang dari satu tahun atau tugastugas sementara (misalnyamenjadipengawaspenilaiandanevaluasi,membimbingpesertadidik dalam kegiatan ekstrakurikuler, menjadi pembimbing penyusunan publikasi ilmiahdankaryainovatif,dansejenisnya)

27

Angka kredit kumulatif yang diperoleh = Angka Kredit Hasil PK GURU selama setahun + 2% Angka Kredit Hasil PK GURU selama setahun x banyaknya tugas temporer yang diberikan selamasetahun. Contoh 4: Guru yang mendapat tugas tambahan menjadi Wali Kelas (tugas tambahanlainyangtidakmengurangijammengajardandikerjakandalamjangka waktusatutahun) Misalnya Budiman, S.Pd. (pada contoh 1) diberikan tugas tambahan sebagai wali kelas selama setahun yang tidak mengurangi jam mengajarnya. Karena Budiman, S.Pd, pada perhitungan contoh 1 sudah mendapatkan angka kredit dari tugas pembelajarannya sebesar 10,5 per tahun, maka angka kredit kumulatif yang dapat dikumpulkan oleh Budiman, S.Pd. selama setahun, karena yang bersangkutan mendapattugassebagaiwalikelasadalah: Angka kredit kumulatif yang dikumpulkan = Angka Kredit Hasil PK GURU selama setahun + 5% Angka Kredit Hasil PK GURU selama setahun=10,5+(10,5x5/100)=10,5+0,53=11,03. Contoh 5: Guru yang mendapat tugas tambahan yang bersifat sementara (tugas tambahan lain yang tidak mengurangi jam mengajar dan dilaksanakan kurang darisatutahun) Misalnya Budiman, S.Pd. (pada contoh 1) diberikan tugas sementara (kurang dari setahun) yang tidak mengurangi jam mengajarnya sebanyak 2 kali sebagai pengawas penilaian dan evaluasi. Karena Budiman, S.Pd. pada perhitungan contoh 1 sudah mendapatkan angka kredit dari tugas pembelajarannya sebesar 10,5 per tahun, maka angka kredit kumulatif yang dapat dikumpulkan oleh Budiman, S.Pd. selamasetahun,karenamendapattugastambahanyangbersifatseentaratersebut adalahsebagaiberikut. Angkakreditkumulatifyangdikumpulkanselamasetahun=AngkaKreditHasilPK GURU selama setahun + 2% Angka Kredit Hasil PK GURU selama setahun x banyaknya tugas sementara yangdiberikanselamasetahun=10,5+(10,5x2/100)x 2=10,5+0,21x2=10,5+0,42=10,92. C. PenilaidalamPKGURU 1. KriteriaPenilai Penilaian kinerja guru dilakukan di sekolah oleh Kepala Sekolah. Apabila Kepala Sekolah tidak dapat melaksanakan sendiri (misalnya karena jumlah guru yang dinilai terlalu banyak), maka Kepala Sekolah dapat menunjuk Guru Pembina atau Koordinator PKB sebagai penilai. Penilaian kinerja Kepala Sekolah dilakukan oleh Pengawas.Penilaiharusmemilikikriteriasebagaiberikut. a) Menduduki jabatan/pangkat paling rendah sama dengan jabatan/pangkat guru/kepalasekolahyangdinilai. b) MemilikiSertifikatPendidik. c) Memiliki latar belakang pendidikan yang sesuai dan menguasai bidang kajian Guru/KepalaSekolahyangakandinilai.

28

d) Memiliki komitmen yang tinggi untuk berpartisipasi aktif dalam meningkatkan kualitaspembelajaran. e) Memilikiintegritasdiri,jujur,adil,danterbuka. f) Memahami PK GURU dan dinyatakan memiliki keahlian serta mampu untuk menilaikinerjaGuru/KepalaSekolah. Dalam hal Kepala Sekolah, Pengawas, Guru Pembina, dan Koordinator PKB memiliki latar belakang bidang studi yang berbeda dengan guru yang akan dinilai maka penilaian dapat dilakukan oleh Kepala Sekolah dan/atau Guru Pembina/ Koordinator PKB dari Sekolah lain atau oleh Pengawas dari kabupaten/kota lain yang sudah memiliki sertifikat pendidik dan memahami PK GURU. Hal ini berlaku jugauntukmemberikanpenilaiankepadaGuruPembina. 2. MasaKerja Masa kerja tim penilai kinerja guru ditetapkan oleh Kepala Sekolah atau Dinas Pendidikanpalinglamatiga(3)tahun.Kinerjapenilaidievaluasisecaraberkalaoleh Kepala Sekolah atau Dinas Pendidikan dengan memperhatikan prinsipprinsip penilaian yang berlaku. Untuk sekolah yang berada di daerah khusus, penilaian kinerja guru dilakukan oleh Kepala Sekolah dan/atau Guru Pembina setempat. Jumlah guru yang dapat dinilai oleh seorang penilai adalah 5 sampai 10 guru per tahun. D. Sanksi Penilaidanguruyangdinilaiakandikenakansanksiapabilayangbersangkutanterbukti melanggar prinsipprinsip pelaksanaan PK GURU, sehingga menyebabkan Penetapan Angka Kredit (PAK) diperoleh dengan cara melawan hukum. Sanksi tersebut adalah sebagaiberikut: 1. DiberhentikansebagaiGuruatauKepalaSekolahdan/atauPengawas. 2. Bagi penilai, wajib mengembalikan seluruh tunjangan profesi, tunjangan fungsional,dansemuapenghargaanyangpernahditerimasejakyangbersangkutan melakukanprosesPKGURU. 3. Bagi guru wajib mengembalikan seluruh tunjangan profesi, tunjangan fungsional, dan semua penghargaan yang pernah diterima sejak yang bersangkutan memperolehdanmempergunakanPAKyangdihasilkandariPKGURU.

29

30

BABIV TUGASDANTANGGUNGJAWABPIHAKTERKAIT DALAMPELAKSANAANPENILAIANKINERJAGURU Setiap pihak terkait memiliki tugas dan tanggung jawab dalam pelaksanaan kegiatan PK GURU Penetapan tugas dan tanggung jawab tersebut sesuai dengan semangat otonomi daerah serta mengutamakan prinsipprinsip efisiensi, keterbukaan, dan akuntabilitas. PelaksanaantugasdantanggungjawabtersebutditunjukkandalamdiagramGambar2. Menyusun Pedoman dan instrumen PK GURU, melakukan Pemantauan dan Evaluasi, Tingkat Pusat KEMDIKNAS menyeleksi dan melatih tim inti PK GURU tingkat pusat. Melaksanakan Pemetaan Data, Pendampingan, Pembimbingan, dan Konsultasi Pelaksanaan Dinas Pendidikan Tingkat Provinsi Kegiatan, Pemantauan dan Evaluasi, Pelaporan Provinsi dan LPMP untuk menjamin pelaksanaan PK GURU yg berkualitas. Mengelola PK GURU tingkat Kabupaten/Kota untuk menjamin PK GURU dilaksanakan secara Dinas Pendidikan Tingkat Kab/Kota efektif, efisien, obyektif, adil, akuntabel, serta Kabupaten/Kota membantu & memonitor pelaksanaan PK GURU. Membantu pelaksanaan tugas Kabupaten/Kota
Tingkat Kecamatan

UPTD Dinas Pendidikan Kabupaten/Kota di Kec.

Tingkat Sekolah
Sekolah atau Madrasah

untuk menjamin keterlaksanaan PK GURU secara efektif, efisien, obyektif, adil, akuntabel serta membantu dan memonitor pelaksanaan PK GURU.

Merencanakan, melaksanakan dan melaporkan pelaksanaan PK GURU secara efektif, efiesien, obyektif, akuntabel, dsb.


Koordinator PKB

Gambar2.DiagramTugasdanTanggungJawabPihakTerkaitdalamPelaksanaan KegiatanPKGURU

Bertanggung jawab bahwa guru menerima dukungan untuk meningkatkan kompetensi dan/atau profesionalismenya sesuai dengan profil kinerjanya.

31

Diagram di atas menunjukkan adanya keterkaitan tugas dan tanggung jawab pihakpihak yang terlibat dalam pelaksanaan PK GURU, mulai dari tingkat pusat (Kemdiknas) sampai dengan sekolah. Konsekuensi dari adanya keterkaitan tersebut, menuntut agar pihak pihak yang terlibat dalam pelaksanaan PK GURU melakukan koordinasi. Tugas dan tanggungjawabmasingmasingpihakdirincisebagaiberikut. A. TugasdanTanggungJawabTingkatPusat:KementerianPendidikanNasional 1. Menyusun dan mengembangkan Ramburambu Pengembangan Kegiatan PK GURU. 2. MenyusunProsedurOperasionalStandarPelaksanaanPKGURU. 3. MenyusuninstrumendanperangkatlainuntukpelaksanaanPKGURU. 4. Mensosialisasikan, menyeleksi dan melaksanakan TOT penilai PK GURU tingkat pusat. 5. MemantaudanmengevaluasikegiatanPKGURU. 6. MenyusunlaporanhasilpemantauandanevaluasiPKGURUsecaranasional. 7. Menyampaikan laporan hasil pemantauan dan evaluasi PK GURU kepada Dinas Pendidikandansekolahsebagaiumpanbalikuntukditindaklanjuti. 8. MengkoordinasidanmensosialisasikankebijakankebijakanterkaitPKGURU. B. TugasdanTanggungJawabTingkatProvinsi:DinasPendidikanProvinsidanLPMP 1. Menghimpun data profil guru dan sekolah yang ada di daerahnya berdasarkan hasilPKGURUdisekolah. 2. Mensosialisasikan, menyeleksi, dan melaksanakan TOT untuk melatih penilai PK GURUtingkatKabupaten/Kota. 3. Menetapkan dan mengesahkan tim penilai PK GURU yang berada di bawah kewenanganprovinsidalambentukSuratKeputusan(SK)KepalaDinasPendidikan Provinsi. 4. Melaksanakan pendampingan kegiatan PK GURU di sekolahsekolah yang ada di bawahkewenangannya. 5. Menyediakan pelayanan konsultasi pelaksanaan kegiatan PK GURU yang ada di bawahkewenangannya. 6. Memantau dan mengevaluasi pelaksanaan kegiatan PK GURU di sekolahsekolah yangadadibawahkewenangannya. 7. Dinas Pendidikan Provinsi bersamasama dengan LPMP membuat laporan hasil pemantauandanevaluasikegiatanPKGURUdanmengirimkannyakepadasekolah, Dinas Pendidikan Kabupaten/Kota, dan/atau Kemdiknas, cq. Direktorat yang menanganiPendidik, C. Tugas dan Tanggung Jawab Tingkat Kabupaten/Kota: Dinas Pendidikan Kabupaten/Kota 1. Menghimpun dan menyediakan data profil guru dan sekolah yang ada di wilayahnyaberdasarkanhasilPKGURUdisekolah. 2. Mensosialisasikan dan melalui koordinasi dengan Dinas Pendidikan Provinsi dan LPMPmelatihpenilaiPKGURUtingkatKabupaten/Kota. 3. Membantu pengkoordinasian pelaksanaan kegiatan PK GURU di sekolahsekolah yangadadiwilayahnya. 4. Melaksanakan pendampingan kegiatan dan pengelolaan PK GURU di sekolah sekolahyangadadiwilayahnya.

32

5. Menetapkan dan mengesahkan tim penilai PK GURU bagi guru yang berada di

bawahkewenangannyadalambentukSuratKeputusan(SK)KepalaDinas. 6. Mengetahui dan menyetujui program kerja pelaksanaan PK GURU yang diajukan sekolah. 7. Menyediakan pelayanan konsultasi dan penyelesaian konflik dalam pelaksanaan kegiatanPKGURUdisekolahsekolahyangadadidaerahnya. 8. Memantau dan mengevaluasi pelaksanaan kegiatan PK GURU untuk menjamin pelaksanaanyangefektif,efisien,obyektif,adil,akuntabel,dansebagainya. 9. Membuat laporan hasil pemantauan dan evaluasi kegiatan PK GURU di sekolah sekolah yang ada di wilayahnya dan mengirimkannya kepada sekolah, dan/atau LPMPdengantembusankeDinasPendidikanProvinsimasingmasing. D. TugasdanTanggungJawabTingkatKecamatan:UPTDDinasPendidikan 1. Menghimpun dan menyediakan data profil guru dan sekolah yang ada di kecamatanwilayahnyaberdasarkanhasilPKGURUdisekolah. 2. Membantu pengkoordinasian pelaksanaan kegiatan PK GURU di wilayah kecamatannya. 3. Melaksanakan pendampingan kegiatan dan pengelolaan PK GURU di wilayah kecamatannya. 4. Menetapkan dan mengesahkan penilai PK GURU dalam bentuk Surat Keputusan (SK)penetapansebagaipenilai. 5. MenyediakanpelayanankonsultasidalampelaksanaankegiatanPKGURUyangada didaerahnya. 6. Memantau dan mengevaluasi serta melaporkan pelaksanaan kegiatan PK GURU di tingkatkecamatanuntukdisampaikankepadaDinasPendidikanKabupaten/Kota. E. TugasdanTanggungJawabTingkatSekolah 1. MemilihdanmengusulkanpenilaiuntukpelaksanaanPKGURU 2. Menyusun program kegiatan sesuai dengan RambuRambu Penyelenggaraan PK GURUdanProsedurOperasionalStandarPenyelenggaraanPKGURU. 3. MengusulkanrencanaprogramkegiatankeUPTDatauDinasKabupaten/Kota. 4. MelaksanakankegiatanPKGURUsesuaiprogramyangtelahdisusunsecaraefektif, efisien,obyektif,adil,akuntabel,dsb. 5. Memberikankemudahanaksesbagipenilaiuntukmelaksanakantugas 6. Melaporkan kepada UPTD atau Dinas Pendidikan Kabupaten/Kota jika terjadi permasalahandalampelaksanaanPKGURU 7. Membuatlaporanpertanggungjawabankegiatan,administrasi,keuangan(jikaada) danpelaksanaanprogram. 8. Membuat rencana tindak lanjut program pelaksanaan PK GURU untuk tahun berikutnya. 9. Membantu tim pemantau dan evaluasi dari tingkat pusat, LPMP, Dinas Pendidikan Kabupaten/Kota, UPTD Dinas Pendidikan Kabupaten di Kecamatan, dan Pengawas Sekolah. 10. Membuat laporan kegiatan PK GURU dan mengirimkannya kepada Tim penilai tingkat kabupaten/kota, provinsi, atau nasional sesuai kewenangannya sebagai dasar penetapan angka kredit (PAK) tahunan yang diperlukan untuk kenaikan pangkat dan jabatan fungsional guru. Tim Penilai untuk menghitung dan

33

menetapkan angka kredit, terlebih dahulu melakukan verifikasi terhadap berbagai dokumen hasil PK GURU. Pada kegiatan verifikasi jika diperlukan dan memang dibutuhkan tim penilai dapat mengunjungi sekolah. Sekolah juga menyampaikan laporan tersebut kepada Dinas Pendidikan Kabupaten/Kota dan/atau ke UPTD PendidikanKecamatan. 11. Merencanakan program untuk memberikan dukungan kepada guru yang memperoleh hasil PK GURU di bawah standar yang ditetapkan maupun bagi guru yangtelahmencapaistandar.

34

BABV PENJAMINANMUTU,MONITORINGDANEVALUASIPELAKSANAANPKGURU A. Penjaminanmutu Penjaminan mutu PK GURU merupakan serangkaian proses untuk mengidentifikasi keterlaksanaandanmutupelaksanaanPKGURUditiapsekolahsehinggaseluruhtahap kegiatanmengarahpadatujuanyangdiharapkan.Peningkatanpenjaminanmutusecara sistem meliputi perencanaan, pelaksanaan, monitoringevaluasi, dan tindak lanjut perbaikan mutu. Sistem penjaminan mutu dapat dilakukan melalui pendekatan monitoring maupun evaluasi. Monitoring dilakukan secara berkala dalam rangka menghimpun data tentang keterlaksanaan program. Penilaian dilakukan untuk mengidentifikasi kinerja PK GURU dalam menilai kemajuan kinerja guru secara berkala danberkelanjutan. Pelaksanaan penjaminan mutu PK GURU meliputi (1) identifikasi tujuan, indikator, dan target PK GURU, (2) pengembangan instrumen (3) penerapan instrumen dalam rangka menghimpun data (4) mengolah, menganalisis dan menginterpretasikan data (5) mengidentifikasi kekuatan dan kelemahan serta mengidentifikasi penyebab munculnya kekuatandankelemahan(6)menyusunrekomendasiperbaikanmutuberkelanjutan(7) mengembangkan rencana PK GURU berikutnya. Oleh karena itu, pelaksanaan penjaminan mutu memerlukan instrumen tersendiri yang disusun oleh penyelenggara penjaminan mutu. Untuk menunjang efektivitas penyelenggaraan, maka penjaminan mutu PK GURU memerlukan perencanaan, kalender pelaksanaan, struktur pelaksana, dan alur sistem informasi hasil evaluasi penjaminan mutu sebagai produk kegiatan penjaminanmutuPKGURU. Pelaksanaan penjaminan mutu PK GURU dilakukan sepanjang tahun, diawali dengan kegiatan evaluasi diri sekolah (EDS) dan pelaksanaan monitoring sekolah oleh pemerintahdaerah(MSPD).Produk kegiatanEDSdanMSPDdivalidasiolehpemerintah provinsi maupun lembaga penjaminan mutu pendidikan (LPMP) dan pemerintah. Hasil pelaksanaan penjaminan mutu PK GURU adalah potret kinerja guru di setiap sekolah, kabupaten/kota, provinsi dan nasional. Profil kinerja mendeskripsikan tingkat keterlaksanaan PK GURU, dan mutu pelaksanaan PK GURU di setiap sekolah. Hasil penjaminanmutuPKGURUdiklasifikasikandalamkelompoksekolahberkinerjarendah, cukup, dan tinggi. Kelompok sekolah yang berkinerja rendah dan cukup perlu ditindaklanjuti dengan pembinaan melalui program pendampingan oleh Lembaga PenjaminanMutuPendidikan(LPMP). Sekolah yang berkinerja tinggi mendapat pembinaan lebih lanjut dari pemerintah, tingkat provinsi, dan kabupaten/kota serta dapat memfasilitasi sekolah berkinerja rendah dan cukup. Biaya penyelenggaraan program penjaminan mutu PK GURU menjadi tanggung jawab masingmasing Provinsi, Pemerintah Kabupaten/Kota, dan satuanpendidikan. B. MonitoringdanEvaluasiProgram Dalam penjaminan efektivitas pelaksanaan PK GURU, perlu dilakukan kegiatan monitoring dan evaluasi yang dilaksanakan secara bertahap dan berkesinambungan

35

oleh institusi/pihak terkait. Hasil monitoring dan evaluasi merefleksikan efektivitas PK GURUyangdilaksanakanolehsekolah.Hasilmonitoringdanevaluasijugadipergunakan untukmeningkatkanmutupelaksanaanPKGURUberikutnya. Monitoringdanevaluasipadaprinsipnyamerupakanstrategiuntukmengetahuiapakah pelaksanaan program PK GURU telah sesuai dengan tujuan yang diharapkan. Di samping itu melalui kegiatan ini dapat diidentifikasi masalah dan rekomendasi untuk mengatasinya. Proses analisis dalam evaluasi diarahkan pada penyusunan kesimpulan tentang keberhasilan program PK GURU untuk memetakan kinerja seorang guru. Secara nyata oleh karena itu, kegiatan monitoring dan evaluasi harus mampu menjawabpertanyaan: 1. Apakah perencanaan program PK GURU benarbenar sudah mengarah pada proses yang efektif, efisien, obyektif, dan akuntabel untuk menggambarkan kinerja guru yangsesungguhnyadalammelaksanakantugasnya? 2. Apakah pelaksanaan PK GURU dan peran pelaksana PK GURU telah efektif, efisien, obyektif, adil, akuntabel, serta mampu mengidentifikasi permasalahan dalam pelaksanaanPKGURU? 3. Apakah kegiatan PK GURU berdampak pada peningkatan kompetensi guru dalam memberikan layanan pendidikan di sekolah, khususnya dalam pelaksanaan tugas sehariharimemfasilitasipembelajaran,pembimbingandan/atautugaslainnya. 4. Bagaimana akuntabilitas pelaksanaan PK GURU di sekolah? Apakah terjamin keberlanjutannyadanaparekomendasiuntukpeningkatannya?. Dengan menganalisis data, petugas monitoring dan evaluasi diharapkan dapat menjawab pertanyaan tersebut di atas serta dapat menarik kesimpulan yang obyektif terhadappelaksanaanPKGURU,sehinggamenggambarkankondisinyatasekolahyang dinilai. C. LaporanMonitoringdanEvaluasiProgramPKGURU Setelah melakukan monitoring dan evaluasi pelaksanaan PK GURU, tim/petugas menyusun laporan yang menggambarkan perencanaan, proses dan hasil yang dicapai. Adapunsistematikapelaporanadalahsebagaiberikut. 1. Pendahuluan Bagian pendahuluan merupakan rangkaian pemikiran yang mendasari kegiatan monitoringdanevaluasipelaksanaanPKGURU,yangmemuathalhalberikut. a. Latar Belakang: menggambarkan dasar pemikiran dilaksanakannya monitoring danevaluasi. b. Permasalahan: menggambarkan masalah penting yang berhubungan dengan pelaksanaanPKGURU. c. Tujuan: mencakup sejumlah karakter pelaksanaan PK GURU yang ingin dicapai dalamkegiatanmonitoringdanevaluasi. d. Manfaat: merupakan sejumlah harapan yang diintegrasikan pada penerapanan temuanhasilprosesmonitoringdanevaluasiPKGURU. e. Skenario kegiatan berisi rangkaian kegiatanyang akan dilakukan dalamkegiatan monitoringdanevaluasiPKGURU.

36

2. Metodologi Metodologi mencakup ruang lingkup, lokasi, populasi dan sampel, petugas monitoring,evaluasi,dananalisisdata. 3. Hasilmonitoringdanevaluasi Hasilmonitoringdanevaluasiadalahbagianintilaporanyangmenyajikandatadan hasil analisis, baik yang bersifat deskriptif kuantitatif maupun analisis yang bersifat kualitatif. Pembahasan hasil monitoring dan evaluasi adalah bagian penting yang menyampaikan ulasan dan pemaknaan terhadap hasil data kuantitatif dan kualitatif yang terkumpul untuk menjawab tujuan pelaksanaan monitoring dan evaluasi serta program pengembangan keprofesian berkelanjutan yang dapat memotretpelaksanaankegiatanPKGURUdilapangan. 4. KesimpulandanRekomendasi Berdasarkan hasil analisis, dibuat kesimpuan dan rekomendasi. Kesimpulan merupakan intisari terpenting dari pelaksanan monitoring dan evaluasi. Penyusunan kesimpulan hendaknya; (1) singkat, jelas, dan mudah dipahami; (2) selaras, sejalan dan sesuai dengan permasalahan kegiatan PK GURU; dan (3) menyampaikan permasalahan yang dihadapi dan upaya pemecahannya. Rekomendasi ditujukan untuk perbaikan pelaksanaan PK GURU dan sekaligus perbaikanpelaksanaanmonitoringdanevaluasinya. Laporan hasil monitoring dan evaluasi disampaikan oleh tim monitoring dan evaluasi kepada Kepala Dinas, Kepala Sekolah dan Koordinator PK GURU sekolah dan/atau institusi terkait sebagai bentuk pertanggungjawaban (akuntabilitas) pelaksanaan PK GURU. Hasil monitoring dan evaluasi yang diperoleh dari kegiatan yang dilakukan secara berkesinambungan, komprehensif, dan transparan diharapkan dapat memotivasi semua yang terlibat dalam program PK GURU untuk terus menerus berupaya meningkatkan mutu pelaksanaan program tersebut sebagai upaya peningkatan profesionalisme guru dalam menunjang peningkatan kualitaspendidikan.

37

38

BABVI PENUTUP PKGURUdilakukanuntukmelihatkinerjagurudalammelaksanakantugasutamanya,yaitu melaksanakan pembelajaran, pembimbingan dan/atau pelaksanaan tugas lain yang relevan dengan fungsi sekolah/madrasah. Hasil PK GURU selanjutnya digunakan untuk membantu guru dalam meningkatkan pengetahuan dan keterampilannya pada kompetensi tertentu sesuai keperluan. Dengan demikian diharapkan guru akan mampu berkontribusi secara optimal dalam upaya peningkatan kualitas pembelajaran peserta didik dan sekaligus membantu guru dalam pengembangan karirnya sebagai seorang yang profesional. Jadi, PK GURU merupakan bagian dari proses untuk meyakinkan semua pihak bahwa setiap guru adalah seorang yang profesional, dan peserta didik dapat memperoleh kesempatanterbaikuntukdapatberkembangsesuaikapasitasmasingmasing. Pelaksanaan terintegrasi antara PK GURU dan PKB akan menciptakan guru yang mempunyai motivasi tinggi, berdedikasi tinggi, terampil dalam membangkitkan minat peserta didik untuk menguasai ilmu pengetahuan dan teknologi, serta memiliki integritas kepribadian yang tangguh untuk berkompetisi di era global. Diharapkan pedoman pelaksanaan PK GURU ini dapat menjadi acuan bagi semua pihak yang terkait dengan pelaksanaanPKGURU.

39

40

LAMPIRAN1 INSTRUMEN PKGURUKELAS/MATAPELAJARAN

41

Lampiran1A Lembarpernyataankompetensi,indikator,dancaramenilai PKGuruKelas/MataPelajaran Sumber: Peraturan Menteri Pendidikan nasional16/2007 tentang Standar Kualifikasi AkademikdanKompetensiGuru BSNP versi 6.0. 11/2008 Kerangka Indikator untuk Pelaporan Pencapaian Standar NasionalPendidikan:StandarKualifikasiAkademikdanKompetensiGuru. Permenegpan dan RB 16/2009 tentang Jabatan Fungsional Guru dan Angka Kreditnya.
Kompetensi Pedagogik 1. 2. 3. 4. 5. 6. 7. Menguasaikarakteristikpesertadidik. Menguasasiteoribelajardanprinsipprinsippembelajaranyang mendidik. Pengembangankurikulum. Kegiatanpembelajaranyangmendidik. Pengembanganpotensipesertadidik. Komunikasidenganpesertadidik. Penilaiandanevaluasi. Pengamatan&Pemantauan Pengamatan Pengamatan Pengamatan Pengamatan&Pemantauan Pengamatan Pengamatan Caramenilai

Kepribadian 8. 9. Bertindaksesuaidengannormaagama,hukum,sosial,dankebudayaan Pengamatan&Pemantauan nasional. Menunjukkanpribadiyangdewasadanteladan. Pengamatan&Pemantauan Pengamatan&Pemantauan

10. EtosKerja,tanggungjawabyangtinggi,rasabanggamenjadiguru. Sosial 11. 12. Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif.

Pengamatan&Pemantauan Pemantauan

Komunikasidengansesamaguru,tenagakependidikan,orangtua, pesertadidik,danmasyarakat. Profesional 13. Penguasaanmateri,struktur,konsep,danpolapikirkeilmuanyang mendukungmatapelajaranyangdiampu. 14. MengembangkanKeprofesionalanmelaluitindakanyangreflektif.

Pengamatan Pemantauan

Keterangan Pengamatan adalah kegiatan untuk menilai kinerja guru melalui diskusi sebelum pengamatan, pengamatan selama pelaksanaan proses pembelajaran, dan diskusi setelah pengamatan. Pemantauan adalah kegiatan untuk menilai kinerja guru melalui pemeriksaan dokumen, wawancaradenganguruyangdinilai,dan/atauwawancaradenganwargasekolah.

42

Kompetensi1 Jenisdancaramenilai Pernyataan

1. 2. 3. 4. 5.
6.

:Mengenalkarakteristikpesertadidik :KompetensiPedagogik(PengamatandanPemantauan) : Guru mencatat dan menggunakan informasi tentang karakteristik peserta didik untuk membantu proses pembelajaran. Karakteristik ini terkait dengan aspek fisikintelektual,sosialemosional,moral,danlatarbelakangsosialbudaya. Indikator Gurudapatmengidentifikasikarakteristikbelajarsetiappesertadidikdikelasnya. Guru memastikan bahwa semua peserta didik mendapatkan kesempatan yang sama untuk berpartisipasi aktifdalamkegiatanpembelajaran. Guru dapat mengatur kelas untuk memberikan kesempatan belajar yang sama pada semua peserta didik dengankelainanfisikdankemampuanbelajaryangberbeda. Guru mencoba mengetahui penyebab penyimpangan perilaku peserta didik untuk mencegah agar perilaku tersebuttidakmerugikanpesertadidiklainnya. Gurumembantumengembangkanpotensidanmengatasikekuranganpesertadidik. Guru memperhatikan peserta didik dengan kelemahan fisik tertentu agar dapat mengikuti aktivitas pembelajaran,sehinggapesertadidiktersebuttidaktermarginalkan(tersisihkan,diolokolok,minder,dsb).

ProsesPenilaian SebelumPengamatan: 1. Mintalahdaftarnamapesertadidik. 1.1 Pilihlah 4 (empat) nama peserta didik secara random. Tanyakan bagaimana kemampuan belajar keempatpesertadidiktersebut.Mintalahbuktihasilulanganterakhirkeempatpesertadidiktersebut. 1.2 Pilihlah 4 (empat) nama peserta didik lain. Tanyakan bagaimana karakteristik keempat peserta didik tersebut(aktif,pendiam,pemalu,ceria,dsb.). 2. Mintalah guru untuk memilih satu nama peserta didik dengan karakteristik teretntu (misalnya aspek intelektual).Tanyakanbagaimanacaramembantumengembangkanpotensinyatersebut. 3. Mintalah guru memilih satu nama peserta didik dengan kekurangan tertentu (misalnya aspek sosial). Tanyakanbagaimanacaramembantupesertadidiktersebutuntukmengatasikelemahannya. 4. Tanyakan kepada guru, apakah di kelas ada peserta didik yang mempunyai kelainan fisik tertentu. Bila ada, bagaimanacaramemastikanbahwapesertadidiktersebutdapatbelajardenganbaik. 5. Tanyakan kepada guru, apakah barubaru ini ada kejadian luar biasa dalam keluarga peserta didik (kelahiran, kematian, sedang ada yang sakit, dsb.). Tanyakan apakah hal tersebut berdampak terhadap pembelajaranpesertadidikyangbersangkutan,danbagaimanamengatasinya. 6. Tanyakankepadaguruapakahadapesertadidikdikelasyangselalumenggangupesertadidiklain.Bilaada, bagaimanaupayauntukmencegahagarperilakutersebuttidakmerugikanpesertadidiklain. 7. Mintalah guru untuk menjelaskan karakteristik umum kelas yang diajarnya (kelas yang ratarata memiliki pesertadidikyangcerdas,kreatif,rataratabaikdalammatapelajarantertentu,dsb.). SelamaPengamatan: 1. Amati apakah guru mengatur posisi tempat duduk peserta didik sesuai dengan kegiatan/aktivitas pembelajaranyangdilakukan. 2. Amatiapakahguruhanyadiamdidepankelasatauberkelilingmensupervisisemuapesertadidik. 3. Amati apakah selama proses pembelajaran guru melakukan pengecekan secara rutin dengan bertanya kepada peserta didik tentang keterbacaan media belajar yang digunakan (termasuk penjelasan pada papan tulis). 4. Amati apakah selama proses pembelajaran guru melakukan pengecekan secara rutin bahwa semua peserta didiksecaraaktifmelaksanakantugastugasyangdiberikan. 5. Amati apakah ada peserta didik yang melakukan kegiatan lain di luar kegiatan yang seharusnya dilakukan danbagaimanagurubersikapterhadappesertadidikyangdemikian. Setelahpengamatan: 1. Tanyakan kepada guru apakah ada alasan tertentu dari penempatan peserta didik (posisi tempat duduk) di dalamkelas(karenapendengaranataupenglihatanyangkurangjelas,karenaperlukonsentrasi,dsb.). 2. Mintalah guru menjelaskan persepsinya tentang hasil pembelajaran peserta didik (apakah sukses, apakah adaanakyangtidakberpartisipasi,dsb.). Pemantauan: Periksa pada awal dan pertengahan semester apakah guru membuat catatan tentang kemajuan dan perkembanganpesertadidik.

43

Kompetensi2 Jenisdancaramenilai Pernyataan

1. 2. 3. 4. 5. 6.

:Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik. :Pedagogik(Pengamatan) : Guru menetapkan berbagai pendekatan, strategi, metode, dan teknik pembelajaran yang mendidik secara kreatif sesuai dengan standar kompetensi guru. Guru menyesuaikan metode pembelajaran supaya sesuai dengan karakteristikpesertadidikdanmemotivasimerekauntukbelajar. Indikator Guru memberi kesempatan kepada peserta didik untuk menguasai materi pembelajaran sesuai usia dankemampuanbelajarnyamelaluipengaturanprosespembelajarandanaktivitasyangbervariasi. Guru selalu memastikan tingkat pemahaman peserta didik terhadap materi pembelajaran tertentu dan menyesuaikanaktivitaspembelajaranberikutnyaberdasarkantingkatpemahamantersebut. Guru dapat menjelaskan alasan pelaksanaan kegiatan/aktivitas yang dilakukannya, baik yang sesuai maupunyangberbedadenganrencana,terkaitkeberhasilanpembelajaran. Gurumenggunakanberbagaiteknikuntukmemotiviasikemauanbelajarpesertadidik. Guru merencanakan kegiatan pembelajaran yang saling terkait satu sama lain, dengan memperhatikan tujuanpembelajaranmaupunprosesbelajarpesertadidik. Guru memperhatikan respon peserta didik yang belum/kurang memahami materi pembelajaran yang diajarkandanmenggunakannyauntukmemperbaikirancanganpembelajaranberikutnya. ProsesPenilaian

SebelumPengamatan: MintalahRPPpadagurudanperiksalahRPPtersebut. 1. Pilihlah satu topik pembelajaran tertentu. Tanyakan bagaimana strategi untuk mencapai tujuan pembelajaran tersebut, seberapa penting tujuan pembelajaran tersebut, dan bagaimana kaitannya dengantujuanpembelajaransebelumnya. 2. Tanyakan seberapa jauh kegiatan atau aktivitas pembelajaran yang akan dilaksanakan sesuai dengan usia,kesiapanbelajar,tingkatpembelajaran,dancarabelajarpsertadidik. 3. Tanyakan alasan yang melatar belakangi penyusunan rencana kegiatan atau rencana aktivitas dalam RPP. SelamaPengamatan: 1. Amatiapakahgurumelaksanakanaktivitaspembelajaransecarabervariasi. 2. Amati apakah guru memberi kesempatan kepada semua peserta didik untuk menguasai materi pembelajaransesuaiusiadankemampuanbelajarnya. 3. Amatiapakahguruselalumemastikantingkatpemahamanpesertadidikterhadapmateripembelajaran tertentu dan menyesuaikan aktivitas pembelajaran berikutnya berdasarkan tingkat pemahaman tersebut. 4. Amati apakah guru memanfaatkan berbagai teknik untuk memberikan motivasi kemauan belajar pesertadidikmelaluipemanfaatanberbagaiteknikpembelajaran. 5. Amati bagaimana guru menghubungkan halhal baru dengan pengetahuan awal yang dimiliki peserta didik. 6. Amati bagaimana kegiatan yang dilaksanakan dapat membantu peserta didik untuk mencapai tujuan pembelajaran. 7. Amatibagaimanagurumenanggapiresponpesertadidikterhadapmateriyangsedangdiajarkan. Setelahpengamatan: 1. Pilihlah satu aktivitas guru di kelas (yang diamati pada saat pengamatan) yang sesuai dengan rencana pembelajaran. Tanyakan mengapa guru melaksanakan aktivitas tersebut dan bagaimana kaitannya dengantujuanpembelajaran. 2. Pilihlah satu aktivitas di kelas (yang diamati pada saat pengamatan) yang dilaksanakan berbeda dari rencana pembelajaran. Tanyakan mengapa guru mengubah pelaksanaan pembelajaran menjadi sangat berbeda dengan rencana semula. Tanyakan pula apakah pengubahan tersebut terkait dengan keberhasilanpembelajaran. Pemantauan:

44

Kompetensi3 :Pengembangankurikulum Jenisdancaramenilai :Pedagogik(Pengamatan) Pernyataan : Guru menyusun silabus sesuai dengan tujuan terpenting kurikulum dan menggunakan RPP sesuai dengan tujuan dan lingkungan pembelajaran. Guru memilih, menyusun, dan menata materi pembelajaran yang sesuai dengankebutuhanpesertadidik. Indikator 1. Gurudapatmenyusunsilabusyangsesuaidengankurikulum. 2. Guru merancang rencana pembelajaran yang sesuai dengan silabus untuk membahas materi ajartertentuagarpesertadidikdapatmencapaikompetensidasaryangditetapkan. 3. Gurumengikutiurutanmateripembelajarandenganmemperhatikantujuanpembelajaran. 4. Guru memilih materi pembelajaran yang: a) sesuai dengan tujuan pembelajaran, b) tepat dan mutakhir, c) sesuai dengan usia dan tingkat kemampuan belajar peserta didik, d) dapat dilaksanakandikelasdane)sesuaidengankontekskehidupansehariharipesertadidik. ProsesPenilaian SebelumPengamatan: Periksalah RPP, dan cermati apakah RPP tersebut telah sesuai dengan silabus dalam kurikulumsekolah. SelamaPengamatan: 1. Amatiseberapalancar,jelasdanlengkapgurumenyampaikanmateriyangdiajarkannya. 2. Amati bagaimana guru menyesuaikan materi yang dijarkan dengan usia, latar belakang, dan tingkatpembelajaranpesertadidik. 3. Amati bagaimana guru menghubungkan materi yang diajarkan dengan lingkungan dan kehidupansehariharipesertadidik. 4. Amatiapakahmateriyangdiajarkanguruadalahmateriyangmutakhir. 5. Amati apakah kegiatan/aktifitas pembelajaran yang dilaksanakan guru mencakup berbagai tipepembelajaransiswa. 6. Amati bagaimana guru membantu mengembangkan kemampuan atau keterampilan generiknya(kreatifitas,berpikirkritis,berpikirinovatif,danpemecahanmasalah,dsb):Berapa jauh pengetahuan atau keterampilan generik tersebut tercakup dalam mata pelejaran tersebut. Setelahpengamatan: Meminta guru menjelaskan bagaimana dia memanfaatkan hasil pembelajaran yang dilaksanakannyauntukmengembangkantopikmatapelajaranberikutnya. Pemantauan:

45

Kompetensi4 :KegiatanPembelajaranyangMendidik Jenisdancaramenilai :Pedagogik(Pengamatan) Pernyataan : Guru menyusun dan melaksanakan rancangan pembelajaran yang mendidik secara lengkap. Guru melaksanakan kegiatan pembelajaran yang sesuai dengan kebutuhan peserta didik. Guru menyusun dan menggunakan berbagai materi pembelajaran dan sumber belajar sesuai dengan karakteristik peserta didik. Jika relevan, guru memanfaatkan teknologiinformasikomunikasi(TIK)untukkepentinganpembelajaran.
Indikator Guru melaksanakan aktivitas pembelajaran sesuai dengan rancangan yang telah disusun secara lengkap dan pelaksanaan aktivitastersebutmengindikasikanbahwagurumengertitentangtujuannya. 2. Guru melaksanakan aktivitas pembelajaran yang bertujuan untuk membantu proses belajar peserta didik, bukan untuk mengujisehinggamembuatpesertadidikmerasatertekan. 3. Guru mengkomunikasikan informasi baru (misalnya materi tambahan) sesuai dengan usia dan tingkat kemampuan belajar pesertadidik. 4. Guru menyikapi kesalahan yang dilakukan peserta didik sebagai tahapan proses pembelajaran, bukan sematamata kesalahan yang harus dikoreksi. Misalnya: dengan mengetahui terlebih dahulu peserta didik lain yang setuju/tidak setuju denganjawabantersebut,sebelummemberikanpenjelasantentangjawabanygbenar. 5. Guru melaksanakan kegiatan pembelajaran sesuai isi kurikulum dan mengkaitkannya dengan konteks kehidupan seharihari pesertadidik. 6. Guru melakukan aktivitas pembelajaran secara bervariasi dengan waktu yang cukup untuk kegiatan pembelajaran yang sesuaidenganusiadantingkatkemampuanbelajardanmempertahankanperhatianpesertadidik. 7. Guru mengelola kelas dengan efektif tanpa mendominasi atau sibuk dengan kegiatannya sendiri agar semua waktu peserta dapattermanfaatkansecaraproduktif. 8. Gurumampumenyesuaikanaktivitaspembelajaranyangdirancangdengankondisikelas. 9. Guru memberikan banyak kesempatan kepada peserta didik untuk bertanya, mempraktekkan dan berinteraksi dengan pesertadidiklain. 10. Gurumengaturpelaksanaanaktivitaspembelajaransecarasistematisuntukmembantuprosesbelajarpesertadidik.Sebagai contoh:gurumenambahinformasibarusetelahmengevaluasipemahamanpesertadidikterhadapmaterisebelumnya. 11. Gurumenggunakanalatbantumengajar,dan/atauaudiovisual(termasukTIK)untukmeningkatkanmotivasibelajarpeserta didikdalammencapaitujuanpembelajaran. 1.

ProsesPenilaian SebelumPengamatan: MintalahRPPpadagurudanperiksalahRPPtersebut. 1. Tanyakan tentang topik dan kegiatan pembelajaran yang akan dilakukan. Tanyakan apakah kemungkinan akan ada kesulitan dalammembahastopiktersebutuntukmencapaitujuanyangditetapkan. 2. Bila ada peserta didik yang mengalami kesulitan untuk memahami materi tersebut, bagaimana strategi guru untuk mengatasinya. 3. Tanyakanbagaimanacaramenentukantingkatpemahamanpesertadidikterhadaptopiktsb. SelamaPengamatan: 1. Amati apakah guru menyesuaikan kemampuan peserta untuk berkonsentrasi dalam menerima pelajaran sesuai dengan tingkatperkembangannya 2. Amati apakah semua kegiatan yang dilaksanakan dalam pembelajaran dapat membantu peserta didik untuk mencapai tujuanpembelajaran 3. Amati bagaimana guru mengelola aktifitas (misalnya apakah waktunya sesuai dengan RPP atau yang direncanakan, apakah gurumelaksanakanpembelajaransesuai/tidakdgtujuanpembelajaranygdirencanakan 4. Amati seberapa lama waktu yang digunakan oleh peserta didik untuk melaksanakan kegiatan/aktifitas pembelajaran untuk menghasilkan sesuatu yang bersifat produktif, dan berapa lama peserta didik hanya menerima keterangan, informasi atau instruksidarigurudalampembelajarannya 5. Amati bagaimana guru membantu setiap peserta didik untuk melakukan kegiatannya masingmasing, apakah ada peserta didikygtidakterlibataktifdlmpembelajarannya&bagaimanagurumenanganipesertadidiktsb. 6. Amati bagaimana guru menggunakan media pembelajaran tersebut di bawah ini, apakah sesuai dengan tujuan pembelajaran, apakah dapat membantu cara belajar atau memotivisai peserta didik, serta seberapa terampil guru menggunakannya. a) Papan tulis; b) Gambar dan/atau bahan tercetak; c) Alat bantu video visual; c) Komputer/TIK; dan d) Medialainnya. Setelahpengamatan: Mintalah guru untuk menjelaskan seberapa jauh tingkat keberhasilan dalam pembelajaran yang dilaksanakan, dan mengidentifikasikanbagianapayangperludiperbaiki. Pemantauan:

46

Kompetensi5 Pernyataan

:Memahamidanmengembangkanpotensi :Pedagogik(PengamatandanPemantauan)

Jenisdancaramenilai

1. 2. 3. 4. 5. 6. 7.

:Guru menganalisis potensi pembelajaran setiap peserta didik dan mengidentifikasi pengembangan potensi peserta didik melalui program pembelajaran yang mendukung siswa mengaktualisasikan potensi akademik, kepribadian, dan kreativitasnya sampai ada bukti jelas bahwa peserta didik mengaktualisasikanpotensimereka. Indikator Gurumenganalisishasilbelajarberdasarkansegalabentukpenilaianterhadapsetiappesertadidikuntuk mengetahuitingkatkemajuanmasingmasing. Guru merancang dan melaksanakan aktivitas pembelajaran yang mendorong peserta didik untuk belajar sesuaidengankecakapandanpolabelajarmasingmasing. Guru merancang dan melaksanakan aktivitas pembelajaran untuk memunculkan daya kreativitas dan kemampuanberfikirkritispesertadidik. Guru secara aktif membantu peserta didik dalam proses pembelajaran dengan memberikan perhatian kepadasetiapindividu. Guru dapat mengidentifikasi dengan benar tentang bakat, minat, potensi, dan kesulitan belajar masing masingpesertadidik. Guru memberikan kesempatan belajar kepada peserta didik sesuai dengan cara belajarnya masing masing. Guru memusatkan perhatian pada interaksi dengan peserta didik dan mendorongnya untuk memahami danmenggunakaninformasiyangdisampaikan.

ProsesPenilaian SebelumPengamatan: Periksadaftarhadir,pilih4(empat)namapesertadidiksecaraacak,danmintalahgurumenerangkanhal halberikut: 1. Bagaimanagurudapatmenunjukkankekuatandankelemahanbelajarpesertadidik(misalnyamelalui pengamatansikappesertadidikterhadapmateriataumatapelajarantertentu). 2. Tindakan apa yang dilakukan guru untuk mengembangkan kekuatan dan mengatasi kelemahan tersebut. 3. ApakahpesertadidiktersebutpernahmendapatlayanankhususdariguruBK. SelamaPengamatan: 1. Amati seberapa jauh guru memperhatikan setiap peserta didik, apakah guru hanya memberikan perhatiankepadapesertadidikyangmemilikikelebihantertentusaja. 2. Amatibagaimanagurumenyakinkansetiappesertadidikterlibatsecaraaktifdalampembelajaran. 3. Amati seberapa jauh guru memberikan perhatian terhadap kontribusi yang diberikan oleh peserta didik dan berapa banyak kesempatan yang diberikan kepada peserta didik untuk menyampaikan pemikiran/pendapatnya. 4. Amati bagaimana guru memotivasi peserta didik untuk bertanya tentang halhal yang berkaitan dengan topikyangdibahas. 5. Amatibagaimanagurumemotivasipesertadidikuntukmengembangkanpemikirandanpengalamannya yangmelebihipengetahuandanpengalamandilingkungandankehidupanseharihari. Setelahpengamatan: 1. Mintalahgurumenjelaskanapakahadatindaklanjutyangakandilakukankarenatopiktersebutmenarik atausulit,danbagaimanamelanjutkannya. 2. Mintalah guru menjelaskan apakah ada peserta didik yang pernah mendapat perhatian khusus untuk mengembangkanpotensinyadanmanfaatnyauntukperbaikanRPP. Pemantauan: Periksaapakahgurumemilikidokumententangkemajuanbelajarsetiappesertadidik.

47

Kompetensi6 :KomunikasidenganPesertaDidik Jenisdancaramenilai :Pedagogik(Pengamatan) Pernyataan :Guru berkomunikasi secara efektif, empatik dan santun dengan peserta didik dan bersikap antusias dan positif. Guru memberikan respon yang lengkapdanrelevankepadakomentarataupertanyaanpesertadidik.
1. Indikator Gurumenggunakanpertanyaanuntukmengetahuipemahamandanmenjagapartisipasipesertadidik, termasukmemberikanpertanyaanterbukayangmenuntutpesertadidikuntukmenjawabdenganide danpengetahuanmereka. Gurumemberikanperhatiandanmendengarkansemuapertanyaandantanggapanpesertadidik,tanpa menginterupsi,kecualijikadiperlukanuntukmembantuataumengklarifikasipertanyaan/tanggapan tersebut. Gurumenanggapipertanyaanpesertadidiksecaratepat,benar,danmutakhir,sesuaitujuan pembelajarandanisikurikulum,tanpamempermalukannya. Gurumenyajikankegiatanpembelajaranyangdapatmenumbuhkankerjasamayangbaikantarpeserta didik. Gurumendengarkandanmemberikanperhatianterhadapsemuajawabanpesertadidikbaikyangbenar maupunyangdianggapsalahuntukmengukurtingkatpemahamanpesertadidik. Gurumemberikanperhatianterhadappertanyaanpesertadidikdanmeresponnyasecaralengkapdan relevanuntukmenghilangkankebingunganpadapesertadidik. ProsesPenilaian SebelumPengamatan: Mintalahgurumenjelaskanbagaimanamendoronginteraksiaktifantarpesertadidik SelamaPengamatan: 1. Amatiberapalamawaktuyangdigunakanoleh: a) guruuntukberbicaradikelas; b) guruuntukberbicarakepadapesertadidiksecaraindividu; c) pesertadidikuntukmenjawabpertanyaanguru; d) pesertadidikuntukmemulaiberinterkasidenganguru; e) pesertadidikuntukbekerjabersamasama; f) pesertadidikuntukbekerjamandiri. Amatisaatpesertadidikbekerjadalamkelompok,berapabanyakanggotanya,danapakahsetiap anggotakelompokmemilikiwaktuyangcukupuntukberpatisipasisecaraaktifdalamkegiatanyang sedangdilakukan. Amatibagaimanagurumemastikanpesertadidikyangdudukdibelakangataudisampingkanankiri kelasuntukberpartisipasiaktifdalamprosespembelajaran. Amativariasipertanyaanyangdigunakanguru(apakahpertanyaantersebuthanyauntukanakyang pandaiataumencakupjugauntukanakyangkurangpandai). Cermatiseberapabanyakpertanyaanterbukayangdisampaikanolehgurudibandingkanpertanyaan yangtelahdiketahuijawabannya. Amatibagaimanacaragurumemilihpesertadidikyangakanmenjawabpertanyaantersebut.

2.

3. 4. 5. 6.

2.

3. 4. 5. 6. 7.

Amatibagaimanagurumeresponjawabanpesertadidikdanberapaseringgurumendorongpeserta didikuntukbekerjasamadalammenjawabpertanyaan. Setelahpengamatan: Memintagurumenjelaskantentangpersepsinyaberkaitandenganefektifitaskomunikasiyangterjadi selamaprosespembelajaran,misalnyapertanyaandaripesertadidikcukupbanyak. Pemantauan:

48

Kompetensi7 :PenilaiandanEvaluasi Jenisdancaramenilai :Pedagogik(Pengamatan) Pernyataan :Guru menyelenggarakan penilaian proses dan hasil belajar secara berkesinambungan. Guru melakukan evaluasi atas efektivitas proses dan hasil belajar dan menggunakan informasi hasil penilaian dan evaluasi untuk merancang program remedial dan pengayaan. Guru menggunakan hasilanalisispenilaiandalamprosespembelajarannya.
Indikator Guru menyusun alat penilaian yang sesuai dengan tujuan pembelajaran untuk mencapai kompetensi tertentusepertiyangtertulisdalamRPP. 2. Guru melaksanakan penilaian dengan berbagai teknik dan jenis penilaian, selain penilaian formal yang dilaksanakan sekolah, dan mengumumkan hasil serta implikasinya kepada peserta didik, tentang tingkat pemahamanterhadapmateripembelajaranyangtelahdanakandipelajari. 3. Guru menganalisis hasil penilaian untuk mengidentifikasi topik/kompetensi dasar yang sulit sehingga diketahui kekuatan dan kelemahan masingmasing peserta didik untuk keperluan remedial dan pengayaan. 4. Guru memanfaatkan masukan dari peserta didik dan merefleksikannya untuk meningkatkan pembelajaran selanjutnya, dan dapat membuktikannya melalui catatan, jurnal pembelajaran, rancangan pembelajaran,materitambahan,dansebagainya. 5. Guru memanfatkan hasil penilaian sebagai bahan penyusunan rancangan pembelajaran yang akan dilakukanselanjutnya. 1.

ProsesPenilaian SebelumPengamatan: 1. Meminta guru untuk menyediakan RPP dan alat penilaian. Periksa apakah alat penilaian sesuai dengan tujuan pembelajaran. Mintalah guru menjelaskan bagaimana memanfaatkan perangkat tersebut untuk merencanakan,memonitorkemajuandanperkembanganpesertadidikdalampembelajarannya. 2. Memintagurumenjelaskanberbagaiteknikdanjenispenilaianyangpernahdilakukan. SelamaPengamatan: SetelahPengamatan: 1. Meminta guru menjelaskan bagaimana cara memperoleh masukan balik tentang pengajarannya (misalnyaevaluasiolehpesertadidik,komentardaritemansekerja,refleksidiri,dsb). 2. Memintagurumenunjukkanhasilanalisispenilaiandanmenunjukkantopikkempetensiyangsulituntuk keperluanremedial. 3. Bagaimana guru mengkomunikasikan hasil penilaian kepada peserta didik dan menunjukkan materi pembelajaranyangbelumdikuasaipesertadidik. 4. Bagaimana guru mendeskripsikan dan memanfaatkan hasil analisis penilaian untuk merencanakan dan melaksanakanpembelajaranberikutnya. Pemantauan:

49

: Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaan nasionalIndonesia Jenisdancaramenilai : Kepribadian(PengamatandanPemantauan) Pernyataan : GurubertindaksesuaidenganhukumdiIndonesia.Semuakegiatanyang dilaksanakan oleh guru mengindikasikan penghargaanya terhadap berbagai keberagaman agama, keyakinan yang dianut, suku, adat istiadat daerah asal, latar belakang sosial ekonomi, dan/atau tampilan fisik.
Indikator 1. 2. 3. 4. 5. Guru menghargai dan mempromosikan prinsipprinsip Pancasila sebagai dasar ideologi dan etika bagi semuawargaIndonesia. Guru mengembangkan kerjasama dan membina kebersamaan dengan teman sejawat tanpa memperhatikanperbedaanyangada(misalnya:suku,agama,dangender). Guru saling menghormati dan menghargai teman sejawat sesuai dengan kondisi dan keberadaan masingmasing. GurumemilikirasapersatuandankesatuansebagaibangsaIndonesia. Guru mempunyai pandangan yang luas tentang keberagaman bangsa Indonesia (misalnya: budaya, suku,agama). ProsesPenilaian SebelumPengamatan: BagaimanapandangangurutentangkeberagamanbangsaIndonesia(misalnya:budaya,suku,agama). SelamaPengamatan: SetelahPengamatan: Pemantauan: Penilai mewawancarai warga sekolah (teman sejawat, peserta didik, orang tua, dan tenaga kependidikan lainnya),danmemintapenjelasandancontohtentangperilakudanreputasiguruyangdinilaiterkaitdengan: 1. 2. bagaimanagurumemahamiprinsipprinsipPancasilasebagaidasarideologidanetikabagisemuawarga Indonesia; bagaimana sikap guru dalam pergaulan seharihari (menghormati, menghargai, dan membantu satu sama lain, sesuai dengan kondisi dan keberadaan masingmasing, bangga sebagai bangsa Indonesia); dan

Kompetensi8

3. bagaimanapandangangurutentangkeberagamanbangsaIndonesia(misalnya:budaya,suku,agama).

50

Kompetensi9 :Menunjukkanpribadiyangdewasadanteladan Jenisdancaramenilai :Kepribadian(PengamatandanPemantauan) Pernyataan : Guru menampilkan diri sebagai teladan bagi peserta didik dan masyarakat. Guru dihormati oleh peserta didiknya dan oleh anggota masyarakatsekitarnya,termasukorangtuasiswa.
Indikator 1. 2. 3. Gurubertingkahlakusopandalamberbicara,berpenampilan,danberbuatterhadapsemuapeserta didik,orangtua,dantemansejawat. Gurumaumembagipengalamannyadengankolega,termasukmengundangmerekauntuk mengobservasicaramengajarnyadanmemberikanmasukan. Gurumampumengelolapembelajaranyangmembuktikanbahwagurudihormatiolehpesertadidik, sehinggasemuapesertadidikselalumemperhatikangurudanberpartisipasiaktifdalamproses pembelajaran. Gurubersikapdewasadalammenerimamasukandaripesertadidikdanmemberikankesempatan kepadapesertadidikuntukberpartisipasidalamprosespembelajaran. Guruberperilakubaikuntukmencitrakannamabaiksekolah.

4. 5.

ProsesPenilaian SebelumPengamatan: SelamaPengamatan: 1. Amatibagaimanaguruberbicaradanbersikapterhadappesertadidiknya(misalnyaapakahsesuai denganusia,tidakmerendahkandiripesertadidik,santun,dsb.). 2. Amatibagaimanapesertadidikberbicaradanbersikapterhadapgurunya(misalnyasopan,santun, terbuka,apakahpesertadidikselalumemperhatikanguruwaktuberbicara,selalumelaksanakan petunjukguru,apakahguruperlumedisiplinkanpesertadidiknya,dsb.). 3. Amatibagaimanagurumemastikansetiappesertadidikmelakukantugasdanberpartisipasiaktifdalam pembelajarannya. SetelahPengamatan: Pemantauan: Penilaimelakukanwawancaradengankepalasekolah,wakilkepalasekolahdan/ataukoordinatorPKB tentang: 1. kehadirangurudisekolahdandikelas(apakahselaluhadirsesuaijammengajarnya,apakahselalu masukkelastepatwaktu,dsb.); 2. apakahgurumemenuhitugasnonpembelajarannyadanbagaimanagurumempersiapkantugastugas tersebut(misalnyaapakahhasiltesdikembalikankepadapesertadidiktepatwaktu,apakahrajin melakukansupervisikegiatanekstrakurikulum,dsb),danapakahpekerjaannyasesuaidenganstandar yangdiharapkanolehsekolah; 3. bagaimanaguruberbagipengalamankeberhasilandalampembelajarandengantemansejawat;dan 4. bagaimanagurubekerjasebagaianggotakelompokdalamkomunitassekolahtermasukdalamkegiatan KKG/MGMP.

51

Kompetensi10 :Etoskerja,tanggungjawabyangtinggi,rasabanggamenjadiguru Jenisdancaramenilai :Kepribadian(PengamatandanPemantauan) Pernyataan :Guru berperilaku sesuai dengan kode etik profesi guru. Guru melaksanakan tugasnya sesuai dengan harapan kepala sekolah/madrasah dan komite sekolah/madrasah. Semua kegiatan guru memperhatikan kebutuhan peserta didik, teman sekerja, dan tujuan sekolah.
Indikator 1. Gurumengawalidanmengakhiripembelajarandengantepatwaktu. 2. Jikaguruharusmeninggalkankelas,gurumengaktifkansiswadenganmelakukanhalhalproduktifterkait denganmatapelajaran,danmemintagurupiketataugurulainuntukmengawasikelas. 3. Guru memenuhi jam mengajar dan dapat melakukan semua kegiatan lain di luar jam mengajar berdasarkanijindanpersetujuanpengelolasekolah. 4. Gurumemintaijindanmemberitahulebihawal,denganmemberikanalasandanbuktiyangsahjikatidak menghadirikegiatanyangtelahdirencanakan,termasukprosespembelajarandikelas. 5. Guru menyelesaikan semua tugas administratif dan nonpembelajaran dengan tepat waktu sesuai standaryangditetapkan. 6. Guru memanfaatkan waktu luang selain mengajar untuk kegiatan yang produktif terkait dengan tugasnya. 7. Guru memberikan kontribusi terhadap pengembangan sekolah dan mempunyai prestasi yang berdampakpositifterhadapnamabaiksekolah. 8. Gurumerasabanggadenganprofesinyasebagaiguru.

ProsesPenilaian Sebelumpengamatan: SelamaPengamatan: Amati apakah guru memiliki materi tambahan sesuai dengan tujuan pembelajaran yang dapat dipergunakanolehgurupiketapabilagurubersangkutanharusmelakukantugaslain. Setelahpengamatan: Pemantauan: 1. Duakalidalamsatusemester,penilaimelakukankunjungankekelasdiawal,ditengahdandiakhirjam pelajaranyangmengamati: 1.1.apakahgurutepatwaktudalammengawalidanmengakhirikelasnya;dan 1.2.apakahpesertadidiknyatetapmelakukantugastugasmerekasesuaidenganjadwal. 2. Duakalidalamsatusemesterpenilaibertanyakepadapesertadidik,diantaranya: 1.1.apakahguruyangbersangkutanpernahtidakhadir 1.2.jikagurutidakhadir,kegiatanapayangdilakukanolehpesertadidik. 3. Dalam wawancara dengan warga sekolah (teman sejawat, peserta didik, orang tua, dan tenaga kependidikan lainnya, koordinator PKB), penilai meminta mereka untuk menjelaskan perilaku guru yang dinilaiterhadaptugastugasnonpembelajaran.

52

Kompetensi11 :Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif. Jenisdancaramenilai :Sosial(PengamatandanPemantauan) Pernyataan :Guru menghargai peserta didik, orang tua peserta didik dan teman sejawat. Guru bertindak inklusif, serta tidak diskriminatif terhadap peserta didik, teman sejawat, dan masyarakat sekitar. Guru menerapkan metode pembelajaran yang memfasilitasi pembelajaran semua peserta didik.
Indikator 1. 2. 3.

Guru memperlakukan semua peserta didik secara adil, memberikan perhatian dan bantuan sesuai kebutuhanmasingmasing,tanpamemperdulikanfaktorpersonal. Guru menjaga hubungan baik dan peduli dengan teman sejawat (bersifat inklusif), serta berkontribusi positifterhadapsemuadiskusiformaldaninformalterkaitdenganpekerjaannya. Guru sering berinteraksi dengan peserta didik dan tidak membatasi perhatiannya hanya pada kelompok tertentu(misalnya:pesertadidikyangpandai,kaya,berasaldaridaerahyangsamadenganguru). ProsesPenilaian

SebelumPengamatan: SelamaPengamatan: 1. Amatibagaimanagurumembagiwaktunyadalamberinteraksidenganpesertadidik,baiksecaraindividu maupunkelompok. 2. Amati bagaimana guru melakukan interaksi (bertanya, berdiskusi, dsb) dengan peserta didik untuk menarikperhatianseluruhpesertadidikdikelas. 3. Amatibagaimanagurumenghargaiprosesdanhasilkerjapesertadidikyangdianggapbaik. 4. Amatibagaimanagurumenanganipersainganyangtidaksehatantarpesertadidik. 5. Amati bagaimana guru manangani peserta didik yang melakukan tindakan negatif terhadap peserta didiklainnya(misalnyadiskriminasietnik,gender,agama,dsb.). 6. Amati apakah guru memberikan perhatian yang sama terhadap setiap peserta didik, atau hanya memberikanperhatianterhadappesertadidikataukelompokpesertadidiktertentu. SetelahPengamatan: Pemantauan: 1. Tanyakankepadakepalasekolah,wakilkepalasekolah,ataukoordinatorPKBtentang: 1.1.hubungandankepedulianguruterhadaptemansejawatdanorangtuapesertadidik;dan 1.2.kontribusigurudalamberbagaidiskusiformaldaninformalterkaitdenganpekerjaannya.

53

Kompetensi12

:Komunikasi dengan sesama guru, tenaga kependidikan, orang tua pesertadidik,danmasyarakat. Jenisdancaramenilai :Sosial(Pemantauan) Pernyataan :Guru berkomunikasi secara efektif baik lisan maupun tulisan dengan orang tua peserta didik dan masyarakat. Guru menyediakan informasi resmi(baiklisanmaupuntulisan)kepadaorangtuapesertadidiktentang program pembelajaran dan kemajuan peserta didik (sekurangkurangnya dua kali dalam setahun). Guru berpartisipasi dalam kegiatan kerjasama antara sekolah dan masyarakat dan berkomunikasi dengan komunitas profesidanberpartisipasidalamkegiatanyangrelevan.
Indikator Guru menyampaikan informasi tentang kemajuan, kesulitan, dan potensi peserta didik kepada orang tuanya, baik dalam pertemuan formal maupun tidak formal antara guru dan orang tua, teman sejawat, dandapatmenunjukkanbuktinya. Guru ikut berperan aktif dalam kegiatan di luar pembelajaran yang diselenggarakan oleh sekolah dan masyarakatdandapatmemberikanbuktikeikutsertaannya. Guru memperhatikan sekolah sebagai bagian dari masyarakat, berkomunikasi dengan masyarakat sekitar,sertaberperandalamkegiatansosialdimasyarakat. ProsesPenilaian

1.

2. 3.

SebelumPengamatan: SelamaPengamatan: SetelahPengamatan: Pemantauan: 1. Penilai meminta guru menyediakan dokumen/catatan tentang pertemuan guru dengan orang tua berkaitan dengan kemajuan, kesulitan, dan potensi peserta didik. Cermati dan catat aspek spesifik yang telahdilakukanguruterkaitdenganhalhaltersebut. Penilai meminta guru menyediakan dokumen/catatan yang membuktikan kerjasamanya dengan teman sejawat dan/atau tenaga kependidikan untuk membantu peserta didik yang membutuhkan layanan khusus(misalnyalayananBKdenganguruBK,layananadministrasidengantenagakependidikan,dsb). Tanyakankepadatemansejawatdan/atauorangtuapesertadidiktentangperilaku,sikap,ataukegiatan guruyangberhubungandengankegiatannonpembelajaran.

2.

3.

54

Kompetensi13

:Penguasaanmateristrukturkonsepdanpolapikirkeilmuanyangmen dukungmatapelajaranyangdiampu. Jenisdancaramenilai :Profesional(Pengamatan) Pernyataan : Rancangan, materi dan kegiatan pembelajaran, penyajian materi baru dan respon guru terhadap peserta didik memuat informasi pelajaran yang tepat dan mutakhir. Pengetahuan ini ditampilkan sesuai dengan usia dan tingkat pembelajaran peserta didik. Guru benarbenar memahami mata pelajaran dan bagaimana mata pelajaran tersebut disajikan di dalam kurikulum. Guru dapat mengatur, menyesuaikan dan menambah aktifitas untuk membantu peserta didik menguasai aspek aspek penting dari suatu pelajaran dan meningkatkan minat dan perhatianpesertadidikterhadappelajaran.
Indikator Guru melakukan pemetaan standar kompetensi dan kompetensi dasar untuk mata pelajaran yang diampunya, untuk mengidentifikasi materi pembelajaran yang dianggap sulit, melakukan perencanaan danpelaksanaanpembelajaran,danmemperkirakanalokasiwaktuyangdiperlukan. Guru menyertakan informasi yang tepat dan mutakhir di dalam perencanaan dan pelaksanaan pembelajaran. Guru menyusun materi, perencanaan dan pelaksanaan pembelajaran yang berisi informasi yang tepat, mutakhir,danyangmembantupesertadidikuntukmemahamikonsepmateripembelajaran. ProsesPenilaian

1.

2. 3.

SebelumPengamatan: Cermati RPP. Pelajari apakah materi yang tercakup dalam RPP merupakan materi yang tepat dan mutakhir. SelamaPengamatan: 1. Amati apakah guru menguasai, terampil dan lancar dalam melaksanakan kegiatan pembelajaran atau apakahguruharusseringmenggunakancatatanataubukuuntukmenyampaikanpembelajaran. 2. Amati apakah guru melaksanakan kegiatan pembelajaran berdasarkan kerangka topik yang dibahas, apakahgurudapatmengidentifikasibagianbagianyangpentingatautidakdaritopiktersebut. 3. Amatiapakahgurumengetahuitopiktopiktertentuyangmungkinsulitdipahamiolehpesertadidikdan memerlukanpengulangansecarabervariasi. 4. Amati bagaimana guru merespon pertanyaan atau pendapat peserta didik (apakah guru mau mendengar,menghargaidanmeresponsecaratepatdanbenarpertanyaandanpendapatpesertadidik). 5. Amatibagaimanagurumenanggapipertanyaanatautanggapanpesertadidikyangtidakrelevandengan tujuanpembelajaran. 6. Amati berapa lama guru menanggapi pertanyaan atau tanggapan peserta didik tertentu tanpa mengabaikanpesertadidiklainnya. Setelahpengamatan: Pemantauan:

55

Kompetensi14 :Mengembangkankeprofesianmelaluitindakanreflektif Jenisdancaramenilai :Profesional(Pemantauan) Pernyataan : Guru melakukan refleksi terhadap kinerja sendiri secara terus menerus dan memanfaatkan hasil refleksi untuk meningkatkan keprofesian. Guru melakukan penelitian tindakan kelas dan mengikuti perkembangan keprofesian melalui belajar dari berbagai sumber, guru juga memanfaatkan TIK dalam berkomunikasi dan pengembangan keprofesianjikadimungkinkan.

Indikator
1. Guru melakukan evaluasi diri secara spesifik, lengkap, dan didukung dengan contoh pengalamandirisendiri. 2. Guru memiliki jurnal pembelajaran, catatan masukan dari teman sejawat atau hasil penilaian prosespembelajaransebagaibuktiyangmenggambarkankinerjanya. 3. Guru memanfaatkan bukti gambaran kinerjanya untuk mengembangkan perencanaan dan pelaksanaan pembelajaran selanjutnya dalam program Pengembangan Keprofesian Berkelanjutan(PKB). 4. Guru dapat mengaplikasikan pengalaman PKB dalam perencanaan, pelaksanaan, penilaian pembelajarandantindaklanjutnya. 5. Guru melakukan penelitian, mengembangkan karya inovasi, mengikuti kegiatan ilmiah (misalnyaseminar,konferensi),danaktifdalammelaksanakanPKB. 6. GurudapatmemanfaatkanTIKdalamberkomunikasidanpelaksanaanPKB.

ProsesPenilaian
Sebelumpengamatan: SelamaPengamatan: SetelahPengamatan: Pemantauan: 1. PenilaimemintagurumenyediakanevaluasidiridanrencanatahunanprogramPKB. 2. Penilai meminta guru menyediakan bukti tentang keikutsertaanya dalam melaksanakan kegiatanPKB. 3. Penilai meminta guru menjelaskan dampak PKB terhadap pembelajaran dengan contoh atau buktiyangdapatdipertanggungjawabkan. 4. Penilai meminta guru menyediakan bukti tentang refleksi diri misalnya jurnal pembelajaran, catatanpentingdalamRPP,dsb. 5. Penilai bertanya kepada guru apakah pernah mengakses laman (website) yang terkait dengan programPKB,jikayaberikancontohnya. 6. Penilai meminta guru menjelaskan bagaimana memperoleh masukan dari peserta didik tentang kegiatan pembelajaran (misalnya apakah yang dipelajari menarik, bermanfaat bagi pesertadidik,sesuaidengankebutuhannya,dsb.). 7. Penilai meminta guru menjelaskan apakah guru merupakan anggota profesi tertentu, apakah guruselaluhadirdalamkegiatankeprofesian:KKG/MGMP,seminar,lokakarya,dsb. 8. Penilai meminta guru menjelaskan tentang perannya dalam kegiatan keprofesian (misalnya KKG/MGMP, seminar, lokakarya, dsb.), dan apakah hasil kegiatan keprofesian diaplikasikan dalamkegiatanpembelajarandandiimbaskankepadatemansejawat. 9. Penilai melaksanakan wawancara dengan koordinator PKB dan bertanya bagaimana guru berpartisipasidalamkegiatanPKB. 10. Penilai melaksanakan wawancara dengan pengelola dan/atau peserta KKG/MGMP bagaimana guru yang dinilai berpartisiapasi dalam kegiatan yang dilaksanakan dalam program KKG/MGMP.

56

Lampiran1B
LAPORANDANEVALUASI PENILAIANKINERJAGURUKELAS/GURUMATAPELAJARAN :____________________________________________(1) :_______________________/_____________________(2) :_______________________/_____________________(3)

NamaGuru NIP/NomorSeriKarpeg Pangkat/GolonganRuang TerhitungMulaiTanggal NUPTK/NRG Namasekolah danalamat

:____________________________________________(4) :____________________________________________ ____________________________________________(5)

Tanggalmulaibekerja disekolahini :____________________________________________(6) Bulan Tahun :_________________sampai___________________(7) Periodepenilaian (tanggal,bulan,tahun) (tanggal,bulan,tahun) PERSETUJUAN(8) (Persetujuaniniharusditandatanganiolehpenilaidanguruyangdinilai) Penilai dan guru yang dinilai menyatakan telah membaca dan mamahami semua aspek yang ditulis/dilaporkandalamformatinidanmenyatakansetuju. Namaguru Namapenilai Tanda Tandatangan tangan Tanggal ___bulan____tahun_______

57

Kompetensi1 :Mengenalkarakteristikpesertadidik NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (21) Tindaklanjutyangdiperlukan: (22) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25)

58

PenilaianuntukKompetensi1:Mengenalkarakteristikpesertadidik Skor Indikator 1. Gurudapatmengidentifikasikarakteristikbelajar setiappesertadidikdikelasnya. 2. Gurumemastikanbahwasemuapesertadidik mendapatkankesempatanyangsamauntuk berpartisipasiaktifdalamkegiatanpembelajaran. 3. Gurudapatmengaturkelasuntukmemberikan kesempatanbelajaryangsamapadasemua pesertadidikdengankelainanfisikdan kemampuanbelajaryangberbeda. 4. Gurumencobamengetahuipenyebab penyimpanganperilakupesertadidikuntuk mencegahagarperilakutersebuttidakmerugikan pesertadidiklainnya. 5. Gurumembantumengembangkanpotensidan mengatasikekuranganpesertadidik. 6. Gurumemperhatikanpesertadidikdengan kelemahanfisiktertentuagardapatmengikuti aktivitaspembelajaran,sehinggapesertadidik tersebuttidaktermarginalkan(tersisihkan,diolok olok,minder,dsb.). Totalskoruntukkompetensi1 Skormaksimumkompetensi1=jumlahindikator2 Persentase=(totalskor/12)100% Nilaiuntukkompetensi1 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi Seluruhnya bukti(Tidak sebagian terpenuhi terpenuhi)

0 0

1 1

2 2

2 2
(26)

(27) 12(28) (29) (30)

59

Kompetensi2 :Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (21) Tindaklanjutyangdiperlukan: (22)

60

PenilaianuntukKompetensi2:Menguasaiteoribelajardanprinsipprinsippembelajaran yangmendidik Skor Indikator


Tidakada bukti (Tidak terpenuhi) Terpenuhi sebagian Seluruhnya terpenuhi

1. Gurumemberikesempatankepadapesertadidik untukmenguasaimateripembelajaransesuaiusia 0 1 2 dankemampuanbelajarnyamelaluipengaturan prosespembelajarandanaktivitasyangbervariasi. 2. Guruselalumemastikantingkatpemahamanpeserta 2 didikterhadapmateripembelajarantertentudan 0 1 menyesuaikanaktivitaspembelajaranberikutnya berdasarkantingkatpemahamantersebut. 3. Gurudapatmenjelaskanalasanpelaksanaan kegiatan/aktivitasyangdilakukannya,baikyang 0 1 2 sesuaimaupunyangberbedadenganrencana, terkaitkeberhasilanpembelajaran. 4. Gurumenggunakanberbagaiteknikuntuk 0 1 2 memotiviasikemauanbelajarpesertadidik. 5. Gurumerencanakankegiatanpembelajaranyang salingterkaitsatusamalain,denganmemperhatikan 0 1 2 tujuanpembelajaranmaupunprosesbelajarpeserta didik. 6. Gurumemperhatikanresponpesertadidikyang belum/kurangmemahamimateripembelajaranyang 0 1 2 diajarkandanmenggunakannyauntukmemperbaiki rancanganpembelajaranberikutnya. Totalskoruntukkompetensi2 (27) Skormaksimumkompetensi2=jumlahindikator2 12(28) Persentase=(totalskor/12)100% (29) Nilaiuntukkompetensi2 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

61

Kompetensi3 :Pengembangankurikulum NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru: (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (21) Tindaklanjutyangdiperlukan: (22)

62

PenilaianuntukKompetensi3:Pengembangankurikulum Skor Indikator Tidakada bukti (Tidak terpenuhi) 0 Terpenuhi sebagian 1 0 1 2


(26)

Terpenuhi seluruhnya 2

1. Gurudapatmenyusunsilabusyangsesuaidengan kurikulum. 2. Gurumerancangrencanapembelajaranyangsesuai dengansilabusuntukmembahasmateriajar tertentuagarpesertadidikdapatmencapai kompetensidasaryangditetapkan. 3. Gurumengikutiurutanmateripembelajaran denganmemperhatikantujuanpembelajaran. 4. Gurumemilihmateripembelajaranyang:a)sesuai dengantujuanpembelajaran,b)tepatdan mutakhir,c)sesuaidenganusiadantingkat kemampuanbelajarpesertadidik,dand)dapat dilaksanakandikelase)sesuaidengankonteks kehidupansehariharipesertadidik. Totalskoruntukkompetensi3 Skormaksimumkompetensi3=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi3 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)

(27) 8(28) (29) (30)

63

Kompetensi4 :KegiatanPembelajaranyangMendidik NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal Dokumendanbahanlain yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru Tindaklanjutyangdiperlukan:

(11) (12)

(13)

(14) SelamaPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal Dokumendanbahanlain yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru Tindaklanjutyangdiperlukan: (22)

(15) (16)

(17)

(19) (20)

(21)

64

PenilaianuntukKompetensi4:KegiatanPembelajaranyangMendidik Indikator Skor Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. Gurumelaksanakanaktivitaspembelajaransesuaidengan rancanganyangtelahdisusunsecaralengkapdan 0 1 2 pelaksanaanaktivitastersebutmengindikasikanbahwaguru mengertitentangtujuannya. 2. Gurumelaksanakanaktivitaspembelajaranyangbertujuan untukmembantuprosesbelajarpesertadidik,bukanuntuk 0 1 2 mengujisehinggamembuatpesertadidikmerasatertekan. 3. Gurumengkomunikasikaninformasibaru(misalnyamateri tambahan)sesuaidenganusiadantingkatkemampuan 0 1 2 belajarpesertadidik. 4. Gurumenyikapikesalahanyangdilakukanpesertadidik sebagaitahapanprosespembelajaran,bukansematamata kesalahanyangharusdikoreksi.Misalnya:dengan 0 1 2 mengetahuiterlebihdahulupesertadidiklainyangsetuju atautidaksetujudenganjawabantersebut,sebelum memberikanpenjelasantentangjawabanyangbenar. 5. Gurumelaksanakankegiatanpembelajaransesuaiisi kurikulumdanmengkaitkannyadengankontekskehidupan 0 1 2 sehariharipesertadidik. 6. Gurumelakukanaktivitaspembelajaransecarabervariasi denganwaktuyangcukupuntukkegiatanpembelajaran 0 1 2 yangsesuaidenganusiadantingkatkemampuanbelajardan mempertahankanperhatianpesertadidik. 7. Gurumengelolakelasdenganefektiftanpamendominasi atausibukdengankegiatannyasendiriagarsemuawaktu 0 1 2 pesertadapattermanfaatkansecaraproduktif. 8. Gurumampumenyesuaikanaktivitaspembelajaranyang 0 1 2 dirancangdengankondisikelas. 9. Gurumemberikanbanyakkesempatankepadapesertadidik untukbertanya,mempraktekkandanberinteraksidengan 0 1 2 pesertadidiklain. 10. Gurumengaturpelaksanaanaktivitaspembelajaransecara sistematisuntukmembantuprosesbelajarpesertadidik. Sebagaicontoh:gurumenambahinformasibarusetelah 0 1 2 mengevaluasipemahamanpesertadidikterhadapmateri sebelumnya. 11. Gurumenggunakanalatbantumengajar,dan/atauaudio visual(termasukTIK)untukmeningkatkanmotivasibelajar 0 1 2 pesertadidikdalammencapaitujuanpembelajaran. Totalskoruntukkompetensi4 (27) Skormaksimumkompetensi4=jumlahindikator2 22(28) Persentase=(totalskor/22)100% (29) Nilaiuntukkompetensi4 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

65

Kompetensi5 :Memahamidanmengembangkanpotensi NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (21) Tindaklanjutyangdiperlukan: (22)

66

Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) PenilaianuntukKompetensi5:Memahamidanmengembangkanpotensi Skor Indikator


Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi)

(23) (24)

(25)

Terpenuhi seluruhnya

1. Gurumenganalisishasilbelajarberdasarkan segalabentukpenilaianterhadapsetiappeserta 0 1 2 didikuntukmengetahuitingkatkemajuanmasing masing. 2. Gurumerancangdanmelaksanakanaktivitas pembelajaranyangmendorongpesertadidik 0 1 2 untukbelajarsesuaidengankecakapandanpola belajarmasingmasing. 3. Gurumerancangdanmelaksanakanaktivitas pembelajaranuntukmemunculkandaya 2 0 1 kreativitasdankemampuanberfikirkritispeserta didik. 4. Gurusecaraaktifmembantupesertadidikdalam prosespembelajarandenganmemberikan 0 1 2 perhatiankepadasetiapindividu. 5. Gurudapatmengidentifikasidenganbenar tentangbakat,minat,potensi,dankesulitan 0 1 2 belajarmasingmasingpesertadidik. 6. Gurumemberikankesempatanbelajarkepada pesertadidiksesuaidengancarabelajarnya 0 1 2 masingmasing. 7. Gurumemusatkanperhatianpadainteraksi denganpesertadidikdanmendorongnyauntuk 0 1 2 memahamidanmenggunakaninformasiyang disampaikan. Totalskoruntukkompetensi5 (27) Skormaksimumkompetensi5=jumlahindikator2 14(28) Persentase=(totalskor/14)100% (29) Nilaiuntukkompetensi5 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

67

Kompetensi6 :Komunikasidenganpesertadidik NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan:

(18) SetelahPengamatan Tanggal Dokumendanbahanlain yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru Tindaklanjutyangdiperlukan: (22)

(19) (20)

(21)

68

PenilaianuntukKompetensi6:Komunikasidenganpesertadidik Skor Indikator 1. Gurumenggunakanpertanyaanuntukmengetahui pemahamandanmenjagapartisipasipesertadidik, termasukmemberikanpertanyaanterbukayang menuntutpesertadidikuntukmenjawabdenganide danpengetahuanmereka. 2. Gurumemberikanperhatiandanmendengarkan semuapertanyaandantanggapanpesertadidik, tanpamenginterupsi,kecualijikadiperlukanuntuk membantuataumengklarifikasi pertanyaan/tanggapantersebut. 3. Gurumenanggapinyapertanyaanpesertadidik secaratepat,benar,danmutakhir,sesuaitujuan pembelajarandanisikurikulum,tanpa mempermalukannya. 4. Gurumenyajikankegiatanpembelajaranyangdapat menumbuhkankerjasamayangbaikantar pesertadidik. 5. Gurumendengarkandanmemberikanperhatian terhadapsemuajawabanpesertadidikbaikyang benarmaupunyangdianggapsalahuntukmengukur tingkatpemahamanpesertadidik. 6. Gurumemberikanperhatianterhadappertanyaan pesertadidikdanmeresponnyasecaralengkapdan relevanuntukmenghilangkankebingunganpada pesertadidik. Totalskoruntukkompetensi6 Skormaksimumkompetensi6=jumlahindikator2 Persentase=(totalskor/12)100% Nilaiuntukkompetensi6 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi Seluruhnya

2 0 1
(26)

(27) 12(28) (29) (30)

69

Kompetensi7 :Penilaiandanevaluasi NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketerangangur (13) Tindaklanjutyangdiperlukan: (14) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (21) Tindaklanjutyangdiperlukan: (22)

70

PenilaianuntukKompetensi7:Penilaiandanevaluasi Skor Indikator 1. Gurumenyusunalatpenilaianyangsesuaidengan tujuanpembelajaranuntukmencapaikompetensi tertentusepertiyangtertulisdalamRPP. 2. Gurumelaksanakanpenilaiandenganberbagai teknikdanjenispenilaian,selainpenilaianformal yangdilaksanakansekolah,danmengumumkan hasilsertaimplikasinyakepadapesertadidik, tentangtingkatpemahamanterhadapmateri pembelajaranyangtelahdanakandipelajari. 3. Gurumenganalisishasilpenilaianuntuk mengidentifikasitopik/kompetensidasaryangsulit sehinggadiketahuikekuatandankelemahan masingmasingpesertadidikuntukkeperluan remedialdanpengayaan. 4. Gurumemanfaatkanmasukandaripesertadidik danmerefleksikannyauntukmeningkatkan pembelajaranselanjutnya,dandapat membuktikannyamelaluicatatan,jurnal pembelajaran,rancanganpembelajaran,materi tambahan,dansebagainya. 5. Gurumemanfatkanhasilpenilaiansebagaibahan penyusunanrancanganpembelajaranyangakan dilakukanselanjutnya. Totalskoruntukkompetensi7 Skormaksimumkompetensi7=jumlahindikator2 Persentase=(totalskor/10)100% Nilaiuntukkompetensi7 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

0 1 2
(26)

(27) 10(28) (29) (30)

71

Kompetensi8 :Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaannasional Indonesia NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25)

72

PenilaianuntukKompetensi8:Bertindaksesuaidengannormaagama,hukum,sosialdan kebudayaannasionalIndonesia Skor Indikator


Terpen Tidakada Terpenuhi uhi bukti(Tidak sebagian Seluruh terpenuhi) nya

1. Gurumenghargaidanmempromosikanprinsipprinsip Pancasilasebagaidasarideologidanetikabagisemua 0 1 2 wargaIndonesia. 2. Gurumengembangkankerjasamadanmembina kebersamaandengantemansejawattanpa 2 0 1 memperhatikanperbedaanyangada(misalnya:suku, agama,dangender). 3. Gurusalingmenghormatidanmenghargaiteman sejawatsesuaidengankondisidankeberadaanmasing 0 1 2 masing. 4. Gurumemilikirasapersatuandankesatuansebagai 0 1 2 bangsaIndonesia. 5. Gurumempunyaipandanganyangluastentang keberagamanbangsaIndonesia(misalnya:budaya,suku, 0 1 2 agama). Totalskoruntukkompetensi8 (27) Skormaksimumkompetensi8=jumlahindikator2 10(28) Persentase=(totalskor/10)100% (29) Nilaiuntukkompetensi8 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

73

Kompetensi9 :Menunjukkanpribadiyangdewasadanteladan NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru (13) Tindaklanjutyangdiperlukan: (14) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25)

74

PenilaianuntukKompetensi9:Menunjukkanpribadiyangdewasadanteladan Indikator Skor


Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. Gurubertingkahlakusopandalamberbicara, berpenampilan,danberbuatterhadapsemua 0 1 2 pesertadidik,orangtua,dantemansejawat. 2. Gurumaumembagipengalamannyadenganteman sejawat,termasukmengundangmerekauntuk 0 1 mengobservasicaramengajarnyadanmemberikan 2 masukan. 3. Gurumampumengelolapembelajaranyang membuktikanbahwagurudihormatiolehpeserta didik,sehinggasemuapesertadidikselalu 0 1 2 memperhatikangurudanberpartisipasiaktifdalam prosespembelajaran. 4. Gurubersikapdewasadalammenerimamasukan daripesertadidikdanmemberikankesempatan 0 1 2 kepadapesertadidikuntukberpartisipasidalam prosespembelajaran. 5. Guruberperilakubaikuntukmencitrakannama 0 1 2 baiksekolah. Totalskoruntukkompetensi9 (27) Skormaksimumkompetensi9=jumlahindikator2 10(28) Persentase=(totalskor/10)100% (29) Nilaiuntukkompetensi9 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

75

Kompetensi10:Etoskerja,tanggungjawabyangtinggi,danrasabanggamenjadiguru NamaGuru :(9) NamaPenilai :(10) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25)

76

Penilaian untuk Kompetensi 10: Etos kerja, tanggung jawab yang tinggi, dan rasa bangga menjadiguru Skor Tidakada Indikator Terpenuhi Terpenuhi bukti(Tidak sebagian seluruhnya terpenuhi) 1. Gurumengawalidanmengakhiripembelajaran 0 1 2 dengantepatwaktu. 2. Jikaguruharusmeninggalkankelas,guru mengaktifkansiswadenganmelakukanhalhal produktifterkaitdenganmatapelajaran,dan 0 1 2 memintagurupiketataugurulainuntuk mengawasikelas. 3. Gurumemenuhijammengajardandapat melakukansemuakegiatanlaindiluarjam 2 0 1 mengajarberdasarkanijindanpersetujuan pengelolasekolah. 4. Gurumemintaijindanmemberitahulebih awal,denganmemberikanalasandanbukti yangsahjikatidakmenghadirikegiatanyang 0 1 2 telahdirencanakan,termasukproses pembelajarandikelas. 5. Gurumenyelesaikansemuatugasadministratif dannonpembelajarandengantepatwaktu 0 1 2 sesuaistandaryangditetapkan. 6. Gurumemanfaatkanwaktuluangselain mengajaruntukkegiatanyangproduktif 0 1 2 terkaitdengantugasnya. 7. Gurumemberikankontribusiterhadap pengembangansekolahdanmempunyai 0 1 2 prestasiyangberdampakpositifterhadap namabaiksekolah. 8. Gurumerasabanggadenganprofesinya 0 1 2 sebagaiguru. Totalskoruntukkompetensi10 (27) Skormaksimumkompetensi10=jumlahindikator 16(28) 2 Persentase=(totalskor/16)100% (29) Nilaiuntukkompetensi10 (30) (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)

(26)

77

Kompetensi11:Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif NamaGuru :(9) NamaPenilai :(10) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: (16) Tindaklanjutyangdiperlukan: (17) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) PenilaianuntukKompetensi11:Bersikapinklusif,bertindakobjektif,sertatidak Diskriminatif Skor Indikator
Tidakada Terpenuhi Seluruhnya bukti(Tidak sebagian terpenuhi terpenuhi)

1. Gurumemperlakukansemuapesertadidiksecaraadil, memberikanperhatiandanbantuansesuaikebutuhan 0 1 2 masingmasing,tanpamemperdulikanfaktorpersonal. 2. Gurumenjagahubunganbaikdanpedulidengan temansejawat(bersifatinklusif),sertaberkontribusi 0 1 2 positifterhadapsemuadiskusiformaldaninformal terkaitdenganpekerjaannya. 3. Guruseringberinteraksidenganpesertadidikdan tidakmembatasiperhatiannyahanyapadakelompok 0 1 2 tertentu(misalnya:pesertadidikyangpandai,kaya, berasaldaridaerahyangsamadenganguru). Totalskoruntukkompetensi11 (27) Skormaksimumkompetensi11=jumlahindikator2 6(28) Persentase=(totalskor/6)100% (29) Nilaiuntukkompetensi11 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

78

Kompetensi12:Komunikasidengansesamaguru,tenagapendidikan,orangtuapeserta didik,danmasyarakat NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) Penilaian untuk Kompetensi 12: Komunikasi dengan sesama guru, tenaga pendidikan, orang tuapesertadidik,danmasyarakat Skor Indikator
Tidakada Terpenuhi Seluruhnya bukti(Tidak sebagian terpenuhi terpenuhi)

1. Gurumenyampaikaninformasitentangkemajuan, kesulitan,danpotensipesertadidikkepadaorang tuanya,baikdalampertemuanformalmaupuntidak 0 1 2 formalantaragurudanorangtua,temansejawat, dandapatmenunjukkanbuktinya. 2. Guruikutberperanaktifdalamkegiatandiluar pembelajaranyangdiselenggarakanolehsekolahdan 0 1 2 masyarakatdandapatmemberikanbukti keikutsertaannya. 3. Gurumemperhatikansekolahsebagaibagiandari masyarakat,berkomunikasidenganmasyarakat 0 1 2 sekitar,sertaberperandalamkegiatansosialdi masyarakat. Totalskoruntukkompetensi12 (27) Skormaksimumkompetensi12=jumlahindikator2 6(28) Persentase=(totalskor/6)100% (29) Nilaiuntukkompetensi12 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

79

Kompetensi13:Penguasaanmateristrukturkonsepdanpolapikirkeilmuanyang mendukungmatapelajaranyangdiampu NamaGuru :(9) NamaPenilai :(10)

SebelumPengamatan Tanggal Dokumendanbahanlain yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru Tindaklanjutyangdiperlukan:

(11) (12)

(13)

(14)

SelamaPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: Tindaklanjutyangdiperlukan:

(15) (16)

(17)

(18)

Penilaian untuk Kompetensi 13: Penguasaan materi struktur konsep dan pola pikir keilmuan yangmendukungmatapelajaranyangdiampu Skor Indikator 1. Gurumelakukanpemetaanstandarkompetensi dankompetensidasaruntukmatapelajaranyang diampunya,untukmengidentifikasimateri pembelajaranyangdianggapsulit,melakukan perencanaandanpelaksanaanpembelajaran,dan memperkirakanalokasiwaktuyangdiperlukan. 2. Gurumenyertakaninformasiyangtepatdan mutakhirdidalamperencanaandanpelaksanaan pembelajaran. 3. Gurumenyusunmateri,perencanaandan pelaksanaanpembelajaranyangberisiinformasi yangtepat,mutakhir,danyangmembantupeserta didikuntukmemahamikonsepmateri pembelajaran. Totalskoruntukkompetensi13 Skormaksimumkompetensi13=jumlahindikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi13 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

2
(26)

(27) 6(28) (29) (30)

80

Kompetensi14:Mengembangkankeprofesianmelaluitindakanreflektif NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) PenilaianuntukKompetensi14:Mengembangkankeprofesianmelaluitindakanreflektif Skor Indikator
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. Gurumelakukanevaluasidirisecaraspesifik, lengkap,dandidukungdengancontohpengalaman 0 1 2 dirisendiri. 2. Gurumemilikijurnalpembelajaran,catatanmasukan darikolegaatauhasilpenilaianprosespembelajaran 0 1 2 sebagaibuktiyangmenggambarkankinerjanya. 3. Gurumemanfaatkanbuktigambarankinerjanya 2 untukmengembangkanperencanaandan pelaksanaanpembelajaranselanjutnyadalam 0 1 programPengembanganKeprofesianBerkelanjutan (PKB). 4. GurudapatmengaplikasikanpengalamanPKBdalam perencanaan,pelaksanaan,penilaianpembelajaran 0 1 2 dantindaklanjutnya. 5. Gurumelakukanpenelitian,mengembangkankarya inovasi,mengikutikegiatanilmiah(misalnyaseminar, 0 1 2 konferensi),danaktifdalammelaksanakanPKB. 6. GurudapatmemanfaatkanTIKdalamberkomunikasi 0 1 2 danpelaksanaanPKB. Totalskoruntukkompetensi14 (27) Skormaksimumkompetensi14=jumlahindikator2 12(28) Persentase=(totalskor/12)100% (29) Nilaiuntukkompetensi14 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

81

PETUNJUKPENGISIANFORMAT1B NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama Pegawai Negeri Sipil yang dinilai sesuai dengan yang tercantum dalamSKpengangkatanpertamasebagaiCPNS. 2. (2) TulislahNomorIndukPegawaidanNomorKarpegPNSyangbersangkutan. 3. (3) Tulislah pangkat dan golongan ruang terakhir PNS tersebut terhitung mulai tanggalberlakunyaSK. 4. (4) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakanNomorRegistrasibagiPendidikdanTenagaKependidikanpadajalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Restgrasi Guru (NRG) setelah yang bersangkutan memiliki sertifikat pendidik. 5. (5) Tulislah dengan jelas Nama Sekolah tempat guru bekerja berikut alamatnya sebagaiSatuanAdministrasiPangkalguruyangbersangkutan. 6. (6) Tulislah sejak kapan guru bekerja pada sekolah sebagai Satuan Admimistrasi Pangkalyangbersangkutan. 7. (7) Tulislah waktu mulai dilakukan penilaian dan akhir pelaksanaan penilaian bagi gurutersebutpadatahunajarantertentu. 8. (8) Tulislah nama guru yang dinilai dan nama penilai yang melakukan penilaian kinerja guru, selanjutnya tandatangani secara bersama pada ruang yang tersediasebagaitandapersetujuanbersamaterhadaphasilpenilaian,sertatulis tanggalbulandantahunsaatmenyatakanpersetujuanterhadaphasilpenilaian. 9. (9) CukupJelas. 10. (10) CukupJelas. 11. (11) Tulislah tanggal saat melakukan pengamatan awal terhadap guru yang dinilai danterhadapdokumendokumenyangdiperlukandalampenilaian. 12. (12) Tuliskandokumendanbahanapasajayangdiperiksa. 13. (13) Tulislah tanggapan penilai terhadap dokumen dan bahan yang telah diperiksa sertatanggapanguruataspertanyaanyangdiajukanolehpenilai. 14. (14) Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah memeriksa dokumen,bahan,danberdiskusidenganguruyangdinilai. 15. (15) Tulislah tanggal saat melakukan pengamatan terhadap kegiatan guru dalam pelaksanaanprosespembelajarandikelas. 16. (16) Tulislah dokumen dan bahan lain yang juga diamati selama melakukan pengamatankegiatangurudalammelaksanakanpembelajajarandikelas. 17. (17) Tulislah tanggapan terhadap aktivitas guru dan peserta didik selama masa pengamatandalamprosespembelajarandikelas. 18. (18) Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah melakukan pengamatanprosespembelajarandikelas. 19. (19) Tulislah tanggal saat melakukan diskusi dengan guru setelah melakukan pengamatan terhadap kegiatan guru dalam melaksanakan pembelajaran di kelas. 20. (20) Tulislah dokumen dan bahan pendukung yang diperiksa setelah melakukan pengamatan terhadap kegiatan guru dalam melaksanakan pembelajaran di kelas. 21. (21) Tulislah tanggapan penilai terhadap dokumen yang diperiksa dan tanggapan guru terhadap pertanyaanpertanyaan yang diberikan oleh penilai terkait denganpelaksanaankegiatanpembelajarandikelas.

82

NO 22. 23. 24. 25. 26.

27. 28. 29.

30.

NOMOR URAIAN KODE (22) Tulislah tindak lanjut yang diperlukan oleh penilai untuk meningkatkan kualitas gurudalampelaksanaanpembelajarandikelas. (23) Tulislahtanggalsaatmelakukanpemantauanterhadapguruyangyangdinilai. (24) Tullislah dokumen dan/atau bahan yang diperiksa selama melakukan pemantauanterhadapguruyangdinilai. (25) Tulislah tanggapan penilai terhadap hasil pemantauan kegiatan guru yang dinilai. (26) Berikan skor 0 atau 1 atau 2 terhadap indikatorindikator yang menunjukkan kompetensi guru yang dinilai sebagai hasil evaluasi terhadap dokumen dan tanggapan guru sebelum pengamatan dan/atau selama pengamatan dan/atau setelahpengamatandan/ataupemantauan. (27) Tulislahtotalhasilskorsetiapindikatorpadakompetensiyangbersangkutan. (28) Angkainimenunjukkanskormaksimumpadakompetensitertentu (29) Hitung dan tulislah hasil penilaian kompetensi tertentu dengan cara membagi total skor yang diperoleh (nomor kode 27) dengan skor maksimum pada kompetensitertentu(nomorkode28)dikalikanseratuspersen(100%). (30) Tulislah nilai kinerja guru dengan mengkonversi hasil persentase (nomor kode 29) ke dalam angka 1 atau 2 atau 3 atau 4 dengan menggunakan ketentuan perhitungansebagaiberikut: Nilai1untuk0%<X<25% Nilai2untuk25%<X<50% Nilai3untuk50%<X<75% Nilai4untuk75%<X<100%

83

Lampiran1C
REKAPHASILPENILAIANKINERJAGURUKELAS/MATAPELAJARAN a. Nama :............................(1) NIP :............................(2) Tempat/TanggalLahir :/.............................(3) Pangkat/Jabatan/Golongan :............................(4) TMTsebagaiguru :............................(5) MasaKerja :........Tahun......Bulan(6) JenisKelamin :L/P(7) PendidikanTerakhir/Spesialisasi :............................(8) ProgramKeahlianyangdiampu :............................(9) b. NamaInstansi/Sekolah :...........................(10) Telp/Fax :...........................(11) Kelurahan :...........................(12) Kecamatan :...........................(13) Kabupaten/kota :...........................(14) Provinsi :..........................(15)
Periodepenilaian (16) Formatif ..........sampai.......... Sumatif (tanggal,bulan,tahun)(tanggal,bulan,tahun) Kemajuan (17) Tahun(20) (18) .. (19)

NO KOMPETENSI NILAI*) A.Pedagogik 1. Menguasaikarakteristikpesertadidik 2. Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik 3. Pengembangankurikulum 4. Kegiatanpembelajaranyangmendidik 5. Pengembanganpotensipesertadidik 6. Komunikasidenganpesertadidik 7. Penilaiandanevaluasi B.Kepribadian 8. Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaan nasional 9. Menunjukkanpribadiyangdewasadanteladan 10. Etoskerja,tanggungjawabyangtinggi,rasabanggamenjadiguru C.Sosial 11. Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif Komunikasidengansesamaguru,tenagakependidikan,orangtua,peserta 12. didik,danmasyarakat D.Profesional Penguasaanmateri,struktur,konsepdanpolapikirkeilmuanyang 13. mendukungmatapelajaranyangdiampu 14. Mengembangkankeprofesionalanmelaluitindakanyangreflektif Jumlah(Hasilpenilaiankinerjaguru) (22) *) Nilai diisi berdasarkan laporan dan evaluasi PK Guru. Nilai minimum per kompetensi = 1 dan nilaimaksimum=4 ..,..(23) GuruyangDinilaiPenilaiKepalaSekolah (.......................(24))(.......................(25))(.........................(26)

(26)

84

PETUNJUKPENGISIANFORMAT1C NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK pengangkatansebagaiguru. 2. (2) TulislahNomorIndukPegawaiguruyangbersangkutan. 3. (3) Tulislah tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan sebagaiKetuaProgram/KompetensiKeahlian. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitungmulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkanSKpengangkatansebagaiguru. 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut bertugas. 7. (7) Tulislah jenis kelamin dari guru yang dinilai dengan cara mencoret huruf L atauP. 8. (8) Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya. 9. (9) Tulislahprogramkeahlianyangdiampugutuyangdinilai. 10. (10) Tulislahnamainstansiatausekolahguruyangdinilai. 11. (11) Tuliskannomordanfaxsekolah(jikaada). 12. (12) Tuliskankelurahandimanasekolah/madrasahberlokasi. 13. (13) Tuliskankecamatandimanasekolah/madrasahberlokasi. 14. (14) Tuliskankelurahandimanasekolah/madrasahberlokasi. 15. (15) Tuliskanprovinsidimanasekolah/madrasahberlokasi. (16) Tulislah kapan mulai dilakukan penilaian dan kapan berakhirnya proses penilaianbagigurutersebutpadatahunajaranyangbersangkutan. 3. (17) Pilihlah dengan memberi tanda centang (v) pada kolom yang sesuai, penilaian formatif (awal tahun ajaran), sumatif (akhir tahun ajaran), atau 4. (18) penilaian kemajuan setelah guru melaksanakan PKB untuk memperbaiki 5. (19) kinerjanya. 6. (20) Tulislahtahunajaranpelaksanaanpenilaian. 7. (21) Tulislah hasil penilaian guru yang merupakan hasil penilaian kinerja guru denganmenggunakanformat1B. 8. (22) Jumlahkan hasil nilai untuk semua kompetensi guru, sehingga memberikan hasil nilai kinerja guru. Bila penilaian ini adalah penilaian sumatif, maka nilai inilah yang kemudian dikonversikan ke dalam perolehan angka kredit guru sesuaiPermennegpandanRB16/2009. 9. (23) Tulislahtempatdantanggaldilakukannyapengisianformatini. 10. (24) Isilah dengan tandatangan dan nama guru yang dinilai sebagai bukti bahwa gurutelahmengetahuidansetujudenganhasilnilaiyangdiperoleh. 11. (25) Isilahdengantandatangandannamapenilai. 12. (26) Isilah dengan tandatangan dan nama kepala sekolah tempat guru bekerja, sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasilnilaikinerjaguru.

85

Lampiran1D
FORMATPENGHITUNGANANGKAKREDITPKGURUKELAS/MATAPELAJARAN a. Nama :........................(1) NIP :........................(2) Tempat/TanggalLahir :/.........................(3) Pangkat/Jabatan/Golongan :........................(4) TMTsebagaiguru :.........................(5) MasaKerja :........Tahun......Bulan(6) JenisKelamin :L/P(7) PendidikanTerakhir/Spesialisasi :.........................(8) :.........................(9) ProgramKeahlianyangdiampu b. NamaInstansi/Sekolah :.......................(10) Telp/Fax :.......................(11) Kelurahan :.......................(12) Kecamatan :.......................(13) Kabupaten/kota :........................(14) Provinsi :.......................(15) NilaiPKGURUKelas/MataPelajaran (16) KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPAN&RM No.16Tahun2009denganrumus Nilai PKG (17) Nilai PKG (100) = 100 Nilai PKG tertinggi Berdasarkanhasilkonversikedalamskalanilaisesuaidenganperaturan (18) tersebut,selanjutnyaditetapkansebutandanpersentaseangkakreditnya Perolehanangkakredit(untukpembelajaran)yangdihitungberdasarkan (19) rumusberikutini. AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 ..,..(20)

Guruyangdinilai

Penilai

((21))

((22))

KepalaSekolah ((23))

86

PETUNJUKPENGISIANFORMAT1D NO NOMOR URAIAN KODE 1 2 3 1. (1) Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK pengangkatansebagaiguru. 2. (2) TulislahNomorIndukPegawaiguruyangbersangkutan. 3. (3) Tulislah tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan sebagaiKetuaProgram/KompetensiKeahlian. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitungmulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkanSKpengangkatansebagaiguru. 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut bertugas. 7. (7) Tulislah jenis kelamin dari guru yang dinilai dengan cara mencoret huruf L atauP. 8. (8) Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya. 9. (9) Tulislahprogramkeahlianyangdiampugutuyangdinilai. 10. (10) Tulislahnamainstansiatausekolahguruyangdinilai. 11. (11) Tuliskannomordanfaxsekolah(jikaada). 12. (12) Tuliskankelurahandimanasekolah/madrasahberlokasi. 13. (13) Tuliskankecamatandimanasekolah/madrasahberlokasi. 14. (14) Tuliskankelurahandimanasekolah/madrasahberlokasi. 15. (15) Tuliskanprovinsidimanasekolah/madrasahberlokasi. 16 (16) DiisidenganhasilPKGURUsesuaidenganhasilPKGURUpadaformatrekap PKGURU. 17 (17) DiisidenganPK(GURU)yangtelahdikonversikankedalamskala0100 sesuaidenganPermennegPANdanRBNo.16Tahun2009melalui perhitungandenganmenggunakanrumustersebut. 18 (18) Diisi dengan sebutan dan prosentase angka kredit dari hasil PK GURU yang telah dikonversikan dalam skala 0 100 sebagaimana ditetapkan dalam PermennegPANdanRBNo.16Tahun2009. 19 (19) diisikandenganperolehanangkakredit pertahunyangdihitungberdasarkan rumus sistem paket tersebut sesuai permen tsb. Ingat JM adalah jam mengajartatapmukaguru,dan JWM adalahjamwajibmengajartatapmuka sesuaidenganaturanyangberlaku. RumusAngkaKreditsatutahun =(AKKAKPKBAKP)x(JM/JWM)xNPK 4 20 (20) Tulislahtempatdantanggaldilakukannyapengisianformatini. 21 (21) Isilah dengan tanda tangan dan nama guru yang dinilai sebagai bukti bahwa gurutelahmengetahuidansetujudenganestimasihasilnilaiyangdiperoleh. 22 (22) Isilahdengantandatangandannamapenilai. 23 (23) Isilah dengan tanda tangan dan nama kepala sekolah tempat guru bekerja, sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasilnilaikinerjaguru.

87

88

LAMPIRAN2 INSTRUMENPKGURUBIMBINGANDAN KONSELING/KONSELOR


89

Lampiran2A
Pernyataankompetensi,indikator,danprosespenilaiankinerja GuruBimbingandanKonseling(BK)/Konselor Sumber: Peraturan Menteri Pendidikan Nasional 27/2008 tentang Standar Kualifikasi dan Kompetensi Konselor. BSNP versi 6.0. 11/2008 tentang Kerangka Indikator untuk Pelaporan Pencapaian Standar NasionalPendidikan:StandarKualifikasiAkademikdanKompetensiGuru. Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi 16/2009 tentangJabatanFungsionalGurudanAngkaKreditnya. Kompetensi Caramenilai Pedagogik 1. Menguasaiteoridanpraksispendidikan. Pemantauan 2. Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilaku Pengamatan konseli. 3. MenguasaiesensilayananBKdalamjalur,jenis,danjenjangsatuan Pemantauan pendidikan. Kepribadian 4. BerimandanbertakwakepadaTuhanYangMahaEsa. Pemantauan 5. Menghargaidanmenjunjungtingginilainilaikemanusian,individualitas Pemantauan dankebebasanmemilih. 6. Menunjukkanintegritasdanstabilitaskepribadianyangkuat. Pemantauan 7. 8. 9. Menampilkankinerjaberkualitastinggi. Mengimplementasikankolaborasiinternalditempatbekerja. BerperandalamorganisasidankegiatanprofesiBK. Pengamatan Pemantauan Pemantauan Pemantauan Sosial

10. Mengimplementasikolaborasiantarprofesi. Profesional 11. Menguasaikonsepdanpraksisasesmenuntukmemahamikondisi, kebutuhandanmasalahkonseli. 12. MenguasaikerangkateoritikdanpraksisBK. 13. MerancangprogramBK. 14. MengimplementasikanprogramBKyangkomprehensif. 15. MenilaiprosesdanhasilkegiatanBK. 16. Memilikikesadarandankomitmenterhadapetikaprofessional.

Pemantauan Pengamatan Pemantauan Pengamatan Pengamatan Pemantauan Pemantauan

17. MenguasaikonsepdanpraksispenelitiandalamBK. Pemantauan Pengamatan adalah kegiatan yang dinilai melalui pengamatan kinerja guru dalam pelaksanaan layanan BK (secara klasikal, layanan bimbingan kelompok, dan/atau layanan konselingkelompoktidaktermasuklayanankonselingindividu). Pemantauan adalahkegiatanyangdinilaimelaluipemeriksaandokumen,wawancaradenganguru BK/konselor selama satu semester, yang tidak dilakukan melalui pengamatan. Khususuntuklayananindividu,Pemantauanmelaluitranskrippelaporanlayanan.

90

Kompetensi1 : Menguasaiteoridanpraksispendidikan Jenisdancaramenilai:Pedagogik(Pemantauan) Pernyataan : Menguasai ilmu pendidikan dan landasan keilmuannya, mengimplementasikan prinsipprinsip pendidikan dan proses pembelajaran dan menguasai landasan budaya dan praksis pendidikan (praksis adalah prinsipprinsip untuk merubah teori menjadipraktik). Indikator 1. Guru BK/Konselor dapat menunjukkan dalam perencanaan layanan BK, sesuai dengan landasan dan prinsipprinsip pendidikan serta pembelajaran yang aktif, kreatif, mandiri, dan berpusatpadapesertadidik/konseli. 2. Guru BK/Konselor dapat menunjukkan dalam perencanaan layanan BK, sesuai dengan usia, tahapperkembangan,dankebutuhanpesertadidik/konseli. 3. Guru BK/Konselor dapat menunjukkan dalam perencanaan layanan BK, sesuai dengan keragamanlatarbelakangbudaya,ekonomi,dansosialpesertadidik/konseli. ProsesPenilaian Pemantauan: 1. Perikasalah, apakah Guru BK/Konselor menyediakan program layanan BK, mempunyai Rencana Pelaksanaan Layanan (RPL)/Satuan Layanan (Satlan)/Satuan Pendukung (Satkung) dan data peserta didik/konseli, termasuk sosiometri (gambaran hubungan sosial antarpesertadidik/konseli). 2. MintalahguruBK/Konselormenjelaskantentang: a. bagaimana pelayanan BK terhadap peserta didik/konseli sebagai makhluk individu, sosial,susila,bekerjadanberkeTuhananYangMahaEsa; b. bagaimana mengembangkan layanan BK yang aktif, kreatif, mandiri, dan berpusat pada individu; c. bagaimana mengembangkan layanan BK sesuai dengan usia, tahap perkembangan, dan kebutuhanpesertadidik/konseli;dan d. bagaimana menerapkan layanan BK lintas budaya, ekonomi, dan sosial peserta didik/konseli.

91

: Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilaku konseli Jenisdancaramenilai:Pedagogik(Pemantauan) Pernyataan : Mengaplikasikan kaidahkaidah perilaku manusia, perkembangan fisik dan psikologis individu terhadap sasaran pelayanan bimbingan dan konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidah kepribadian, individualitas dan perbedaan konseli terhadap sasaran pelayanan bimbingan dan konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidah belajar terhadap sasaran pelayanan bimbingan dan konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidahkeberbakatanterhadapsasaranpelayananbimbingandan konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidah kesehatan mental terhadap sasaran pelayanan bimbingan dan konseling dalamupayapendidikan. Indikator 1. 2. 3. ProsesPenilaian SebelumPengamatan: 1. Guru BK/Konselor menyediakan program pelayanan BK, RPL/Satlan/Satkung, instrumen nontes/angket,dandatayangdidasarkankebutuhanpesertadidik/konseli. 2. Guru BK/Konselor menjelaskan bagaimana data tersebut digunakan dalam perencanaan programpelayananBK. SelamaPengamatan: Penilai mengamati program pelayanan BK secara klasikal, layanan bimbingan kelompok, layanan konseling kelompok, dan mencermati apakah guru BK/Konselor telah melaksanakan pelayananBKyangsesuaidengan: 1. kebutuhanperkembanganmental,emosional,fisik,dangender; 2. kebutuhanbakat,minat,danpotensipribadi;dan 3. harapanuntukmelanjutkanpendidikandanpilihankarir. Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan kebutuhanperkembanganmental,emosional,fisik,dangender. Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan kebutuhanbakat,minat,danpotensipribadi. Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan harapanuntukmelanjutkanpendidikandanpilihankarir. Kompetensi2

92

: MenguasaiesensilayananBKdalamjalur,jenis,danjenjangsatuan pendidikan Jenisdancaramenilai:Pedagogik(Pemantauan) Pernyataan : Menguasaiesensibimbingandankonseling pada pendidikanformal, nonformal dan informal, menguasai esensi bimbingan dan konseling pada satuan jenis pendidikan umum, kejuruan, keagamaan, menguasai esensi bimbingan dan konseling pada satuan jenjang pendidikanusiadini,dasardanmenengah,sertatinggi. Indikator 1. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan padajalursatuanpendidikanformal,nonformaldaninformal. 2. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan padajenissatuanpendidikanumum,kejuruan,keagamaan,dankhusus. 3. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan padajenjangsatuanpendidikanusiadini,dasardanmenengah,sertatinggi. ProsesPenilaian Pemantauan: 1. Guru BK/Konselor menyediakan hasil pemetaan latar belakang individu (jenis kelamin, agama, kemampuan akademik) dan keluarga (pendidikan dan pekerjaan orang tua/wali) danmenampilangrafikhubunganantarakebutuhanlayanansesuaidatayangdimiliki. 2. Guru BK/Konselor diminta untuk menjelaskan hasil pemetaan (tampilan grafik) dan menindaklanjutihasiltersebutterkaitdengankebutuhanlayanan.

Kompetensi3

93

Kompetensi4 : BerimandanbertakwakepadaTuhanYangMahaEsa Jenisdancaramenilai:Kepribadian(Pemantauan) Pernyataan : MenampilkankepribadianyangberimandanbertakwakepadaTuhan Yang Maha Esa, konsisten dalam menjalankan kehidupan beragama dan toleran terhadap pemeluk agama lain, berakhlak mulia dan berbudipekertiluhur. Indikator 1. GuruBK/Konselorberpenampilanrapihdanbersih. 2. GuruBK/Konselorberbicaradengansantundanjujurkepadapesertadidik/konseli. 3. Guru BK/Konselor bersikap dan mendorong kepada peserta didik/konseli untuk bersikap toleran. 4. Guru BK/Konselor memperlihatkan konsistensi dan memotivasi peserta didik/konseli dalammelaksanakanibadah. ProsesPenilaian Pemantauan: 1. Penilai mengamati penampilan guru BK/Konselor, cara berpakaian, dan cara berbicara kepadapesertadidik/konseli. 2. Penilai mengamati sikap dan cara guru BK/Konselor dalam mendorong peserta didik/konseliuntukbersikaptoleran. 3. Penilai mengamati konsistensi guru BK/Konselor dalam beribadah dan memotivasi pesertadidik/konseloruntukberibadah.

94

: Menghargaidanmenjunjungtingginilainilaikemanusiaan, individualitasdankebebasanmemilih Jenisdancaramenilai:Kepribadian(Pemantauan) Pernyataan : Mengaplikasikan pandangan positif dan dinamis tentang manusia sebagai makhluk spiritual, bermoral, sosial, individual, dan berpotensi, menghargai dan mengembangkan potensi positif individu pada umumnya dan konseli pada khususnya, peduli terhadap kemaslahatan manusia pada umumnya dan peserta didik pada khususnya, menjunjung tinggi harkat dan martabat manusia sesuai dengan hak asasinya, toleran terhadap permasalahan konseli,bersikapdemokratis. Indikator 1. Guru BK/Konselor merencanakan layanan BK yang mengacu kepada pengaplikasian pandangan dinamis tentang manusia sebagai mahluk bermoral spiritual, sosial, dan individu. 2. Pelayanan BK yang dirancang oleh Guru BK/Konselor mendorong kepada pengembanganpotensipositifindividu. 3. Rancangan pelayanan BK mengacu kepada kebutuhan dan masukan balik peserta didik/konseli. 4. Pelayanan BK dirancang untuk mengembangkan sikap toleran dalam menjunjung hak azasimanusiapadapesertadidik/konseli. ProsesPenilaian Pemantauan: 1. GuruBK/KonselormenyediakanprogrampelayananBK,RPL/Satlan/Satkungdandata pesertadidik/konselisertasosiometri. 2. PenilaimemintaguruBK/Konselormenjelaskantentang: a. bagaimana pelayanan terhadap peserta didik/konseli sebagai makhluk bermoral, spiritual,sosialdanindividu; b. bagaimana mengembangkan pelayanan BK yang mendorong kepada pengembanganpotensipositifindividu; c. bagaimana menerapkan pelayanan BK yang mengacu kepada kebutuhan dan masukanbalikpesertadidik/konseli;dan d. bagaimana mengembangkan sikap toleran yang menjunjung hak azasi manusia dalamlayananBK. Kompetensi5

95

Kompetensi6 : Menunjukkanintegritasdanstabilitaskepribadianyangkuat Jenisdancaramenilai:Kepribadian(Pemantauan) Pernyataan : Menampilkan kepribadian dan perilaku yang terpuji (seperti berwibawa, jujur, sabar, ramah, dan konsisten), menampilkan emosi yang stabil, peka, bersikap empati, serta menghormati keragaman dan perubahan, menampilkan toleransi tinggi terhadap konseli yang menghadapistresdanfrustasi. Indikator 1. Guru BK/Konselor menunjukkan kepribadian, kestabilan emosi dan perilaku yang terpuji, jujur,sabar,ramah,dankonsisten. 2. Guru BK/Konselor menunjukkan kepekaan dan bersikap empati terhadap keragaman dan perubahan. 3. Guru BK/Konselor menampilkan toleransi tinggi terhadap peserta didik/konseli yang menghadapistresdanfrustasi. ProsesPenilaian Pemantauan: 1. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh tindakan guru BK/Konselor yang menunjukkan kepribadian, kestabilan emosi, dan perilaku terpuji,jujur,sabar,ramah,dankonsisten. 2. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh tindakan guru BK/Konselor yang menunjukkan kepekaan dan sikap empati guru terhadap keragamandanperubahan,baikyangbersifatmembangunmaupunsebaliknya. 3. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh tindakan guru BK/Konselor yang menunjukkansikap toleransi guru terhadap peserta didik/konseliyangsedangmenghadapistressdanfrustasi.

96

Kompetensi7 : Menampilkankinerjaberkualitastinggi Jenisdancaramenilai:Kepribadian(Pengamatan) Pernyataan : Menampilkan tindakan yang cerdas, kreatif, inovatif, dan produktif, bersemangat, berdisiplin, dan mandiri, berpenampilan menarik dan menyenangkan,berkomunikasisecaraefektif. Indikator 1. Guru BK/Konselor memotivasi peserta didik/konseli untuk berpartisipasi aktif dalam layananBKyangdiberikan. 2. Guru BK/Konselor melaksanakan pelayanan BK yang efektif sesuai dengan rancangan untukmencapaitujuanpelayananBKdalamwaktuyangtersedia. 3. Guru BK/Konselor melaksanakan tugas layanan BK secara mandiri, disiplin, dan semangat agarpesertadidik/konseliberpartisipasisecaraaktif. ProsesPenilaian Sebelumpengamatan: PenilaimemintaguruBK/KonselormenyediakanprogramBKdanRPL/Satlan/Satkungdan menerangkantujuankegiatandanaktifitaspelayananBK. Selamapengamatan: 1. Penilai mengamati, apakah peserta didik/konseli berpartisipasi aktif dalam kegiatan pelayananBK. 2. Penilai mengamati, apakah peserta didik/konseli mengerti dan mengikuti prosedur pelayananBKsesuaidenganwaktuyangdisediakan. 3. Penilai mengamati, apakah guru BK/Konselor melaksanakan kegiatan pelayanan BK secaralancarsesuaidenganrancangandantujuanyangakandicapai. 4. Penilai mencatat jika terdapat perbedaan antara perencanaan dan pelaksanaan pelayananBK. Setelahpengamatan: 1. Penilai meminta penjelasan guru BK/konselor jika terdapat perbedaan antara perencanaandanpelaksanaanpelayananBK. 2. Penilai meminta penjelasan guru BK/konselor terhadap ketercapaian pelaksanaan pelayananBK.

97

Kompetensi8 : Mengimplementasikankolaborasiinternalditempatbekerja Jenisdancaramenilai:Sosial(Pemantauan) Pernyataan : Memahami dasar, tujuan, organisasi, dan peran pihakpihak lain (guru, wali kelas, pimpinan sekolah/madrasah, komite sekolah/madrasah) di tempat bekerja, mengkomunikasikan dasar, tujuan, dan kegiatan pelayanan bimbingan dan konseling kepada pihakpihak lain di tempat bekerja, bekerja sama dengan pihakpihak terkait di dalam tempat bekerja (seperti guru, orang tua, tenaga administrasi). Indikator 1. Guru lain dapat menunjukkan contoh penggunaan hasil pelayanan BK untuk membantu pesertadidik/konselidalamprosespembelajaranyangdilakukannya. 2. Guru BK/Konselor merencanakan pelayanan BK dengan menyertakan pihakpihak terkait disekolah. 3. Guru BK/Konselor dapat menunjukkan bukti bagaimana menjelaskan program dan hasil layananBKkepadapihakpihakterkaitdisekolah. 4. Guru BK/Konselor dapat menunjukkan bukti permintaan guru lain untuk membantu penyelesaianpermasalahanpembelajaran. ProsesPenilaian Pemantauan: 1. Guru BK/Konselor menyediakan dokumen dan buktibukti lain berkaitan dengan pelayanan BK dalam membantu peserta didik/konseli berdasarkan hasil tes peserta didik/konselidan/ataupermintaangurulain. 2. Guru BK/Konselor menyediakan dokumen dan buktibukti lain berkaitan dengan halhal yang telah dilakukannya dalam mengkomunikasikan rencana dan hasil pelayanan BK kepadapihakpihakterkait.

98

Kompetensi9 : BerperandalamorganisasidankegiatanprofesiBK Jenisdancaramenilai:Sosial(Pemantauan) Pernyataan : Memahami dasar, tujuan, dan AD/ART organisasi profesi bimbingan dan konseling untuk pengembangan diri dan profesi, mentaati Kode Etik profesi bimbingan dan konseling, aktif dalam organisasi profesi bimbingandankonselinguntukpengembangandiridanprofesi. Indikator 1. Guru BK/Konselor mentaati Kode Etik organisasi profesi BK (seperti MGBK, ABKIN, atau organisasiprofesisejenislainnya). 2. Guru BK/Konselor berpartisipasi aktif dalam proses pengembangan diri melalui organisasi profesiguruBK/Konselor. 3. Guru BK/Konselor dapat memanfaatkan organisasi profesi BK/Konselor untuk membangunkolaborasidalampengembanganprogramBK. ProsesPenilaian Pemantauan: 1. Penilai menanyakan kepada teman seprofesi tentang kesesuaian aktifitas guru BK/KonselordenganKodeEtikprofesi. 2. Guru BK/Konselor dapat menunjukkan bukti keterlibatan dan aktivitasnya dalam organisasi profesi BK/Konselor (seperti MGBK, ABKIN, atau organisasi profesi sejenis lainnya)tentangpengembangandiridankolaborasi.

99

Kompetensi10 : Mengimplementasikankolaborasiantarprofesi Jenisdancaramenilai:Sosial(Pemantauan) Pernyataan : Mengkomunikasikanaspekaspekprofesionalbimbingandankonseling kepadaorganisasiprofesilain,memahamiperanorganisasiprofesilain dan memanfaatkannya untuk suksesnya pelayanan bimbingan dan konseling, bekerja dalam tim bersama tenaga paraprofesional dan profesional profesi lain, melaksanakan referal (alih tangan kasus) kepadaahliprofesilainsesuaidengankeperluan. Indikator 1. Guru BK/Konselor dapat menunjukkan bukti melakukan interaksi dengan organisasi profesi lain. 2. Guru BK/Konselor dapat berkolaborasi dengan institusi atau profesi lain untuk mencapai tujuanpelayananBK. 3. Guru BK/Konselor dapat memanfaatkan keahlian lain untuk membantu penyelesaian permasalahanpesertadidik/konselisesuaikebutuhan. ProsesPenilaian Pemantauan: 1. Penilai meminta guru BK/Konselor untuk menunjukkan bukti melakukan interaksi dengan organisasi profesi lain (antara lain berupa surat kerjasama, surat keterangan, MoU dengan pihakterkait,ataubuktifisiklainnya). 2. Guru BK/Konselor dapat menunjukkan bukti dan menjelaskan bagaimana memanfaatkan kerjasama dengan institusi (Sekolah, Perguruan Tinggi, Kementerian Sosial, Kementerian TenagaKerja,daninstitusilainnya)atauorganisasiprofesidalammencapaitujuanlayanan BK. 3. Konselor dapat menunjukkan bukti dan menjelaskan bagaimana melaksanakan kerjasama dengan satuan pendukung alih tangan kasus (psikolog, psikiater, pekerja sosial, atau profesilainnya)dalampenyelesaianpermasalahanpesertadidik/konseli.

100

Kompetensi11

: Menguasaikonsepdanpraksispenilaian(assessment)untuk memahamikondisi,kebutuhan,danmasalahkonseli Jenisdancaramenilai:Profesional(Pemantauan) Pernyataan : Mendeskripsikan hakikat asesmen untuk keperluan pelayanan konseling, memilih teknik penilaian sesuai dengan kebutuhan pelayanan bimbingan dan konseling, menyusun dan mengembangkan instrumen penilaian untuk keperluan bimbingan dan konseling, mengadministrasikan asesmen untuk mengungkapkan masalah masalah peserta didik, memilih dan mengadministrasikan teknik penilaian pengungkapan kemampuan dasar dan kecenderungan pribadi peserta didik, memilih dan mengadministrasikan instrumen untuk mengungkapkan kondisi aktual peserta didik berkaitan dengan lingkungan, mengakses data dokumentasi tentang peserta didik dalam pelayanan bimbingan dan konseling, menggunakan hasil penilaian dalam pelayanan bimbingan dan konseling dengan tepat, menampilkantanggungjawabprofesionaldalampraktikpenilaian.
Indikator 1. 2. 3. 4. Guru BK/Konselor dapat mengembangkan instrumen nontes (pedoman wawancara, angket, atau formatlainnya)untukkeperluanpelayananBK. Guru BK/Konselor dapat mengaplikasikan instrumen nontes untuk mengungkapkan kondisi aktual pesertadidik/konseliberkaitandenganlingkungan. Guru BK/Konselor dapat mendeskripsikan penilaian yang digunakan dalam pelayanan BK yang sesuaidengankebutuhanpesertadidik/konseli. GuruBK/Konselordapatmemilihjenispenilaian(InstrumenTugasPerkembangan/ITP,AlatUngkap Masalah/AUM, Daftar Cek Masalah/DCM, atau instrumen non tes lainnya) yang sesuai dengan kebutuhanlayananbimbingandankonseling. Guru BK/Konselor dapat mengadministrasikan penilaian (merencanakan, melaksanakan, mengolah data)untukmengungkapkankemampuandasardankecenderunganpribadipesertadidik/konseli. Guru BK/Konselor dapat mengadministrasikan penilaian (merencanakan, melaksanakan, mengolah data) untuk mengungkapkan masalah peserta didik/konseli (data catatan pribadi, kemampuan akademik,hasilevaluasibelajar,danhasilpsikotes). Guru BK/Konselor dapat menampilkan tanggung jawab profesional sesuai dengan azas BK (misalnyakerahasiaan,keterbukaan,kemutakhiran,dll.)dalampraktikpenilaian. ProsesPenilaian Pemantauan: 1. PenilaimemintaguruBK/Konseloruntukmenyediakaninstrumennontesyangtelahdikembangkan sesuaikebutuhanpelayananBK. 2. Penilai meminta guru BK/Konselor untuk menjelaskan pengaplikasian instrumen nontes tersebut dalammengungkapkankondisiaktualpesertadidik/konseliberkaitandenganlingkungan. 3. Penilai meminta guru BK/Konselor untuk menjelaskan penilaian yang digunakan dalam pelayanan BKyangsesuaidengankebutuhanpesertadidik/konseli. 4. Penilai meminta guru BK/Konselor untuk menyediakan jenis penilaian yang dipilih sesuai dengan kebutuhanlayananbimbingandankonseling. 5. Penilai meminta guru BK/Konselor untuk menyediakan hasil penilaian tentang pengungkapan kemampuandasardankecenderunganpribadipesertadidik/konseli. 6. Penilai meminta guru BK/Konselor untuk menyediakan hasil pendukung penilaian seperti data catatan pribadi peserta didik/konseli, kemampuan akademik/hasil evaluasi belajar, hasil psikotes, dll. 7. PenilaimemintaguruBK/KonseloruntukmenjelaskanpenggunaanazasBKsebagaitanggungjawab professional.

5. 6.

7.

101

Kompetensi12 : MenguasaikerangkateoretikdanpraksisBK Jenisdancaramenilai:Profesional(PengamatandanPemantauan) Pernyataan : Mengaplikasikan hakikat pelayanan bimbingan dan konseling, mengaplikasikan arah profesi bimbingan dan konseling, mengaplikasikan dasardasar pelayanan bimbingan dan konseling, mengaplikasikan pelayanan bimbingan dan konseling sesuai kondisi dan tuntutan wilayah kerja, mengaplikasikan pendekatan/model/jenis pelayanan dan kegiatan pendukung bimbingan dan konseling, mengaplikasikan dalam praktik format pelayanan bimbingan dan konseling.

Indikator 1. 2. 3. 4. 5. 6. Guru BK/Konselor dapat mengaplikasikan hakikat pelayanan BK (tujuan, prinsip, azas, fungsi, dan landasan). Guru BK/Konselor dapat menentukankan arah profesi bimbingan dan konseling (peran sebagai guru BK/konselor). GuruBK/KonselordapatmengaplikasikandasardasarpelayananBK. GuruBK/KonselordapatmengaplikasikanpelayananBKsesuaikondisidantuntutanwilayahkerja. Guru BK/Konselor dapat mengaplikasikan pendekatan /model/jenis pelayanan dan kegiatan pendukungbimbingandankonseling. GuruBK/Konselordapatmengaplikasikanpraktikformat(kegiatan)pelayananBK. ProsesPenilaian Sebelumpengamatan: 1. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan penjelasantentangtujuan,prinsip,azas,fungsi,danlandasanyangdiaplikasikandalamprogramtsb. 2. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan penjelasantentangdasardasarpelayananyangdiaplikasikannyadalamprogramtsb. 3. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan penjelasan tentang kesesuaian kondisi dan tuntutan wilayah kerja yang terdapat di dalam program, RPL/Satlan. 4. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan penjelasan tentangpendekatan/model (misalnya: trait factor, analisis transaksional, rasional emotif, psikoanalisa, konseling behavioural, konseling individual, client centered, terapi gestalt) atau jenis pelayanan (misalnya: jenis pelayanan informasi, orientasi, konseling individu, bimbingan kelompok/konselingkelompok)yangdiaplikasikandalamprogram,RPL/Satlan/Satkungtersebut. 5. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan penjelasan tentang format kegiatan yang digunakan dalam pelayanan BK (secara klasikal, layanan bimbingankelompok,layanankonselingkelompok)tersebut. SelamaPengamatan: 1. Penilai mengamati pelaksanaan pelayanan BK (layanan konseling kelompok dan layanan bimbingan kelompok) untuk menilai misalnya: pendekatan/model atau jenis layanan BK dan meminta guru BK/konselormenjelaskantentangtujuan,teknik,danhasillayananBKtsb. 2. Penilai mengamati pelaksanaan pelayanan BK (layanan konseling kelompok dan layanan bimbingan kelompok) untuk menilai misalnya: layanan informasi, layanan orientasi, layanan konseling perorangan, layanan bimbingan kelompok, layanan konseling kelompok) dan meminta guru BK/konselormenjelaskantentangjenisformat,tujuan,danhasillayanantsb. Pemantauan: Penilai meminta transkrip pelaporan layanan konseling individu dan penjelasan tentang proses dan hasilnya.

102

Kompetensi13 : MerancangprogramBK Jenisdancaramenilai:Profesional(Pengamatan) Pernyataan : Menganalisis kebutuhan konseli, menyusun program bimbingan dan konseling yang berkelanjutan berdasar kebutuhan konseli secara komprehensif dengan pendekatan perkembangan, menyusun rencana pelaksanaan program bimbingan dan konseling, merencanakan sarana dan biaya penyelenggaraan program bimbingandankonseling. Indikator 1. GuruBK/Konselordapatmenganalisiskebutuhanpesertadidik/konseli. 2. Guru BK/Konselor dapat menyusun program pelayanan BK yang berkelanjutan berdasar kebutuhan peserta didik/konseli secara komprehensif dengan pendekatan perkembangan. 3. GuruBK/KonselordapatmenyusunrencanapelaksanaanprogrampelayananBK. 4. Guru BK/Konselor dapat merencanakan sarana dan biaya penyelenggaraan program pelayananBK. ProsesPenilaian Sebelumpengamatan: 1. Penilai meminta guru BK/Konselor untuk menyediakan dokumen hasil asesmen dan atau hasil belajar serta meminta guru BK/konselor mendeskripsikan kesesuaian antara kebutuhanpesertadidik/konselidenganhasilasesmenatauhasilbelajartersebut. 2. PenilaimemintaguruBK/KonseloruntukmenyediakandaftarkegiatanpelayananBKsatu semesterterakhirdanmemintaguruBK/konselormenunjukkanbahwapraktikpelayanan tsbdilaksanakansecarakomprehensifdanberkelanjutan. 3. Penilai meminta guru BK/Konselor untuk menjelaskan tentang program pelayanan BK yang meliputi program tahunan, program semester, program bulanan, mingguan, dan program harian (RPL/Satlan/Satkung) dan meminta guru BK/konselor menjelaskan keterkaitan antara programprogram tersebut dan strategi penyusunannya (bagaimana programtersebutdisusun). SelamaPengamatan: 1. Penilai mengamati pelaksanaan pelayanan BK, misalnya: layanan informasi, layanan orientasi,layananbimbingankelompok,layanankonselingkelompok). 2. PenilaimengamatibagaimanaguruBK/Konselorberinteraksidenganpesertadidik/konseli dalam proses pelayanan BK termasuk sejauhmana guru BK/konselor memberikan kesempatankepadapesertadidik/konseliuntukberpartisipasiaktif. SetelahPengamatan: Penilai meminta guru BK/Konselor menjelaskan kesesuaian antara kebutuhan peserta didik/konselidenganlayananBKyangdiberikan.

103

Kompetensi14 : MengimplementasikanprogramBKyangkomprehensif Jenisdancaramenilai:Profesional(Pengamatan) Pernyataan : Melaksanakan program bimbingan dan konseling, melaksanakan pendekatan kolaboratif dalam pelayanan bimbingan dan konseling, memfasilitasi perkembangan akademik, karier, personal, dan sosial konseli, mengelola sarana dan biaya program bimbingan dan konseling.
Indikator 1. 2. 3. 4. GuruBK/KonselordapatmelaksanakanprogrampelayananBK. Guru BK/Konselor dapat melaksanakan pendekatan kolaboratif dengan pihak terkait dalam pelayananBK. Guru BK/Konselor dapat memfasilitasi perkembanganakademik, karier, personal/ pribadi, dan sosial pesertadidik/konseli. GuruBK/KonselordapatmengelolasaranadanbiayaprogrampelayananBK. ProsesPenilaian Sebelumpengamatan: 1. Penilai meminta guru BK/konselor menyediakan program pelayanan BK yang meliputi program tahunan,programsemester,programbulanan,mingguan,danprogramharian(RPL/Satlan/Satkung). 2. Penilai meminta guru BK/Konselor menjelaskan bagaimana program tsb dilaksanakan melalui berbagaijenislayanandankegiatanpendukung. 3. Penilai meminta guru BK/Konselor untuk menunjukkan adanya kerja sama dengan pihak terkait dalampelaksanaannya. 4. Penilai meminta guru BK/Konselor menunjukkan bagian mana dari program tsb yang memfasilitasi perkembanganakademik,karir,personal,dansosialpesertadidik/konseli. 5. PenilaimemintaguruBK/Konseloruntukmenjelaskanbagaimanasaranadanbiayayangadadikelola dalampelaksanaanprogramtersebut. SelamaPengamatan: Penilai mengamati pelaksanaan pelayanan BK (misalnya: layanan informasi,orientasi, bimbingan kelompok, konseling kelompok) dan bagaimana guru BK/Konselor melaksanakan pelayanan BK termasuk: 1. Berapalamawaktuyangdiperlukanuntukmelakukansetiapkegiatan/aktifitaspelayananBK. 2. ApakahguruBK/KonselormenyesuaikanjenislayananBKsesuaikebutuhanpesertadidik/konseli. 3. Apakah semua layanan BK dapat membantu peserta didik/konseli untuk mencapai tujuan pelayanan. 4. Bagaimana guru BK/Konselor mengelola aktifitas pelayanan BK (misalnya apakah tujuan pelayananBKdapattercapaisesuaidenganRPL/Satlan/Satkung). 5. Bagaimana guru BK/Konselor menggunakan media pelayanan BK (misalnya komputer, film, gambar,komik,danmedialainnya). 6. SeberapaterampilguruBK/KonselormenggunakanmediapelayananBKtersebut. SetelahPengamatan: 1. Penilaimemilihsecararandomsebanyaklimaorangpesertadidik/konseli. 2. Penilai menanyakan bagaimana guru BK/konselor membimbing mereka untuk mencapai keberhasilan pembelajaran/akademik, pemilihan karir, dan/atau penyelesaian masalah pribadi dan social. 3. Penilai meminta guru BK/konselor menjelaskan aktifitas pelayanan BK yang berhasil atau kurang berhasil. 4. jika ada layanan yang tidak sesuai dengan rencana pelayanan BK, penilai meminta guruBK/konselor memberikanalasanberdasarkankebutuhanpesertadidik/konselidanteoriBK.

104

Kompetensi15 : MenilaiprosesdanhasilkegiatanBK Jenisdancaramenilai:Profesional(Pemantauan) Pernyataan : Melakukan evaluasi hasil, proses, dan program bimbingan dan konseling, melakukan penyesuaian proses pelayanan bimbingan dan konseling, menginformasikan hasil pelaksanaan evaluasi pelayanan bimbingan dan konseling kepada pihak terkait, menggunakan hasil pelaksanaan evaluasi untuk merevisi dan mengembangkan program bimbingandankonseling. Indikator 1. GuruBK/KonselordapatmelakukanevaluasiprosesdanhasilprogrampelayananBK. 2. Guru BK/Konselor dapat melakukan penyesuaian kebutuhan peserta didik/konseli dalam prosespelayananBK. 3. Guru BK/Konselor dapat menginformasikan hasil pelaksanaan evaluasi pelayanan BK kepadapihakterkait. 4. Guru BK/Konselor dapat menggunakan hasil pelaksanaan evaluasi untuk merevisi dan mengembangkanprogrampelayananBKberdasarkananalisiskebutuhan. ProsesPenilaian Pemantauan: 1. PenilaimemintaguruBK/konselormenyediakandatahasildanlaporan(lapelprog)evaluasi programpelayananBK. 2. Penilai meminta guru BK/konselor untuk menjelaskan proses pelayanan BK yang sesuai dengankebutuhanpesertadidik/konseli. 3. Penilai meminta guru BK/konselor menunjukkan bukti dan menjelaskan bagaimana hasil layanan BK diinformasikan kepada pihak terkait sesuai dengan kebutuhan (misalnya peserta didik/konseli ybs, kepala sekolah, wali kelas, guru mata pelajaran, dan orang tua) danmenjagakerahasiaandiripesertadidik/konseli. 4. Penilai meminta guru BK/konselor menjelaskan bagaimana hasil evaluasi pelaksanaan program pelayanan BK dan bagianbagian mana dari program tersebut yang harus direvisi dandikembangkanuntukpelayananBKselanjutnya. 5. Penilai memilih secara acak sebanyak lima orang peserta didik/konseli dan bertanya apakah guru BK/konselor mendiskusikan hasil dan kegunaan evaluasi untuk penyesuaian programlayananBKdengankebutuhanmasingmasingpesertadidik/konseli.

105

Kompetensi16 : Memilikikesadarandankomitmenterhadapetikaprofesional Jenisdancaramenilai:Profesional(Pengamatan) Pernyataan : Memberdayakan kekuatan pribadi, dan keprofesionalan guru BK/konselor, meminimalkan dampak lingkungan dan keterbatasan pribadi guru BK/konselor, menyelenggarakan pelayanan sesuai dengan kewenangan dan kode etik profesional guru BK/konselor, mempertahankan obyektivitas dan menjaga agar tidak larut dengan masalah peserta didik, melaksanakan referal sesuai dengan keperluan, peduli terhadap identitas profesional dan pengembangan profesi, mendahulukan kepentingan peserta didik daripada kepentingan pribadi guruBK/konselor.

1. 2. 3. 4. 5. 6. 7.

Indikator GuruBK/Konselordapatmemberdayakankekuatanpribadi,dankeprofesionalanguruBK/konselor. GuruBK/KonselordapatmeminimalisirdampaklingkungandanketerbatasanpribadiguruBK/konselor. Guru BK/Konselor dapat menyelenggarakan pelayanan BK sesuai dengan kewenangan dan kode etik profesionalguruBK/konselor. Guru BK/Konselor dapat mempertahankan objektivitas dan menjaga agar tidak larut dengan masalah pesertadidik/konseli. Guru BK/Konselor dapat melaksanakan layanan pendukung sesuai kebutuhan peserta didik/konseli (misalnyaalihtangankasus,kunjunganrumah,konferensikasus,instrumenbimbingan,himpunandata) GuruBK/Konselordapatmenghargaiidentitasprofesionaldanpengembanganprofesi. GuruBK/Konselordapatmendahulukankepentinganpesertadidik/konselidaripadakepentinganpribadi guruBK/konselor. ProsesPenilaian

Pemantauan: 1. Penilai meminta guru BK/Konselor menyediakan hasil evaluasi diri program PKB. Penilai mengevaluasi dokumentersebut. 2. Penilai meminta guru BK/Konselor mendeskripsikan kekuatan diri dan bagaimana kekuatan tersebut dimanfaatkanbagisuksesnyapelayananBK. 3. Penilai meminta guru BK/Konselor mendeskripsikan keterbatasan diri dan lingkungan (termasuk prasaranadansarana)dalampelayananBK,sertaupayameminimalkandampakketerbatasantersebut. 4. Penilai meminta guru BK/Konselor mengidentifikasi kewenangan guru BK/konselor sesuai dengan Kode EtikpelaksanaanpelayananBK. 5. Penilai meminta guru BK/Konselor menyediakan minimal satu laporan pelaksanaan program layanan (lapelprog).Penilaimengevaluasilaporantersebut. 6. Penilai meminta guru BK/Konselor untuk menjelaskan perlu tidaknya masalah peserta didik/konseli dialihtangankankepadapihaklain. 7. Penilai meminta guru BK/Konselor mendeskripsikan identitas dan pengembangan profesi BK serta bagaimanakesungguhanguruBK/KonselordalammelaksanakanpelayananBKtersebut. 8. Penilai meminta guru BK/Konselor menjelaskan dan membuktikan apakah guru BK/Konselor mengutamakan kebutuhan peserta didik/konseli meskipun harus mengorbankan sesuatu (misalnya waktu). 9. Penilai meminta guru BK/Konselor untuk menjelaskan tentang upayanya dalam menghimpun dan menjagakerahasiaanpermasalahanpesertadidik/konseli. 10. Penilai meminta Kepala Sekolah untuk menjelaskan apakah guru BK/Konselor bekerja sesuai dengan etikaprofesiBK. 11. Penilai meminta Kepala Sekolah untuk menerangkan bagaimana pekerjaan guru BK/konselor mencapai standaryangdiharapkanolehkepalasekolahdan/ataukomitesekolah.

106

Kompetensi17 : MenguasaikonsepdanpraksispenelitiandalamBK Jenisdancaramenilai:Profesional(Pemantauan) Pernyataan : Mendeskripsikan berbagai jenis dan metode penelitian, mampu merancang penelitian bimbingan dan konseling, melaksanakan penelitian bimbingan dan konseling, memanfaatkan hasil penelitian dalam bimbingan dan konseling dengan mengakses jurnal pendidikan danbimbingandankonseling. Indikator 1. 2. 3. 4. ProsesPenilaian Pemantauan: 1. Penilai meminta guru BK/Konselor untuk mendeskripsikan berbagai jenis dan metoda penelitian,khususnyayangdapatdanperludilaksanakandalamprofesiBK. 2. Penilai meminta guru BK/Konselor mengemukakan satu permasalahan bidang BK terkait denganpelayananBKdisekolahyangperluditeliti. 3. Penilai meminta guru BK/Konselor menjelaskan langkahlangkah dalam merancang penelitiantentangmasalahtersebut. 4. Penilai meminta guru BK/Konselor menyediakan bukti penelitian yang telah dilaksanakannyasertamenjelaskangarisbesarprosesdanisipenelitian. 5. Penilai meminta guru BK/Konselor menyediakan laporan hasil penelitian dari jurnal atau sumberlainterkaitpelayananBKdisekolah. 6. Penilai meminta guru BK/Konselor menjelaskan keterkaitan dan kegunaan hasil penelitian tersebutdalamkegiatanpelayananBKdisekolah. 7. Penilai meminta guru BK/Konselor menjelaskan manfaat hasil penelitian terkait dengan programPKByangdirencanakan. GuruBK/KonselordapatmendeskripsikanjenisdanmetodepenelitiandalamBK. GuruBK/KonselormampumerancangpenelitiandalamBK. GuruBK/KonselordapatmelaksanakanpenelitiandalamBK. GuruBK/KonselordapatmemanfaatkanhasilpenelitiandalamBKdenganmengaksesjurnal yangrelevan.

107

Lampiran2B
LAPORANDANEVALUASI PENILAIANKINERJAGURUBIMBINGANDANKONSELING/KONSELOR :______________________________________________(1)

NamaGuru NIP/NomorSeriKarpeg :________________________/_____________________(2) Pangkat/GolonganRuang :________________________/_____________________(3) TerhitungMulaiTanggal NUPTK/NRG :________________________/_____________________(4) Namasekolah dan :________________________________________________ Alamatsekolah :_______________________________________________(5) Tanggalmulaibekerja disekolahini :______________________________________________(6) Bulan Tahun Periodepenilaian :_________________sampai___________________(7) (tanggal,bulan,tahun) (tanggal,bulan,tahun) PERSETUJUAN(8) (Persetujuaniniharusditandatanganiolehpenilaidanguruyangdinilai) Penilai dan guru yang dinilai menyatakan telah membaca dan mamahami semua aspek yang ditulis/dilaporkandalamformatinidanmenyatakansetuju. Namaguru Namapenilai Tanda Tandatangan tangan Tanggal ___bulan____tahun_______

108

Kompetensi1 :Menguasaiteoridanpraksispendidikan NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) PenilaianuntukKompetensi1:Menguasaiteoridanpraksispendidikan. Skor Indikator 1. GuruBK/Konselordapatmenunjukkandalam perencanaanlayananBK,sesuaidenganlandasan danprinsipprinsippendidikanserta pembelajaranyangaktif,kreatif,mandiri,dan berpusatpadapesertadidik/konseli. 2. GuruBK/Konselordapatmenunjukkandalam perencanaanlayananBK,sesuaidenganusia, tahapperkembangan,dankebutuhanpeserta didik/konseli. 3. GuruBK/Konselordapatmenunjukkandalam perencanaanlayananBK,sesuaidengan keragamanlatarbelakangbudaya,ekonomi,dan sosialpesertadidik/konseli. Totalskoruntukkompetensi1 Skormaksimumkompetensi1=jumlahindikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi1 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

(34)

(25)

2
(26)

(27) 6(28) (29) (30)

109

Kompetensi2:Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilakukonseli NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru: (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) Penilaian untuk Kompetensi 2: Mengaplikasikan perkembangan fisiologis dan psikologis serta perilakukonseli. Skor Indikator
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. Pesertadidik/konselidiberikesempatandalam
memperolehlayananBKsesuaidengankebutuhan perkembanganmental,emosional,fisik,dangender. 2. Pesertadidik/konselidiberikesempatandalam memperolehlayananBKsesuaidengankebutuhan bakat,minat,danpotensipribadi. 3. Pesertadidik/konselidiberikesempatandalam memperolehlayananBKsesuaidenganharapan untukmelanjutkanpendidikandanpilihankarir. Totalskoruntukkompetensi2 Skormaksimumkompetensi2=jumlah indikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi2 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4) 0 1

2
(26)

(27) 6(28) (29) (30)

110

Kompetensi3 :Menguasaiesensipelayananbimbingandankonselingdalamjalur, jenis,danjenjangsatuanpendidikan NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) 21) Penilaian untuk Kompetensi 3: Menguasai esensi pelayanan bimbingan dan konseling jalur, jenis,danjenjangsatuanpendidikan. Skor Indikator
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. LayananBKyangdiprogramkanolehguruBK/
Konselortelahmemenuhiesensilayananpadajalur satuanpendidikanformal,nonformaldaninformal. 2. LayananBKyangdiprogramkanolehguruBK/ Konselortelahmemenuhiesensilayananpadajenis satuanpendidikanumum,kejuruan,keagamaan, dankhusus. 3. LayananBKyangdiprogramkanolehguruBK/ Konselortelahmemenuhiesensilayananpada jenjangsatuanpendidikanusiadini,dasardan menengah,sertatinggi. Totalskoruntukkompetensi3 Skormaksimumkompetensi3=jumlahindikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi3 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4) 0 1

(26)

(27) 6(28) (29) (30)

111

Kompetensi4 :BerimandanbertakwakepadaTuhanYangMahaEsa NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) PenilaianuntukKompetensi4:BerimandanbertakwakepadaTuhanYangMahaEsa. Skor Indikator
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

1. GuruBK/Konselorberpenampilanrapihdan
bersih. 2. GuruBK/Konselorberbicaradengansantundan jujurkepadapesertadidik/konseli. 3. GuruBK/Konselorbersikapdanmendorong kepadapesertadidik/konseliuntukbersikap toleran. 4. GuruBK/Konselormemperlihatkankonsistensi danmemotivasipesertadidik/konselidalam melaksanakanibadah. Totalskoruntukkompetensi4 Skormaksimumkompetensi4=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi4 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)

0 0 0

1 1 1

2 2 2
(26)

(27) 8(28) (29) (30)

112

Kompetensi5 :Menghargaidanmenjunjungtingginilainilaikemanusiaan, individualitasdankebebasanmemilih NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) Penilaian untuk Kompetensi 5: Menghargai dan menjunjung tinggi nilainilai kemanusiaan, individualitasdankebebasanmemilih. Skor Indikator
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

1. GuruBK/KonselormerencanakanlayananBKyang
mengacukepadapengaplikasianpandangan dinamistentangmanusiasebagaimahlukbermoral spiritual,sosial,&individu. 2. PelayananBKyangdirancangolehGuru BK/Konselormendorongkepadapengembangan potensipositifindividu. 3. RancanganpelayananBKmengacukepada kebutuhandanmasukanbalikpeserta didik/konseli. 4. PelayananBKdirancanguntukmengembangkan sikaptolerandalammenjunjunghakazasimanusia padapesertadidik/konseli. Totalskoruntukkompetensi5 Skormaksimumkompetensi5=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi5 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4) 0 1

(26)

(27) 8(28) (29) (30)

113

Kompetensi6 :Menunjukkanintegritasdanstabilitaskepribadianyangkuat NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan)

(23) (24)

(25) PenilaianuntukKompetensi6:Menunjukkanintegritasdanstabilitaskepribadianyangkuat. Skor Indikator


Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. GuruBK/Konselormenunjukkankepribadian,
kestabilanemosidanperilakuyangterpuji,jujur, sabar,ramah,dankonsisten. 2. GuruBK/Konselormenunjukkankepekaandan bersikapempatiterhadapkeragamandan perubahan. 3. GuruBK/Konselormenampilkantoleransitinggi terhadappesertadidik/konseliyangmenghadapi tressdanfrustasi. Totalskoruntukkompetensi6 Skormaksimumkompetensi6=jumlahindikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi6 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4) 0 1

2
(26)

2 2

(27) 6(28) (29) (30)

114

Kompetensi7 :Menampilkankinerjaberkualitastinggi NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru: (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan: (21) Tindaklanjutyangdiperlukan: (22)

115

PenilaianuntukKompetensi7:Menampilkankinerjaberkualitastinggi. Skor Indikator


Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. GuruBK/Konselormemotivasipeserta
didik/konseliuntukberpartisipasiaktifdalam layananBKyangdiberikan. 2. Guru BK/Konselor melaksanakan pelayanan BK yang efektif sesuai dengan rancangan untuk mencapai tujuan pelayanan BK dalam waktu yang tersedia. 3. GuruBK/KonselormelaksanakantugaslayananBK secaramandiri,disiplin,dansemangatagar pesertadidik/konseliberpartisipasisecaraaktif. Totalskoruntukkompetensi7 Skormaksimumkompetensi7=jumlahindikator2 Persentase=(totalskor/6)100% Nilaiuntukkompetensi7 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4) 0 1

2
(26)

2 (27)

6(28) (29) (30)

116

Kompetensi8 :Mengimplementasikankolaborasiinternalditempatbekerja NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (19) Dokumendanbahanlain (20) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (21) Penilaian untuk Kompetensi 8: Mengimplementasikan kolaborasi internal di tempat bekerja. Skor Indikator
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

1. Gurulaindapatmenunjukkancontohpenggunaan 2 hasilpelayananBKuntukmembantupeserta 0 1 didik/konselidalamprosespembelajaranyang dilakukannya. 2. GuruBK/KonselormerencanakanpelayananBK denganmenyertakanpihakpihakterkaitdi 0 1 2 sekolah. 3. GuruBK/Konselordapatmenunjukkanbukti bagaimanamenjelaskanprogramdanhasil 0 1 2 layananBKkepadapihakpihakterkaitdisekolah. 4. GuruBK/Konselordapatmenunjukkanbukti permintaangurulainuntukmembantu 0 1 2 penyelesaianpermasalahanpembelajaran. Totalskoruntukkompetensi8 (27) Skormaksimumkompetensi8=jumlahindikator2 8(28) Persentase=(totalskor/8)100% (29) Nilaiuntukkompetensi8 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

117

Kompetensi9 :BerperandalamorganisasidankegiatanprofesiBK NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) PenilaianuntukKompetensi9:BerperandalamorganisasidankegiatanprofesiBK. Skor Indikator
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi) (26)

1. GuruBK/KonselormentaatiKodeEtikorganisasi profesiBK(sepertiMGBK,ABKIN,atauorganisasi 0 1 2 profesisejenislainnya). 2. GuruBK/Konselorberpartisipasiaktifdalam prosespengembangandirimelaluiorganisasi 0 1 2 profesiguruBK/Konselor. 3. GuruBK/Konselordapatmemanfaatkan organisasiprofesiBK/Konseloruntukmembangun 0 1 2 kolaborasidalampengembanganprogramBK. Totalskoruntukkompetensi9 (27) Skormaksimumkompetensi9=jumlahindikator2 6(28) Persentase=(totalskor/6)100% (29) Nilaiuntukkompetensi9 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

118

Kompetensi10:Mengimplementasikankolaborasiantarprofesi NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa Catatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25) PenilaianuntukKompetensi10:Mengimplementasikankolaborasiantarprofesi. Skor Indikator 1. GuruBK/Konselordapatmenunjukkanbukti melakukaninteraksidenganorganisasiprofesilain. 2. GuruBK/Konselordapatberkolaborasidengan institusiatauprofesilainuntukmencapaitujuan pelayananBK. 3. GuruBK/Konselordapatmemanfaatkankeahlian lainuntukmembantupenyelesaianpermasalahan pesertadidik/konselisesuaikebutuhan. 4. GuruBK/Konselordapatmenunjukkanbukti melakukaninteraksidenganorganisasiprofesilain. Totalskoruntukkompetensi10 Skormaksimumkompetensi10=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi10 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

0 0

1 1

2 2
(26)

0 0

1 1

2 2

(27) 8(28) (29) (30)

119

Kompetensi11:Menguasaikonsepdanpraksispenilaian(assessment)untukmemahamikondisi, kebutuhan,danmasalahkonseli NamaGuru :(9) NamaPenilai :(10) Pemantauan


Tanggal (23) Dokumendanbahanlain (24) yangdiperiksa Catatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan) (25)

Penilaian untuk Kompetensi 11: Menguasai konsep dan praksis penilaian (assessment) untuk memahamikondisi,kebutuhan,danmasalahkonseli. Skor Tidakada Indikator Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi) 1. Guru BK/Konselor dapat mengembangkan instrumen non tes (pedoman wawancara, angket, atau format lainnya) 0 1 2 untukkeperluanpelayananBK. 2. Guru BK/Konselor dapat mengaplikasikan instrumen non tes untuk mengungkapkan kondisi aktual peserta 0 1 2 didik/konseliberkaitandenganlingkungan. 3. Guru BK/Konselor dapat mendeskripsikan penilaian yang digunakan dalam pelayanan BK yang sesuai dengan 0 1 2 kebutuhanpesertadidik/konseli. 4. Guru BK/Konselor dapat memilih jenis penilaian (Instrumen Tugas Perkembangan/ITP, Alat Ungkap 2 Masalah/AUM, Daftar Cek Masalah/DCM, atau instrumen 0 1 nontes lainnya) yang sesuai dengan kebutuhan layanan bimbingandankonseling. 5. Guru BK/Konselor dapat mengadministrasikan penilaian (merencanakan, melaksanakan, mengolah data) untuk 0 1 2 mengungkapkan kemampuan dasar dan kecenderungan pribadipesertadidik/konseli. 6. Guru BK/Konselor dapat mengadministrasikan penilaian (merencanakan, melaksanakan, mengolah data) untuk mengungkapkan masalah peserta didik/konseli (data 0 1 2 catatan pribadi, kemampuan akademik, hasil evaluasi belajar,danhasilpsikotes). 7. Guru BK/Konselor dapat menampilkan tanggung jawab profesional sesuai dengan azas BK (misalnya kerahasiaan, 0 1 2 keterbukaan,kemutakhiran,dll.)dalampraktikpenilaian. Totalskoruntukkompetensi11 (27) Skormaksimumkompetensi11=jumlahindikator2 14(28) Persentase=(totalskor/14)100% (29) Nilaiuntukkompetensi11 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

120

Kompetensi12:MenguasaikerangkateoretikdanpraksisBK NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal Dokumendanbahanlain yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru: Tindaklanjutyangdiperlukan:

(11) (12)

(13)

(14) SelamaPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan: Tindaklanjutyangdiperlukan: (18) Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan)

(15) (16)

(17)

(23) (24)

(25)

121

PenilaianuntukKompetensi12:MenguasaikerangkateoretikdanpraksisBK. Skor Indikator


Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

1. GuruBK/Konselordapatmengaplikasikanhakikat pelayananBK(tujuan,prinsip,azas,fungsi,dan 0 1 2 landasan). 2. GuruBK/Konselordapatmenentukankanarah profesibimbingandankonseling(peransebagaiguru 0 1 2 BK/konselor). 3. GuruBK/Konselordapatmengaplikasikandasar 0 1 2 dasarpelayananBK. 4. GuruBK/Konselordapatmengaplikasikanpelayanan 0 1 2 BKsesuaikondisidantuntutanwilayahkerja. 5. GuruBK/Konselordapatmengaplikasikan pendekatan/model/jenispelayanandankegiatan 0 1 2 pendukungbimbingandankonseling. 6. GuruBK/Konselordapatmengaplikasikanpraktik 0 1 2 format(kegiatan)pelayananBK. Totalskoruntukkompetensi12 (27) Skormaksimumkompetensi12=jumlahindikator2 12(28) Persentase=(totalskor/12)100% (29) Nilaiuntukkompetensi12 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

(26)

122

Kompetensi13:MerancangprogramBK NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal (11) Dokumendanbahanlain (12) yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru: (13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal (15) Dokumendanbahanlain (16) yangdiperiksa Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan: (17) Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan: Tindaklanjutyangdiperlukan:

(19) (20)

(21)

(22)

123

PenilaianuntukKompetensi13:MerancangprogramBK. Skor Indikator 1. GuruBK/Konselordapatmenganalisiskebutuhan pesertadidik/konseli. 2. GuruBK/Konselordapatmenyusunprogram pelayananBKyangberkelanjutanberdasar kebutuhanpesertadidik/konselisecara komprehensifdenganpendekatanperkembangan. 3. GuruBK/Konselordapatmenyusunrencana pelaksanaanprogrampelayananBK. 4. GuruBK/Konselordapatmerencanakansaranadan biayapenyelenggaraanprogrampelayananBK. Totalskoruntukkompetensi13 Skormaksimumkompetensi13=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi13 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi bukti(Tidak sebagian terpenuhi) Terpenuhi seluruhnya

2 2
(26)

0 0

1 1

2 2

(27) 8(28) (29) (30)

124

Kompetensi14:MengimplementasikanprogramBKyangkomprehensif NamaGuru :(9) NamaPenilai :(10) SebelumPengamatan Tanggal Dokumendanbahanlain yangdiperiksa TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(11) (12)

(13) Tindaklanjutyangdiperlukan: (14) SelamaPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Kegiatan/aktivitasgurudanpesertadidikselamapengamatan: Tindaklanjutyangdiperlukan: (18) SetelahPengamatan Tanggal Dokumendanbahanlain yangdiperiksa Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan: Tindaklanjutyangdiperlukan: (22) (19) (20)

(15) (16)

(17)

(21)

125

PenilaianuntukKompetensi14:MengimplementasikanprogramBKyangkomprehensif. Skor Indikator 1. GuruBK/Konselordapatmelaksanakanprogram pelayananBK. 2. GuruBK/Konselordapatmelaksanakanpendekatan kolaboratifdenganpihakterkaitdalampelayanan BK. 3. GuruBK/Konselordapatmemfasilitasi perkembanganakademik,karier,personal/pribadi, dansosialpesertadidik/konseli. 4. GuruBK/Konselordapatmengelolasaranadanbiaya programpelayananBK. Totalskoruntukkompetensi14 Skormaksimumkompetensi14=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi14 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)
Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

0 0

1 1

2 2
(26)

0 0

1 1

2 2

(27) 8(28) (29) (30)

126

Kompetensi15:MenilaiprosesdanhasilkegiatanBK NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa Tanggapandankegiatan/aktivitasguruselamapemantauan: PenilaianuntukKompetensi15:MenilaiprosesdanhasilkegiatanBK. Skor Indikator 1. GuruBK/Konselordapatmelakukanevaluasiproses danhasilprogrampelayananBK. 2. GuruBK/Konselordapatmelakukanpenyesuaian kebutuhanpesertadidik/konselidalamproses pelayananBK. 3. GuruBK/Konselordapatmenginformasikanhasil pelaksanaanevaluasipelayananBKkepadapihak terkait. 4. GuruBK/Konselordapatmenggunakanhasil pelaksanaanevaluasiuntukmerevisidan mengembangkanprogrampelayananBK berdasarkananalisiskebutuhan. Totalskoruntukkompetensi15 Skormaksimumkompetensi15=jumlahindikator2 Persentase=(totalskor/8)100% Nilaiuntukkompetensi15 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)

(23) (24)

(25)

Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

0 0

1 1

2 2
(26)

(27) 8(28) (29) (30)

127

Kompetensi16:Memilikikesadarandankomitmenterhadapetika professional NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa Tanggapandankegiatan/aktivitasguruselamapemantauan: PenilaianuntukKompetensi16:Memilikikesadarandankomitmenterhadapetika professional. Skor Indikator 1. GuruBK/Konselordapatmemberdayakankekuatan pribadi,dankeprofesionalanguruBK/konselor. 2. GuruBK/Konselordapatmeminimalisirdampak lingkungandanketerbatasanpribadiguru BK/konselor. 3. GuruBK/Konselordapatmenyelenggarakan pelayananBKsesuaidengankewenangan rofessi etikp rofesionalguruBK/konselor. 4. GuruBK/Konselordapatmempertahankan objektivitasdanmenjagaagartidaklarutdengan masalahpesertadidik/konseli. 5. GuruBK/Konselordapatmelaksanakanlayanan pendukungsesuaikebutuhanpesertadidik/konseli (misalnyaalihtangankasus,kunjunganrumah, konferensikasus, instrumenbimbingan,himpunan data). 6. GuruBK/Konselordapatmenghargaiidentitas p rofesionaldanpengembanganprofesi. 7. GuruBK/Konselordapatmendahulukankepentingan pesertadidik/konselidaripadakepentinganpribadi guruBK/konselor. Totalskoruntukkompetensi16 Skormaksimumkompetensi16=jumlahindikator2 Persentase=(totalskor/14)100% Nilaiuntukkompetensi16 (0%<X25%=1;25%<X50%=2; 50%<X75%=3;75%<X100%=4)

(23) (24)

(25)

Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

0 0

1 1

2 2 2

1
(26)

0 0

1 1

2 2

(27) 14(28) (29) (30)

128

Kompetensi17:MenguasaikonsepdanpraksispenelitiandalamBK NamaGuru :(9) NamaPenilai :(10) Pemantauan Tanggal Dokumendanbahanlain yangdiperiksa CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru (catatkegiatanyangdilakukan)

(23) (24)

(25)

129

PenilaianuntukKompetensi17:MenguasaikonsepdanpraksispenelitiandalamBK. Skor Indikator


Tidakada Terpenuhi Terpenuhi bukti(Tidak sebagian Seluruhnya terpenuhi)

2 0 1 metodepenelitiandalamBK. 2. Guru BK/Konselor mampu merancang penelitian 0 1 2 dalamBK. 3. GuruBK/Konselordapatmelaksanakanpenelitian 0 1 2 dalamBK. 4. GuruBK/Konselordapatmemanfaatkanhasil 0 1 2 penelitiandalamBKdenganmengaksesjurnalyang relevan. Totalskoruntukkompetensi17 (27) Skormaksimumkompetensi17=jumlahindikator2 8(28) Persentase=(totalskor/8)100% (29) Nilaiuntukkompetensi17 (0%<X25%=1;25%<X50%=2; (30) 50%<X75%=3;75%<X100%=4)

1. Guru BK/Konselor dapat mendeskripsikan jenis dan

(26)

130

PETUNJUKPENGISIANFORMAT2B NO NOMOR URAIAN KODE 1 2 3 1. (1) Tulislah nama Pegawai Negeri Sipil yang dinilai sesuai dengan yang tercantum dalamSKpengangkatanpertamasebagaiCPNS. 2. (2) TulislahNomorIndukPegawaidanNomorKarpegPNSyangbersangkutan. 3. (3) Tulislah pangkat dan golongan ruang terakhir PNS tersebut terhitung mulai tanggalberlakunyaSK. 4. (4) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta nomor registrasi guru/setelah guru yang bersangkutan memiliki sertifikat pendidik(NRG). 5. (5) Tulislah dengan jelas Nama Sekolah tempat guru bekerja berikut alamatnya sebagaiSatuanAdministrasiPangkalguruyangbersangkutan. 6. (6) Tulislah sejak kapan guru bekerja pada sekolah sebagai Satuan Admimistrasi Pangkalyangbersangkutan. 7. (7) Tulislah waktu mulai dilakukan penilaian dan akhir pelaksanaan penilaian bagi gurutermaksudpadatahunajarantertentu. 8. (8) Tulislah nama guru yang dinilai dan nama penilai yang melakukan penilaian kinerja guru, selanjutnya tandatangani secara bersama pada ruang yang tersedia sebagai tanda persetujuan bersama terhadap hasil penilaian, serta tulis tanggal bulan dan tahun saat menyatakan persetujuan terhadap hasil penilaian. 9. (9) CukupJelas. 10. (10) CukupJelas. 11. (11) Tulislah tanggal saat melakukan pengamatan terhadap guru yang dinilai dan pengamatanterhadapdokumendokumenyangdiperlukandalampenilaian. 12. (12) Tuliskandokumendanbahanapasajayangdiperiksa. 13. (13) Tulislah tanggapan penilai terhadap dokumen dan bahan yang telah diperiksa sertatanggapanguruataspertanyaanyangdiajukanolehpenilai. 14. (14) Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah memeriksa dokumen,bahan,danberdiskusidenganguruyangdinilai. 15. (15) Tulislah tanggal saat melakukan pengamatan terhadap kegiatan guru dalam pelaksanaanprosesbimbingandankonseling. 16. (16) Tulislah dokumen dan bahan lain yang juga diamati selama melakukan pengamatan kegiatan guru dalam melaksanakan proses bimbingan dan konseling. 17. (17) Tulislah tanggapan terhadap aktivitas guru dan peserta didik selama masa pengamatandalamprosesbimbingandankonseling. 18. (18) Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah melakukan pengamatanprosesbimbingandankonseling. 19. (19) Tulislah tanggal saat melakukan diskusi dengan guru setelah melakukan pengamatan terhadap kegiatan guru dalam melaksanakan proses bimbingan dankonseling. 20. (20) Tulislah dokumen dan bahan pendukung yang diperiksa setelah melakukan pengamatan terhadap kegiatan guru dalam melaksanakan proses bimbingan dankonseling.

131

NO 21.

NOMOR KODE (21)

URAIAN Tulislah tanggapan penilai terhadap dokumen yang diperlukan dan tanggapan guru terhadap pertanyaanpertanyaan yang diberikan oleh penilai terkait denganpelaksanaankegiatanprosesbimbingandankonseling. Tulislah tindak lanjut yang diperlukan oleh penilai untuk meningkatkan kualitasgurudalampelaksanaanprosesbimbingandankonseling. Tulislahtanggalsaatmelakukanpemantauanterhadapguruyangyangdinilai. Tulislah dokumen dan/atau bahan yang diperiksa selama melakukan pemantauanterhadapguruyangdinilai. Tulislah tanggapan penilai terhadap hasil pemantauan kegiatan guru yang dinilai. Berikan skor 0 atau 1 atau 2 terhadap indikatorindikator yang menunjukkan kompetensi guru yang dinilai sebagai hasil evaluasi terhadap dokumen dan tanggapangurusebelumpengamatandan/atauselamapengamatandan/atau setelahpengamatandan/ataupemantauan. Tulislahtotalhasilskorsetiapindikatorpadakompetensiyangbersangkutan. Angkainimenunjukkanskormaksimumpadakompetensitertentu. Hitungdantulislahhasilpenilaiankompetensitertentudengancaramembagi total skor yang diperoleh (nomor kode 27) dengan skor maksimum pada kompetensitertentu(nomorkode28)dikalikanseratuspersen(100%). Tulislah nilai kinerja guru dengan mengkonversi hasil persentase (nomor kode 29) ke dalam angka 1 atau 2 atau 3 atau 4 dengan menggunakan ketentuan perhitungansebagaiberikut: Nilai1untuk0%<X<25% Nilai2untuk25%<X<50% Nilai3untuk50%<X<75% Nilai4untuk75%<X<100%

22. 23. 24. 25. 26.

(22) (23) (24) (25) (26)

27. 28. 29.

(27) (28) (29)

30.

(30)

132

Lampiran2C
REKAPHASILPENILAIANKINERJAGURUBIMBINGANDANKONSELING/KONSELOR a. Nama :........................(1) NIP :........................(2) Tempat/TanggalLahir :/.........................(3) Pangkat/Jabatan/Golongan :........................(4) TMTsebagaiguru :........................(5) MasaKerja :........Tahun..Bulan(6) JenisKelamin :L/P(7) PendidikanTerakhir/Spesialisasi:..........................(8) ProgramKeahlianyangdiampu :.........................(9) b. NamaInstansi/Sekolah :.........................(10) Telp/Fax :.........................(11) Kelurahan :.........................(12) Kecamatan :.........................(13) Kabupaten/kota :.........................(14) Provinsi :.........................(15)

Periodepenilaian(16) ..........sampai.......... (tanggal,bulan,tahun)(tanggal,bulan,tahun)

Formatif Sumatif Kemajuan

(18) (19)

Tahun(20) ..

No. Pedagogik 1 2 3 v4 5 6 7 Sosial 8 9 10 11 12 13 14 15 16 17

Kompetensi Menguasaiteoridanpraksispendidikan. Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilakukonseli. MenguasaiesensipelayananBKdalamjalur,jenis,danjenjangsatuanpendidikaan. BerimandanbertakwakepadaTuhanYangMahaEsa. Menghargaidanmenjunjungtingginilainilaikemanusian,individualitasdan kebebasanmemilih. Menunjukkanintegritasdanstabilitaskepribadianyangkuat. Menampilkankenerjaberkualitastinggi. Mengimplimentasikankolaborasiinternalditempatbekerja. BerperandalamorganisasidankegiatanprofesiBK. Mengimplimentasikolaborasiantarprofesi. Menguasaikonsepdanpraksispenilaian(assessment) untukmemahamikondisi, kebutuhandanmasalahkonseli. MenguasaikerangkateoritikdanpraksisBK. MerancangprogramBK. MengimplementasikanprogramBKyangkomprehensif. Menilaiprosesdanhasilkegiatanbimbingandankonseling. Memilikikesadarandankomitmenterhadapetikaprofesional. MenguasaikonsepdanpraksispenelitiandalamBK.

Nilai*)

Kepribadian

(26)

Profesional

Jumlah(Hasilpenilaiankinerjaguru) *)Nilaidiisiberdasarkanlaporandanevaluasi.Nilaiminimumperkompetensi=1dannilaimaksimum=4. .,(23) Guruyangdinilai Penilai KepalaSekolah (........................(24)) (...............................(25)) (.............................(26))

(22)

133

PETUNJUKPENGISIANFORMAT2C NO NOMOR URAIAN KODE 1 2 3 1. (1) Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK pengangkatansebagaiguru. 2. (2) TulislahNomorIndukPegawaiguruyangbersangkutan. 3. (3) TulislahtempatdantanggallahirguruyangdinilaisesuaiSKpengangkatan. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitung mulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkanSKpengangkatansebagaiguru. 6. (6) Tulislahsejakkapan(berapatahundanberapabulan)gurutersebutbertugas. 7. (7) TulislahjeniskelamindariguruyangdinilaidengancaramencorethurufLatauP. 8. (8) Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya. 9. (9) Tulislahprogramkeahlianyangdiampuguruyangdinilai. 10. (10) Tulislahnamainstansiatausekolahguruyangdinilai. 11. (11) Tuliskannomordanfaxsekolah(jikaada). 12. (12) Tuliskankelurahandimanasekolah/madrasahberlokasi. 13. (13) Tuliskankecamatandimanasekolah/madrasahberlokasi. 14. (14) Tuliskankelurahandimanasekolah/madrasahberlokasi. 15. (15) Tuliskanprovinsidimanasekolah/madrasahberlokasi. 16. (16) Tulislah kapan guru mulai dilakukan penilaian dan kapan berakhirnya proses penilaianbagigurutersebutpadatahunajaranyangbersangkutan. 17. (17) Pilihlahdenganmemberitandacentangvpadakolomyangsesuai,penilaian formatif(awaltahunajaran),sumatif(akhirtahunajaran),ataupenilaian 18. (18) kemajuansetelahgurumelaksanakanPKBuntukmemperbaikikinerjanya. 19. (19) 20. (20) Tulislahtahunajaranpelaksanaanpenilaian. 21. (21) Tulislah hasil penilaian guru yang merupakan hasil penilaian kinerja guru dengan menggunakanformat1B. 22. (22) Jumlahkan hasil nilai untuk semua kompetensi guru, sehingga memberikan hasil nilai kinerja guru. Bila penilaian ini adalah penilaian sumatif, maka nilai inilah yang kemudian dikonversikan ke dalam perolehan angka kredit guru sesuai PermennegpandanRB16/2009. 23. (23) Tulislahtempatdantanggaldilakukannyapengisianformatini. 24. (24) Isilah dengan tandatangan dan nama guru yang dinilai sebagai bukti bahwa guru telahmengetahuidansetujudenganhasilnilaiyangdiperoleh. 25. (25) Isilahdengantandatangandannamapenilai. 26. (26) Isilah dengan tandatangan dan nama kepala sekolah tempat guru bekerja, sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasil nilaikinerjaguru.

134

Lampiran2D
FORMATPENGHITUNGANANGKAKREDITPKGURUBIMBINGANDANKONSELING/KONSELOR a. Nama :........................(1) NIP :........................(2) Tempat/TanggalLahir :/.........................(3) Pangkat/Jabatan/Golongan :........................(4) TMTsebagaiguru :........................(5) MasaKerja :........Tahun..Bulan(6) JenisKelamin :L/P(7) PendidikanTerakhir/Spesialisasi :.........................(8) :........................(9) ProgramKeahlianyangdiampu b. NamaInstansi/Sekolah :......................(10) Telp/Fax :.......................(11) Kelurahan :.......................(12) Kecamatan :.......................(13) Kabupaten/kota :.......................(14) Provinsi :......................(15) NilaiPKGURUBimbingandanKonseling/Konselor. (16) KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPAN&RM No.16Tahun2009denganrumus: (17) Nilai PKG Nilai PKG (100) = 100 Nilai PKG tertinggi Berdasarkanhasilkonversikedalamskalanilaisesuaidenganperaturan tersebut,selanjutnyaditetapkansebutandanprosentaseangkakreditnya. (18) Perolehanangkakredit(bimbingandankonseling/konselor)yangdihitung berdasarkanrumusberikutini. (19) AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 Jakarta..........................................,..............(20) Guruyangdinilai Penilai KepalaSekolah (........................(21)) (..........................(22)) (.............................(23))

135

PETUNJUKPENGISIANFORMAT2D NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK pengangkatansebagaiguru. 2. (2) TulislahNomorIndukPegawaiguruyangbersangkutan. 3. (3) TulislahtempatdantanggallahirguruyangdinilaisesuaiSKpengangkatan 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitung mulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkanSKpengangkatansebagaiguru. 6. (6) Tulislahsejakkapan(berapatahundanberapabulan)gurutersebutbertugas. 7. (7) TulislahjeniskelamindariguruyangdinilaidengancaramencorethurufLatauP. 8. (8) Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya. 9. (9) Tulislahprogramkeahlianyangdiampuguruyangdinilai. 10. (10) Tulislahnamainstansiatausekolahguruyangdinilai. 11. (11) Tuliskannomordanfaxsekolah(jikaada). 12. (12) Tuliskankelurahandimanasekolah/madrasahberlokasi. 13. (13) Tuliskankecamatandimanasekolah/madrasahberlokasi. 14. (14) Tuliskankelurahandimanasekolah/madrasahberlokasi. 15. (15) Tuliskanprovinsidimanasekolah/madrasahberlokasi. 16 (16) DiisidenganhasilPKGURUsesuaidenganhasilPKGURUpadaformatrekapPK GURU. 17 (17) DiisidenganPK(GURU)yangtelahdikonversikankedalamskala0100sesuai denganPermennegPANdanRBNo.16Tahun2009melaluiperhitungandengan menggunakanrumustersebut. 18 (18) Diisi dengan sebutan dan prosentase angka kredit dari hasil PK GURU yang telah dikonversikan dalam skala 0 100 sebagaimana ditetapkan dalam Permenneg PANdanRBNo.16Tahun2009. 19 (19) diisikan dengan perolehan angka kredit per tahun yang dihitung berdasarkan rumus sistem paket tersebut sesuai permen tersebut. (Ingat JM adalah jumlah konseli yang dibimbing oleh guru BK/Konselor dan JWM adalah jumlah konseli yangwajibdibimbingsesuaiperaturan. RumusAngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK 4 20 (20) Tulislahtempatdantanggaldilakukannyapengisianformatini. 21 (21) Isilahdengantandatangandannamaguruyangdinilaisebagaibukti bahwaguru telahmengetahuidansetujudenganestimasihasilnilaiyangdiperoleh. 22 (22) Isilahdengantandatangandannamapenilai 23 (23) Isilah dengan tanda tangan dan nama kepala sekolah tempat guru bekerja, sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasil nilaikinerjaguru.

136

LAMPIRAN3 INSTRUMENPKGURU DENGANTUGASTAMBAHANYANGRELEVAN DENGANFUNGSISEKOLAH/MADRASAH

137

Lampiran3A

INSTRUMENPENILAIANKINERJAKEPALASEKOLAH(IPPKS) A. PETUNJUKPENILAIAN 1. Penilaian kinerja kepala sekolah merupakan penilaian berbasis bukti dan menggunakanpendekatan360. 2. Buktibuktidapatberupadata,dokumen,kondisilingkunganfisiksekolah,perilakudan budaya dan lainlain yang dapat diidentifikasi oleh penilaian melalui pengkajian, pengamatan,dan penggalian informasidari pihakpihak yangterkait di sekolah seperti guru,pegawai,komitesekolah,danpesertadidik. 3. Penilai harus mencatat semua bukti yang teridentifikasi pada tempat yang disediakan padamasingmasingkriteriapenilaian.Buktibuktiyangdimaksuddapatberupa: a. Buktiyangteramati(tangibleevidences)seperti: Dokumendokumentertulis. Kondisi srana/prasarana (hardware dan/atau software) dan lingkungan sekolah. Foto,gambar,slide,video. Produkproduksiswa. b. Buktiyangtakteramati(intangibleevidences)seperti Sikapdanperilakukepalasekolah. Budayadaniklimsekolah. Buktibuktiinidapatdiperolehmelaluipengamatan,wawancaradenganpemangku kepentingan pendidikan (guru, komite, siswa, mitra dunia usaha dan dunia industri). 4. Penilaian dilakukan dengan cara memberikan skor pada masingmasing kriteria berdasarkankelengkapandankeabsahanbuktiyangrelevendanteridentifikasi. 5. Skor penilaian dinyatakan dengan angka 4, 3, 2, atau 1 dengan ketentuan sebagai berikut: a. Skor 4 diberikan apabila kepala sekolah mampu menunjukkan buktibukti yang lengkap dan sangat meyakinkan bahwa kepala sekolah yang bersangkutan berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai. b. Skor 3 diberikan apabila kepala sekolah mampu menunjukkan buktibukti yang lengkap dan cukup meyakinkan bahwa kepala sekolah yang bersangkutan berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai. c. Skor 2 diberikan apabila kepala sekolah menunjukkan buktibukti yang kurang lengkap dan cukup meyakinkan bahwa yang bersangkutan berkinerja sesuai denganmasingmasingkriteriakomponenyangdinilai. d. Skor 1 diberikan apabila ditemukan bukti yang sangat terbatas dan kurang meyakinkanatautidakditemukanbuktibahwakepalasekolahyangbersangkutan berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai.

138

6. Hasil Penilaian dinyatakan rentang nilai 1 sampai dengan 100 yang dibedakan menjadi empat kategori penilaian yaitu Amat Baik, Baik, Cukup, Sedang dan Kurang denganketentuansebagaiberikut: NKKS Kategori

91100 AmatBaik 7690 Baik 6175 Cukup 5160 Sedang 50 Kurang Untuk menentukan nilai akhir diperlukan konversi dari Skor penilaian yang memiliki rentangan 6 sampai dengan 24 menjadi Nilai Kinerja Kepala Sekolah/Madrasah (NKKS/M) dengan rentangan 25 sampai dengan 100 dengan menggunakan rumus sebagaiberikut: NKKS = Total Skor Rata-Rata/ 24 x 100

139

B. FORMATIDENTITASDIRI IDENTITASKEPALASEKOLAHYANGDINILAI a. Nama :........................(1) NIP/No.SeriKarpeg :/......................(2) Tempat/TanggalLahir :/.........................(3) Pangkat/Jabatan/Golongan :........................(4) TMTsebagaiguru/Kepala Sekolah :/........................(5) NUPTK/NRG :/........................(6) MasaKerja :Tahun......Bulan(7) JenisKelamin : L/P(8) PendidikanTerakhir/Spesialisasi :..........................(9) ProgramKeahlianyangdiampu :........................(10) b. NamaInstansi/Sekolah :.........................(11) Telp/Fax :.........................(12) Kelurahan :........................(13) Kecamatan :.........................(14) Kota/Kabupaten :........................(15) Provinsi :.......................(16) IDENTITASPENILAI a. Nama :........................(17) NIP :........................(18) b. SKPenugasan(Jikaada) Nomor :........................(19) Tanggal :........................(20) Berlakusampaidengan :........................(21) .,,.........(22) Penilai, KepalaSekolahyangdinilai, ................................. ..(23) NIP....... NIP....

140


C. FORMATPENILAIANKINERJA 1. Kompetensi :KepribadiandanSosial(PKKS1) BUKTIYANG SKOR KRITERIA TERIDENTIFIKASI(24) (25) 1. Berakhlakmulia,mengembangkanbudaya 1234 dantradisiakhlakmulia,danmenjadi teladanakhlakmuliabagikomunitasdi sekolah/madrasah. 2. Melaksanakantugaspokokdanfungsi 1234 sebagaikepalasekolahdenganpenuh kejujuran,ketulusan,komitmen,dan integritas. 3. Bersikapterbukadalammelaksanakantugas 1234 pokokdanfungsisebagaikepala sekolah/madrasah. 4. Mengendalikandiridalammenghadapi 1234 masalahdantantangansebagaikepala sekolah/madrasah. 5. Berpartisipasidalamkegiatansosial 1234 kemasyarakatan. 6. Tanggapdanpeduliterhadapkepentingan 1234 orangataukelompoklain. 7. Mengembangkandanmengelolahubungan 1234 sekolah/madrasahdenganpihaklaindiluar sekolahdalamrangkamendapatkan dukunganide,sumberbelajar,dan pembiayaansekolah/madrasah. JumlahSkor (26) SKORRATARATA=JUMLAHSKOR:7= (27) DeskripsiKinerjayangTelahDilakukan:(28)

141

2. Kompetensi

:KepemimpinanPembelajaran(PKKS2) BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

KRITERIA

1. Bertindaksesuaidenganvisidanmisi 1234 sekolah/madrasah. 2. Merumuskantujuanyangmenantangdiri 1234 sendiridanoranglainuntukmencapai standardyangtinggi. 3. Mengembangkansekolah/madrasah 1234 menujuorganisasipembelajar(learning organization). 4. Menciptakanbudayadaniklim 1234 sekolah/madrasahyangkondusifdan inovatifbagipembelajaran. 5. Memegangteguhtujuansekolahdengan 1234 menjadicontohdanbertindaksebagai pemimpinpembelajaran 6. Melaksanakankepemimpinanyang 1234 inspiratif. 7. Membangunrasasalingpercayadan 1234 memfasilitasikerjasamadalamrangka untukmenciptakankolaborasiyangkuat diantarawargasekolah/madrasah 8. Bekerjakerasuntukmencapaikeberhasilan 1234 sekolah/madrasahsebagaiorganisasi pembelajaryangefektif. 9. Mengembangankurikulumdankegiatan 1234 pembelajaransesuaidenganvisi,misi,dan tujuansekolah. 10. Mengelolapesertadidikdalamrangka 1234 pengembangankapasitasnyasecara optimal. JumlahSkor (26) SKORRATARATA=JUMLAHSKOR:10= (27) DeskripsiKinerjayangTelahDilakukan:(28)

142

3. Kompetensi

:PengembanganSekolah(PKKS3) KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Menyusunrencanapengembangan 1234 sekolah/madrasahjangkapanjang,menengah, danpendekdalamrangkamencapaivisi,misi, dantujuansekolah/madrasah. 2. Mengembangkanstrukturorganisasisekolah/ 1234 madrasahyangefektifdanefisiensesuai dengankebutuhan. 3. Melaksanakanpengembangansekolah/ 1234 madrasahsesuaidenganrencanajangka panjang,menengah,danjangkapendek sekolahmenujutercapainyavisi,misi,dan tujuansekolah. 4. Mewujudkanpeningkatankinerjasekolahyang 1234 signifikansesuaidenganvisi,misi,tujuan sekolahdanstandardnasionalpendidikan. 5. Melakukanmonitoring,evaluasi,danpelaporan 1234 pelaksanaanprogramkegiatan sekolah/madrasahdenganproseduryang tepat. 6. Merencanakandanmenindaklanjutihasil 1234 monitoring,evaluasi,danpelaporan. 7. Melaksanakanpenelitiantindakansekolah 1234 dalamrangkameningkatkankinerja sekolah/madrasah. JumlahSkor (26) SkorRataRata=JumlahSkor:7= (27) DeskripsiKinerjayangTelahDilakukan:(28)

143

4. Kompetensi

:ManajemenSumberDaya(PKKS4) KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Mengeloladanmendayagunakanpendidikdan 1234 tenagakependidikansecaraoptimal. 2. Mengeloladanmendayagunakansaranadan 1234 prasaranasekolah/madrasahsecaraoptimal untukkepentinganpembelajaran. 3. Mengelolakeuangansekolah/madrasahsesuai 1234 denganprinsipprinsipefisiensi,transparansi, danakuntabilitas. 4. Mengelolalingkungansekolahyangmenjamin 1234 keamanan,keselamatan,dankesehatan. 5. Mengelolaketatausahaansekolah/madrasah 1234 dalammendukungpencapaiantujuansekolah/ madrasah. 6. Mengelolasisteminformasisekolah/madrasah 1234 dalammendukungpenyusunanprogramdan pengambilankeputusan. 7. Mengelolalayananlayanankhusus 1234 sekolah/madrasahdalammendukungkegiatan pembelajarandankegiatanpesertadidikdi sekolah/madrasah. 8. Memanfaatkanteknologisecaraefektifdalam 1234 kegiatanpembelajarandanmanajemen sekolah/madrasah. JumlahSkor (26) SkorRataRata=JumlahSkor:8= (27) DeskripsiKinerjayangTelahDilakukan:(28)

144

5. Kompetensi

:Kewirausahaan(PKKS5) KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Menciptakaninovasiyangbermanfaatbagi 1234 pengembangansekolah/madrasah. 2. Memilikimotivasiyangkuatuntuksukses 1234 dalammelaksanakantugaspokokdan fungsinyasebagaipemimpinpembelajaran. 3. Memotivasiwargasekolahuntuksukses 1234 dalammelaksanakantugaspokokdan fungsinyamasingmasing. 4. Pantangmenyerahdanselalumencarisolusi 1234 terbaikdalammenghadapikendalayang dihadapisekolah/madrasah. 5. Menerapkannilaidanprinsipprinsip 1234 kewirausahaandalammengembangkan sekolah/madrasah. JumlahSkor (26) SkorRataRata=JumlahSkor:5= (27) DeskripsiKinerjayangTelahDilakukan:(28)

145

6. Kompetensi

:SupervisiPembelajaran(PKKS6) KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Menyusunprogramsupervisiakademikdalam 1234 rangkapeningkatanprofesionalismeguru. 2. Melaksanakansupervisiakademikterhadap 1234 gurudenganmenggunakanpendekatandan tekniksupervisiyangtepat. 3. Menilaidanmenindaklanjutikegiatansupervisi 1234 akademikdalamrangkapeningkatan profesionalismeguru. JumlahSkor (26) SkorRataRata=JumlahSkor:3= (27) DeskripsiKinerjayangTelahDilakukan:(28)

146

REKAPITULASIHASILPENILAIANKINERJAKEPALASEKOLAH No KompetensiPenilaian Kode PKKS1 PKKS2 PKKS3 PKKS4 PKKS5 PKKS6 (30) Skorratarata (29)

1. KepribadiandanSosial 2. Kepemimpinan 3. PengembanganSekolah/Madrasah 4. PengelolaanSumberDaya 5. Kewirausahaan 6. Supervisi NKKS KepalaSekolah(33) yangdinilai, Nama NIP Total

=TotalSkorRatarata/24X100=................x100=...............(31)

,(32) Penilai,(34)

Nama NIP

147

PETUNJUKPENGISIANFORMAT3A NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama Kepala Sekolah yang dinilai sesuai dengan yang tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil. 2. (2) TulislahNomorIndukPegawaiKepalaSekolahyangbersangkutan. 3. (3) TulislahtempatdantanggallahirKepalaSekolahyangdinilaisesuai SKpengangkatansebagaiPegawaiNegeriSipil. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir Kepala SekolahtersebutterhitungmulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkan SK pengangkatan sebagai Guru dan sebagai KepalaSekolah. 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala Sekolahtersebuttelahbertugassebagaiguru. 7. (7) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Registrasi Guru (NRG)setelahyangbersangkutanmemilikisertifikatpendidik. 8. (8) Tulislah jenis kelamin Kepala Sekolah yang dinilai dengan cara mencorethurufLatauP 9. (9) Tulislah kualifikasi pendidikan terakhir Kepala Sekolah beserta spesialisasinya. 10. (10) TulislahprogramkeahlianyangdiampuKepalaSekolahyangdinilai 11. (11) Tulislah nama instansi atau sekolah sebagai tempat bekerja Kepala Sekolahyangdinilai 12. (12) Cukupjelas 13. (13) Cukupjelas 14. (14) Cukupjelas 15. (15) Cukupjelas 16. (16) Cukupjelas 17. (17) Tulislahnamapenilai 18. (18) TulislahNomorIndukPenilaiyangbersangkutan 19. (19) Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala Sekolah(jikaada) 20. (20) Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala Sekolah 21. (21) Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK penugasansebagaipenilaikinerjaKepalaSekolah 22. (22) Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri 23. (23) Bubuhkan tanda tangan, nama jelas, dan NIP penilai dan Kepala Sekolahyangdinilai.

148

NO 24.

NOMOR KODE (24)

URAIAN Tulislah bukti yang relevan dan teridentifikasi, sesuai masing masingkriteriapadasetiapkompetensiyangdinilaidalampenilaian KepalaSekolah. Berikan skor untuk masingmasing kriteria berdasarkan bukti yang relevanyangteridentifikasi. Jumlahkan semua skor kriteria pada kompetensi dalam penilaian kinerjaKepalaSekolah. Hitunglah skor ratarata setiap kompetensi hasil penilaian kinerja Kepala Sekolah dengan cara membagi jumlah skor dengan banyaknyakriteriakomponenyangbersangkutan. Tulislahdeskripsikinerjayangtelahdilakukankepalasekolahuntuk masingmasing kompetensi berdasarkan kriteria, bukti fisik yang teramati,danskorrataratakomponentersebut. Pindahkan skor ratarata keenam kompetensi dalam penilaian kinerja Kepala Sekolah ke dalam format rekapitulasi hasil penilaian kinerjaKepalaSekolah. JumlahkansemuaskorkomponenpenilaiankinerjaKepalaSekolah Hitunglah nilai NKKS dengan cara membagi jumlah semua skor komponen penilaian kinerja Kepala Sekolah dengan 24 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai (bilangan)dalamduadesimal. Tulislah nama kota, tanggal, bulan, dan tahun pengisian format rekapitulasihasilpenilaiankinerjaKepalaSekolah. Tulislah nama, NIP, dan bubuhkan tandatangan Kepala Sekolah yangdinilai. Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja KepalaSekolah.

25. 26. 27.

(25) (26) (27)

28.

(28)

29.

(29)

30. 31.

(30) (31)

32. 33. 34.

(32) (33) (34)

149

A. 1. 2. 3.

Lampiran3B INSTRUMENPENILAIANKINERJAWAKILKEPALASEKOLAH(IPKWKS) PETUNJUKPENILAIAN

Penilaiankinerjawakilkepalasekolahdilakukanolehkepalasekolah. Penilaiankinerjawakilkepalasekolahmerupakanpenilaianberbasisbukti. Buktibuktidapatberupadata,dokumen,kondisilingkunganfisiksekolah,perilakudan budaya dan lainlain yang dapat diidentifikasi oleh penilaian melalui pengkajian, pengamatan,dan penggalian informasidari pihakpihak yangterkait di sekolah seperti guru,pegawai,danpesertadidik. 4. Penilai harus mencatat semua bukti yang teridentifikasi pada tempat yang disediakan padamasingmasingkriteriapenilaian.Buktibuktiyangdimaksuddapatberupa: a. Buktiyangteramati(tangibleevidences)seperti: Dokumendokumentertulis Kondisi srana/prasarana (hardware dan/atau software) dan lingkungan sekolah Foto,gambar,slide,video. Produkproduksiswa b. Buktiyangtakteramati(intangibleevidences)seperti Sikapdanperilakuwakilkepalasekolah Budayadaniklimsekolah Buktibuktiinidapatdiperolehmelaluipengamatan,wawancaradenganpemangku kepentinganpendidikan(guru,siswa). 5. Penilaian dilakukan dengan cara memberikan skor pada masingmasing kriteria berdasarkankelengkapandankeabsahanbuktiyangrelevendanteridentifikasi. 6. Skor penilaian dinyatakan dengan angka 4, 3, 2, atau 1 dengan ketentuan sebagai berikut: a. Skor 4 diberikan apabila wakil kepala sekolah mampu menunjukkan buktibukti yang lengkap dan sangat meyakinkan bahwa wakil kepala sekolah yang bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang dinilai. b. Skor 3 diberikan apabila wakil kepala sekolah mampu menunjukkan buktibukti yang lengkap dan cukup meyakinkan bahwa wakil kepala sekolah yang bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang dinilai. c. Skor 2 diberikan apabila wakil kepala sekolah menunjukkan buktibukti yang kurang lengkap dan cukup meyakinkan bahwa yang bersangkutan berkinerja sesuaidenganmasingmasingkriteriakomponenyangdinilai. d. Skor 1 diberikan apabila ditemukan bukti yang sangat terbatas dan kurang meyakinkan atau tidak ditemukan bukti bahwa wakil kepala sekolah yang bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang dinilai.

150

7. Hasil Penilaian dinyatakan rentang nilai 1 sampai dengan 100 yang dibedakan menjadi empat kategori penilaian yaitu Amat Baik, Baik, Cukup, Sedang dan Kurang denganketentuansebagaiberikut: NKKS 91100 7690 6175 5160 50 Kategori AmatBaik Baik Cukup Sedang Kurang

Untuk menentukan nilai akhir diperlukan konversi dari Skor penilaian yang memiliki rentangan 5 sampai dengan 20 menjadi Nilai Kinerja Wakil Kepala Sekolah/Madrasah (NKWKS/M) dengan rentangan 20 sampai dengan 100 dengan menggunakan rumus sebagaiberikut: NKWKS = Total Skor Rata-rata/ 20 x 100

151

B. FORMATIDENTITASDIRI IDENTITASWAKILKEPALASEKOLAHYANGDINILAI a. Nama :........................(1) NIP/NomorSeriKarpeg Tempat/TanggalLahir TMTsebagaiguru/ WakilKepalaSekolah MasaKerja NUPTK/NRG JenisKelamin :/......................(5) :Tahun.........Bulan(6) :...................................................................(7) : L/P(8) Pangkat/Jabatan/Golongan :/......................(2) :/.........................(3) :.......................(4)

PendidikanTerakhir/Spesialisasi :........................(9) ProgramKeahlianyangdiampu :......................(10) b. NamaInstansi/Sekolah Telp/Fax Kelurahan Kecamatan Provinsi IDENTITASPENILAI a. Nama NIP Nomor Tanggal Penilai ................................... NIP....... (23) NIP.... :........................(17) :........................(18) :........................(19) :........................(20) :........................(21) .,,.........(22) WakilKepalaSekolahyangdinilai :......................(11) :.....................(12) :......................(13) :......................(14) :......................(15) :.....................(16)

Kota/Kabupaten

b. SKPenugasan(Jikaada)

Berlakusampaidengan

152

C. FORMATPENILAIANKOMPONENKINERJA 1. Kompetensi1 :KepribadiandanSosial(PKWKS1) KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Berakhlakmulia,mengembangkanbudaya 1234 dantradisiakhlakmulia,danmenjadi teladanakhlakmuliabagikomunitasdi sekolah/madrasah. 2. Melaksanakantugaspokokdanfungsi 1234 sebagaikepalasekolahdenganpenuh kejujuran,ketulusan,komitmen,dan integritas. 3. Bersikapterbukadalammelaksanakan 1234 tugaspokokdanfungsisebagaikepala sekolah/madrasah. 4. Mengendalikandiridalammenghadapi 1234 masalahdantantangansebagaikepala sekolah/madrasah. 5. Berpartisipasidalamkegiatansosial 1234 kemasyarakatan. 6. Tanggapdanpeduliterhadapkepentingan 1234 orangataukelompoklain. 7. Mengembangkandanmengelolahubungan 1234 sekolah/madrasahdenganpihaklaindiluar sekolahdalamrangkamendapatkan dukunganide,sumberbelajar,dan pembiayaansekolah/madrasah. JumlahSkor (26) SKORRATARATA=JUMLAHSKOR:7= (27) DeskripsiKinerjayangTelahDilakukan:(28)

153

2. Kompetensi

:Kepemimpinan(PKWKS2) BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

KRITERIA

1. Bertindaksesuaidenganvisidanmisi 1234 sekolah/madrasah. 2. Merumuskantujuanyangmenantangdiri 1234 sendiridanoranglainuntukmencapai standardyangtinggi. 3. Mengembangkansekolah/madrasahmenuju 1234 organisasipembelajaran(learning organization). 4. Menciptakanbudayadaniklim 1234 sekolah/madrasahyangkondusifdaninovatif bagipembelajaran. 5. Memegangteguhtujuansekolahdengan 1234 menjadicontohdanbertindaksebagai pemimpinpembelajaran. 6. Melaksanakankepemimpinanyanginspiratif. 1234 7. Membangunrasasalingpercayadan 1234 memfasilitasikerjasamadalamrangkauntuk menciptakankolaborasiyangkuatdiantara wargasekolah/madrasah 8. Bekerjakerasuntukmencapaikeberhasilan 1234 sekolah/madrasahsebagaiorganisasi pembelajaryangefektif. 9. Mengembangankurikulumdankegiatan 1234 pembelajaransesuaidenganvisi,misi,dan tujuansekolah. 10. Mengelolapesertadidikdalamrangka 1234 pengembangankapasitasnyasecaraoptimal. JumlahSkor (26) SKORRATARATA=JUMLAHSKOR:10= (27) DeskripsiKinerjayangTelahDilakukan:(28)

154

3. Kompetensi

:PengembanganSekolah(PKWKS3) BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

KRITERIA

1. Menyusunrencanapengembangan 1234 sekolah/madrasahjangkapanjang,menengah, danpendekdalamrangkamencapaivisi,misi, dantujuansekolah/madrasah. 2. Mengembangkanstrukturorganisasisekolah/ 1234 madrasahyangefektifdanefisiensesuaidengan kebutuhan. 3. Melaksanakanpengembangansekolah/ 1234 madrasahsesuaidenganrencanajangka panjang,menengah,danjangkapendeksekolah menujutercapainyavisi,misi,dantujuan sekolah. 4. Mewujudkanpeningkatankinerjasekolahyang 1234 signifikansesuaidenganvisi,misi,tujuan sekolahdanstandardnasionalpendidikan. 5. Melakukanmonitoring,evaluasi,danpelaporan 1234 pelaksanaanprogramkegiatan sekolah/madrasahdenganproseduryangtepat. 6. Merencanakandanmenindaklanjutihasil 1234 monitoring,evaluasi,danpelaporan. 7. Melaksanakanpenelitiantindakansekolah 1234 dalamrangkameningkatkankinerja sekolah/madrasah. JumlahSkor (26) SkorRataRata=JumlahSkor:7= (27) DeskripsiKinerjayangTelahDilakukan:(28)

155

4. Kompetensi

:Kewirausahaan(PKWKS4) BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

KRITERIA

1. Menciptakaninovasiyangbermanfaatbagi 1234 pengembangansekolah/madrasah. 2. Memilikimotivasiyangkuatuntuksuksesdalam 1234 melaksanakantugaspokokdanfungsinyasebagai pemimpinpembelajaran. 3. Memotivasiwargasekolahuntuksuksesdalam 1234 melaksanakantugaspokokdanfungsinyamasing masing. 4. Pantangmenyerahdanselalumencarisolusi 1234 terbaikdalammenghadapikendalayangdihadapi sekolah/madrasah. 5. Menerapkannilaidanprinsipprinsip 1234 kewirausahaandalammengembangkan sekolah/madrasah. JumlahSkor (26) SkorRataRata=JumlahSkor:5= (27) DeskripsiKinerjayangTelahDilakukan:(28)

156

5. Kompetensi :BidangTugasWakasek(PKWKS5) a. WakasekBidangAkademik KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Mengeloladanmendayagunakanpendidikdan 1234 tenagakependidikansecaraoptimal. 2. Memanfaatkanteknologisecaraefektifdalam 1234 kegiatanpembelajaran. 3. Menyusunprogramsupervisiakademikdalam 1234 rangkapeningkatanprofesionalismeguru. 4. Melaksanakansupervisiakademikterhadapguru 1234 denganmenggunakanpendekatandanteknik supervisiyangtepat. 5. Menilaidanmenindaklanjutikegiatansupervisi 1234 akademikdalamrangkapeningkatan profesionalismeguru. JumlahSkor (26) SkorRataRata=JumlahSkor:5= (27) DeskripsiKinerjayangTelahDilakukan:(28)

157

b. Wakasekbidangkesiswaan KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Mengelolapesertadidikdalamrangka 1234 pengembangankapasitasnyasecaraoptimal sesuaiminatdanbakatmasingmasing. 2. Mengelolalayananlayanankhusus 1234 sekolah/madrasahdalammendukung kegiatanpembelajarandankegiatanpeserta didikdisekolah/madrasah. 3. Melaksanakanbimbingankegiatankegiatan 1234 kesiswaan. 4. Menegakkandisiplindantatatertibsiswa. 1234 JumlahSkor (26) SkorRataRata=JumlahSkor:4= (27) DeskripsiKinerjayangTelahDilakukan:(28)

158

c. WakasekbidangSaranadanPrasarana KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Mengeloladanmendayagunakansaranadan 1234 prasaranasekolah/madrasahsecaraoptimaluntuk kepentinganpembelajaran. 2. Mengelolalingkungansekolahyangmenjamin 1234 keamanan,keselamatan,dankesehatan. 3. Mengelolasisteminformasisekolah/madrasah 1234 dalammendukungpenyusunanprogramdan pengambilankeputusan. JumlahSkor (26) SkorRataRata=JumlahSkor:3= (27) DeskripsiKinerjayangTelahDilakukan:(28)

159

d. WakasekbidangHumas KRITERIA BUKTIYANG TERIDENTIFIKASI (24) SKOR (25)

1. Membangunjejaringkerjasamadenganpihak 1234 luar. 2. Mengelolahubungansekolah/madrasah 1234 denganpihaklaindiluarsekolahdalamrangka mendapatkandukunganide,sumberbelajar, danpembiayaansekolah/madrasah. 3. Mempublisasikankebijakan,programsekolah 1234 danprestasisekolahpadapihakdiluarsekolah. JumlahSkor (26) SkorRataRata=JumlahSkor:3= (27) DeskripsiKinerjayangTelahDilakukan:(28)

160

D. REKAPITULASIHASILPENILAIANKINERJAWAKILKEPALASEKOLAH No KomponenPenilaian Kode PKWKS1 PKWKS2 PKWKS3 PKWKS4 PKWKS5 Total (30) SkorRatarata (29)

1. KepribadiandanSosial 2. Kepemimpinan 3. PengembanganSekolah/Madrasah 4. Kewirausahaan 5. BidangTugas

NKWKS/M=TotalSkorRatarata/20X100=................x100=..........................(31) WakilKepalaSekolah(33) yangdinilai, Nama NIP ,(32) Penilai,(34)

Nama NIP

161

PETUNJUKPENGISIANFORMAT3B NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama Wakil Kepala Sekolah yang dinilai sesuai dengan yang tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil. 2. (2) Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang bersangkutan. 3. (3) Tulislah tempat dan tanggal lahir Wakil Kepala Sekolah yang dinilai sesuaiSKpengangkatansebagaiPegawaiNegeriSipil. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir Wakil Kepala SekolahtersebutterhitungmulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkan SK pengangkatan sebagai Guru dan SK sebagai WakilKepalaSekolah. 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) Wakil Kepala Sekolahtersebuttelahbertugassebagaiguru. 7. (7) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Restgrasi Guru (NRG) setelah yang bersangkutanmemilikisertifikatpendidik. 8. (8) Tulislah jenis kelamin Wakil Kepala Sekolah yang dinilai dengan cara mencorethurufLatauP. 9. (9) Tulislah kualifikasi pendidikan terakhir Wakil Kepala Sekolah beserta spesialisasinya. 9. (10) Tulislah program keahlian yang diampu Wakil Kepala Sekolah yang dinilai. 11. (11) Tulislah nama instansi atau sekolah sebagai tempat bekerja Wakil KepalaSekolahyangdinilai. 12. (12) Cukupjelas. 13. (13) Cukupjelas. 14. (14) Cukupjelas. 15. (15) Cukupjelas. 16. (16) Cukupjelas. 17. (17) Tulislahnamapenilai. 18. (18) TulislahNomorIndukPenilaiyangbersangkutan. 19. (19) Tulislah Nomor SK penugasan sebagai penilai kinerja Wakil Kepala Sekolah(jikaada). 20. (20) Tulislah tanggal SK penugasan sebagai penilai kinerja Wakil Kepala Sekolah. 21. (21) Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK penugasansebagaipenilaikinerjaWakilKepalaSekolah. 22. (22) Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri

162

NO 23. 24.

NOMOR KODE (23) (24)

URAIAN Bubuhkan tandatangan, nama jelas, dan NIP penilai dan Wakil Kepala Sekolahyangdinilai. Tulislah bukti yang relevan dan teridentifikasi sesuai masingmasing kriteria pada setiap kompetensi yang dinilai dalam penilaian Wakil KepalaSekolah. Berikan skor untuk masingmasing kriteria berdasarkan bukti yang relevanyangteridentifikasi. Jumlahkan semua skor kriteria pada kompetensi dalam penilaian kinerjaWakilKepalaSekolah. Hitunglah skor ratarata kompetensi yang dinilai dalam penilaian kinerja Wakil Kepala Sekolah dengan cara membagi jumlah skor denganbanyaknyakriteriakomponenyangbersangkutan. Tulislah deskripsi kinerja yang telah dilakukan untuk masingmasing kompetensi berdasarkan kriteria, bukti fisik yang teramati, dan skor rataratauntukkompetensitersebut. Pindahkan skor ratarata kelima kompetensi dalam penilaian kinerja keformatrekapitulasihasilpenilaiankinerjaWakilKepalaSekolah. Jumlahkan semua skor kompetensi dlam penilaian kinerja Wakil KepalaSekolah. Hitunglah nilai NKWKS dengan cara membagi jumlah semua skor kompetensi dalam penilaian kinerja Wakil Kepala Sekolah dengan 20 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai (bilangan)dalamduadesimal. Tulislah nama kota, tanggal, bulan, dan tahun pengisian format rekapitulasihasilpenilaiankinerjaWakilKepalaSekolah. Tulislah nama, NIP, dan bubuhkan tandatangan Wakil Kepala Sekolah yangdinilai. Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja Wakil KepalaSekolah.

25. 26. 27.

(25) (26) (27)

28.

(28)

29. 30. 31.

(29) (30) (31)

32. 33. 34.

(32) (33) (34)

163

Lampiran3C INSTRUMENPENILAIANKINERJAKEPALAPERPUSTAKAAN(IPKKPS/M) A. PETUNJUKPENILAIAN 1. Penilaipenilaiankinerjaguruyangditugaskansebagaikepalaperpustakaansekolah terdiri atas Kepala sekolah atau Wakil Kepala sekolah Bidang sarana/prasarana atauWakilKepalasekolahlingkupsekolahyangbersangkutan. 2. Petugas penilai adalah orang yang kompeten yang telah ditugaskan dengan surat tugas dari kepala sekolah dan telah mengikuti pembekalan penilaian kinerja guru yangditugaskansebagaikepalaperpustakaansekolah. 3. Setiap penilai wajib: (1) memberikan penilaian, secara obyektif berbasis bukti, (2) berkoordinasidenganpihakterkait(gurusebagaikepalaperpustakaansekolah),(3) memberikan komentar dan rekomendasi, dan menghitung hasil penilaian dan membuatlaporan. 4. Pengumpulan data dan informasi dilakukan melalui: (1) Observasi. Dilakukan dengan cara mengamati lingkungan perpustakaan baik secara fisik maupun nonfisik (persepsi pengguna) perpustakaan sekolah; (2) Wawancara. Dilakukan dengan mewawancarai guru yang diberi tugas sebagai kepala perpustakaan sekolah serta sumbersumber yang relevan, antara lain kepala sekolah, wakasek, guru, siswa, dan staf tata usaha; dan (3) Dokumen. Dilakukan dengan cara menelaah dokumendokumen yang ada kaitannya dengan kegiatan yang dilakukan kepalaperpustakaansekolah. 5. Perhitungan skor kinerja guru yang diberi tugas sebagai kepala perpustakaan sekolah terdiri atas 6 (enam) dimensi kinerja dengan 10 (sepuluh) jenis kegiatan yang bersumber dari standar kompetensi kepala perpustakaan sekolah (Permendiknas No. 25 Tahun 2008). Berdasarkan indikatorindikator yang dinilai padajeniskegiatan,penilaimemberikanskordenganrentangan1sampai4. 6. Rumus Perhitungan Penilaian Kinerja Guru yang diberi tugas sebagai Kepala PerpustakaanSekolahadalahsebagaiberikut. perolehanSkor NA=x100 (Indikatoryangdinilai)(4) Keterangan: NA =NilaiAkhirKinerja 7. Nilai akhir (NA) yang telah dihitung, maka kinerja guru dengan tugas tambahan sebagaikepalaperpustakaansekolahdapatdiklasifikasikansebagaiberikut: No Klasifikasi NilaiAkhirKinerja 1 Sangatbaik 91100 2 Baik 7690 3 Cukup 6175 4 Sedang 5160 5 Kurang 0 50

164

8. Nilai akhir (NA) yang telah diklasifikasikan dalam 5 (lima) diatas, kemudian dikonversikankepadaangkakredityangtelahditentukandengancaraperhitungan sebagaiberikut: a. Nilai sangat baik diberikan angka kredit 125% dari jumlah angka kredit yang dicapaisetiaptahun. b. Nilai baik diberikan angka kredit 100% dari jumlah angka kredit yang dicapai setiaptahun. c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang dicapaisetiaptahun. d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit yangdicapaisetiaptahun. e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit yangdicapaisetiaptahun.

165

B. FORMATIDENTITASDIRI IDENTITASKEPALAPERPUSTAKAANYANGDINILAI a. Nama :....................(1) :.....................(2) :/......................(3) :.....................(4) :/....................(5) :.......Tahun....Bulan(6) :...................................../......................(7) : L/P(8) NIP/NomorSeriKarpeg Tempat/TanggalLahir TMTsebagaiguru/ KepalaPerpustakaan MasaKerja NUPTK/NRG JenisKelamin Pangkat/Jabatan/Golongan

PendidikanTerakhir/Spesialisasi :.......................(9) b. NamaInstansi/Sekolah Telp/Fax Kelurahan Kecamatan Provinsi IDENTITASPENILAI a. Nama NIP :........................(16) :........................(17) :........................(18) :........................(19) :........................(20) .,,.......(21) :.......................(10) :.......................(11) :.......................(12) :.......................(13) :.......................(14) :......................(15)

Kota/Kabupaten

b. SKPenugasan(Jikaada) Nomer Tanggal ................................... NIP....... NIP.... (22) Penilai KepalaPerpustakaanyangdinilai

Berlakusampaidengan

166

C. FORMATPENILAIANKOMPONENKINERJA 1. Kompetensi:Merencanakankegiatanperpustakaansekolah/madrasah BuktiYang Skor Kriteria Terindentifikasi (24) (23) 1. Merencanakanprogram 1 2 3 4 pengembangankoleksi. 2. Merencanakanpengembangan 1 2 3 4 saranadanprasarana. 3. Merencanakanpengembangan 1 2 3 4 SDMtenagaperpustakaan. 4. Merencanakananggaran. 1 2 3 4 5. Merencanakanprogram 1 2 3 4 pengembangankoleksi perpustakaan. 6. Merencanakanprogrampromosi 1 2 3 4 perpustakaan. 7. Merencanakanpengembangan 1 2 3 4 programkualifikasitenaga perpustakaanperpustakaan. 8. Merencanakanpengembangan 1 2 3 4 programkompetensitenaga perpustakaanperpustakaan. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:8= (26) DeskripsiKinerjayangTelahDilakukan (27)

167

2. Kompetensi:Melaksanakanprogramperpustakaansekolah/madrasah Kriteria BuktiYang Teridentifikasi (23) Skor (24)

1. Melaksanakanprogram 1 2 3 4 pengembangankoleksi. 2. Melaksanakanpengembangan 1 2 3 4 saranadanprasarana. 3. Melaksanakanpengembangan 1 2 3 4 SDMtenagaperpustakaan. 4. Merealisasikananggaran 1 2 3 4 sesuaidenganprogram. 5. Menginventarisasibukubuku 1 2 3 4 perpustakaan. 6. Mengawasikeluarmasuknya 1 2 3 4 bukudaripeminjam. 7. Mengoptimalkanpembuatan 1 2 3 4 catalog. 8. Mengoptimalkanpenyusunan 1 2 3 4 ataupenempatanbukubuku sesuaidenganperuntukannya. 9. Mendatapengunjungdan 1 2 3 4 penggunaperpustakaandalam bentukgrafik. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:9=(26) DeskripsiKinerjayangTelahDilakukan(27)

168

3. Kompetensi:Mengevaluasiprogramperpustakaansekolah/madrasah BuktiYang Skor Krtiteria Teridentifikasi (24) (23) 1. Mengevaluasiprogram 1 2 3 4 pengembangankoleksi. 2. Mengevaluasipengembangan 1 2 3 4 saranadanprasarana. 3. Mengevaluasipengembangan 1 2 3 4 SDMtenagaperpustakaan. 4. Mengevaluasianggaransesuai 1 2 3 4 denganprogram. 5. Mengevaluasiisirbukubuku 1 2 3 4 perpustakaan. 6. Mengevaluasikeluarmasuknya 1 2 3 4 bukudaripeminjam. 7. Mengevaluasipembuatan 1 2 3 4 katalog. 8. Mengevaluasipenyusunanatau 1 2 3 4 penempatanbukubukusesuai denganperuntukannya. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:8= (26) DeskripsiKinerjayangTelahDilakukan(27)

169

4. Kompetensi:Mengembangkankoleksiperpustakaansekolah/madrasah BuktiYang Skor Krieteria Teridentifikasi (24) (23) 1. MenyusunPengembanganKoleksi 1 2 3 4 (CollectionDevelopmentPolicy). 2. Menggunakanberbagaialatbantu 1 2 3 4 seleksiuntukpemilihanbahan perpustakaan. 3. Melakukansurveykebutuhankoleksi 1 2 3 4 penggunaperpustakaan. 4. Menyeleksikoleksisesuaidengan 1 2 3 4 KebijakanPengembanganKoleksi 5. Mengkoordinasipemilihanbahan 1 2 3 4 perpustakaanbekerjasamadengan tenagapendidik/gurubidangstudi. 6. Memilihkoleksiyangberagamyang 1 2 3 4 memenuhikebutuhankurikulum. 7. Melakukanpengadaanbahan 1 2 3 4 perpustakaan. 8. Mendayagunakanteknologiinformasi 1 2 3 4 untukkeperluanperawatanbahan perpustakaan. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:8= (26) DeskripsiKinerjayangTelahDilakukan(27)

170

5. Kompetensi:Mengorganisasilayananjasainformasiperpustakaan BuktiYang Skor Kriteria Teridentifikasi (24) (23) 1. Mengorganisasipenyusunandeskripsi 1 2 3 4 bibliografis(pengkatalogan)sesuai denganstandarAACR(Anglo AmericanCatalogingRules). 2. Mengorganisasipenentuanklasifikasi 1 2 3 4 menggunakanDeweyDecimal Classification. 3. Mengorganisasipenentuantajuk 1 2 3 4 subyek. 4. Mengorganisasipengelolaandata 1 2 3 4 bibliografis. 5. Mengorganisasipemanfaatan 1 2 3 4 teknologiinformasidankomunikasi untukpengorganisasiandan penelusuraninformasi. 6. Mengorganisasipenyusunanprogram 1 2 3 4 layananjasainformasi. 7. Mengorganisasipenyelenggaraan 1 2 3 4 layananjasasirkulasi. 8. Mengorganisasibimbingan 1 2 3 4 penggunaanperpustakaanbagi penggunaperpustakaan(User instruction). JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:8= (26) DeskripsiKinerjayangTelahDilakukan(27)

171

6. Kompetensi:Menerapkanteknologiinformasidankomunikasi BuktiYang Skor Kriteria Teridentifikasi (24) (23) 1. Melakukananalisiskebutuhaninformasi 1 2 3 4 penggunaperpustakaan. 2. Melaksanakanpenerapanteknologi 1 2 3 4 informasidalampengelolaan perpustakaan. 3. Membimbingpenggunaperpustakaan 1 2 3 4 dalampemanfaatanteknologiinformasi dalammemfasilitasiprosesbelajar mengajar. 4. Membantupenggunaperpustakaan 1 2 3 4 dalammemanfaatkanteknologi informasidankomunikasi(internet). JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:4 (26) DeskripsiKinerjayangTelahDilakukan(27)

172

7. Komponen:Mempromosikanperpustakaan&literasiinformasi BuktiYang SKOR Kriteria Teridentifikasi (24) (23) 1. Mengidentifikasikemampuandasar 1 2 3 4 literasiinformasipengguna perpustakaansekolah. 2. Menyusunpanduanmateri 1 2 3 4 bimbinganliterasiinformasisesuai dengankebutuhanpengguna. 3. Membimbingpenggunamencapai 1 2 3 4 kemampuanliterasiinformasi. 4. Mempromosikankegiatanminat 1 2 3 4 bacakomunitassekolah/madrasah. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan(27)

173

8. Kompetensi: Mengembangkan kegiatan perpustakaan sebagai sumber belajar kependidikan BuktiYang Skor Kriteria Teridentifikasi (24) (23) 1. Mengembangkanvisidanmisi 1 2 3 4 perpustakaansekolahberdasarkan tujuandanfungsi sekolah/madrasahdalamkonteks pendidikannasional. 2. Mengembangkanprogram 1 2 3 4 perpustakaansekolahdalam mendukungpelaksanaan kurikulum. 3. Mengembangkanpedoman 1 2 3 4 perpustakaansebagaisumber belajar. 4. Mengembangkanpedomanbelajar 1 2 3 4 mandiri. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan(27)

174

9. Kompetensi:Memilikiintegritasdanetoskerja BuktiYang Skor Kriteria Teridentifikasi (24) (23) 1. Kedisiplinan. 1 2 3 4 2. Kerapian. 1 2 3 4 3. Kesopanan/Kesantunan/ 1 2 3 4 Keramahan. 4. Kepedulian. 1 2 3 4 5. Berinteraksidengankomunitas 1 2 3 4 sekolah/madrasah. 6. Bekerjasamadengangurudalam 1 2 3 4 mengembangkanpembelajaran sekolah/madrasah. 7. Membangunkomunikasidengan 1 2 3 4 komunitassekolah/madrasah. 8. Menjalinkerjasamainternaldan 1 2 3 4 eksternalperpustakaansekolah. JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:8= (26) DeskripsiKinerjayangTelahDilakukan(27)

175

10. Kompetensi:Mengembangkanprofesionalitaskepustakawanan BuktiYang Skor Kriteria Teridentifikasi (24) (23) 1. Membuatkaryatulisdibidangilmu 1 2 3 4 perpustakaandaninformasi. 2. Meresensi/meresumebuku. 1 2 3 4 3. Membuatindeks. 1 2 3 4 4. Membuatbibliografi. 1 2 3 4 JUMLAHSKOR (25) SKORRATARATA=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan(27)

176

D. REKAPITULASIHASILPENILAIANKINERJAKEPALAPERPUSTAKAAN KOMPETENSI 1 2 3 4 5 6 7 8

SKOR (28)

Merencanakanprogramperpustakaansekolah/madrasah. Melaksanakanprogramperpustakaansekolah/madrasah. Mengevaluasiprogramperpustakaansekolah/madrasah. Gembangkankoleksiperpustakaansekolah/madrasah. Mengorganisasilayananjasainformasiperpustakaan. Menerapkanteknologiinformasidankomunikasi. Mempromosikanperpustakaan&literasiinformasi. Mengembangkankegiatanperpustakaansebagaisumber belajarkependidikan. 9 Memilikiintegritasdanetoskerja. 10 Mengembangkanprofesionalitaskepustakawanan. JUMLAHSKOR (29) NilaiAkhir=JumlahSkor/40X100=................x.........................(30) KepalaPerpustakaan(32)Penilai(33) yangdinilai, Nama Nama NIP NIP ,(31) KepalaSekolah(34)

Nama NIP

177

PETUNJUKPENGISIANFORMAT3C NOMOR NO URAIAN KODE 1 2 3 1. (1) TulislahnamaKepalaPerpustakaanyangdinilaisesuaidenganyang tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil. 2. (2) Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang bersangkutan. 3. (3) Tulislah tempat dan tanggal lahir Kepala Perpustakaan yang dinilai sesuaiSKpengangkatansebagaiPegawaiNegeriSipil. 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir PNS tersebutterhitungmulaitanggalberlakunyaSK. 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkan SK pengangkatan sebagai guru dan SK sebagaiKepalaPerpustakaan. 6. (6) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Restgrasi Guru (NRG)setelahyangbersangkutanmemilikisertifikatpendidik. 7. (7) Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala PerpustakaantersebuttelahbekerjasebagaiKepalaPerpustakaan 8. (8) TulislahjeniskelaminKepalaPerpustakaanyangdinilaidengancara mencorethurufLatauP. 9. (9) Tulislah kualifikasi pendidikan terakhir Kepala Perpustakaan besertaspesialisasinya. 10. (10) Tulislah nama instansi atau sekolah sebagai tempat bekerja Kepala Perpustakaanyangdinilai. 11. (11) Cukupjelas. 12. (12) Cukupjelas. 13. (13) Cukupjelas. 14. (14) Cukupjelas. 15. (15) Cukupjelas. 16. (16) Tulislahnamapenilai. 17. (17) TulislahNomorIndukPenilaiyangbersangkutan. 18. (18) Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala Perpustakaan(jikaada). 19. (19) Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala Perpustakaan. 20. (20) Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK penugasansebagaipenilaikinerjaKepalaPerpustakaan. 21. (21) Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri. 22. (22) Bubuhkan tandatangan, nama jelas, dan NIP penilai dan Kepala Perpustakaanyangdinilai.

178

NO 23.

NOMOR KODE (23)

URAIAN Tulislahbuktiyangrelevandanteridentifikasisesuaimasingmasing kriteriapadasetiapkompetensiyangdinilaidalampenilaianKepala Perpustakaan. Berikan skor untuk masingmasing kriteria berdasarkan bukti yang relevanyangteridentifikasi. Jumlahkan semua skor kriteria pada kompetensi dalam penilaian kinerjaKepalaPerpustakaan. HitunglahskorrataratakompetensidalampenilaiankinerjaKepala Perpustakaan dengan cara membagi jumlah skor dengan banyaknyakriteriakomponenyangbersangkutan. Tulislahdeskripsikinerjayangtelahdilakukanuntukmasingmasing kompetensiberdasarkankriteria,buktifisikyangteramati,danskor rataratakompetensitersebut. Pindahkan skor ratarata kesepuluh kompetensi yang dinilai dalam penilaian kinerja ke dalam format rekapitulasi hasil penilaian kinerjaKepalaPerpustakaan. Jumlahkan semua skor kompetensi dalam penilaian kinerja Kepala Perpustakaan. HitunglahnilaiNilaiAkhirdengancaramembagijumlahsemuaskor kompetensi dalam penilaian kinerja Kepala Perpustakaan dengan 40 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai(bilangan)dalamduadesimal. Tulislah nama kota, tanggal, bulan, dan tahun pengisian format rekapitulasihasilpenilaiankinerjaKepalaPerpustakaan. Tulislah nama, NIP, dan bubuhkan tandatangan Kepala Perpustakaanyangdinilai. Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja KepalaPerpustakaan. Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

24. 25. 26.

(24) (25) (26)

27.

(27)

28.

(28)

29. 30.

(29) (30)

31. 32. 33. 34.

(31) (32) (33) (34)

179

KINERJAKEPALAPERPUSTAKAAN FormatPersetujuanHasilPenilaianKinerjaKepalaPerpustakaan HASILPENILAIANKINERJAGURUYANGBERTUGASSEBAGAIKEPALAPERPUSTAKAAN SEKOLAH 1 Nama : (1) : /(2) 2 NIP/Karpeg Tempat,TanggalLahir : (3) PangkatGolongan/Golongan : (4) JabatanFungsionalGuru : (5) JenisKelamin : (6) MasaKerjasebagaiguru : (7) MasaKerjaKepalaPerpustakaan : (8) PendidikanTerakhir : (9) PelatihanBidangPerpustakaan : (10) NamaSekolah : (11) : Telp/Fax : Kelurahan : Kecamatan : Kota/Kabupaten : (12) Provinsi NUPTKdanNRG : /(13) PeriodePenilaian : sampai PERSETUJUAN(14) (PersetujuaniniharusditandatanganiolehPenilaidanGuruyangdinilai) PenilaidanguruyangdinilaimenyatakantelahmembacadanmemahamisemuaIndikator yang ditulis/dilaporkan dalam form ini dan menyatakan: SETUJU/TIDAK SETUJU (coret yangbukanpilihan) NamaPenilai (15a) NamaKepala (16a) Perpustakaan TandaTangan (15b) TandaTangan (16b) Tanggal (15c) Tanggal (16c) 3 4 5 6 7 8 9 10 11 12 13

180

PETUNJUKPENGISIANFORMATPERSETUJUANHASILPENILAIANKINERJA KEPALAPERPUSTAKAAN
NO 1 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. NOMOR KODE 2 (1) URAIAN

13. 14.

15. 16.

3 Tulislah nama Kepala Perpustakaan yang dinilai sesuai dengan yang tercantumdalamSKpengangkatansebagaiKepalaPerpustakaan (2) Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang bersangkutan (3) Tulislah tempat dan tanggal lahir Kepala Perpustakaan yang dinilai sesuaiSKpengangkatansebagaiKepalaPerpustakaan (4) Tulislah pangkat dan golongan ruang terakhir Kepala Perpustakaan tersebutterhitungmulaitanggalberlakunyaSK (5) Tulis jabatan fungsional guru yang diberi tugas tambahan sebagai KepalaPerpustakaan (6) Tulislah jenis kelamin Kepala Perpustakaan yang dinilai dengan cara mencorethurufLatauP (7) Tulislahmasakerja(berapatahundanberapabulan)guruyangdinilai (8) Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut bekerjasebagaiKepalaPerpustakaan. (9) Tulislah kualifikasi pendidikan terakhir Kepala Perpustakaan beserta spesialisasinya. (10) Tulislahjenispelatihanbidangperpustakaanyangpernahdiikuti (11) Tulislah nama instansi atau sekolah sebagai tempat bekerja Kepala Perpustakaanyangdinilai Cukupjelas Cukupjelas Cukupjelas Cukupjelas Cukupjelas (12) Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK danPLB,sertaNomorRestgrasiGuru(NRG)setelahyangbersangkutan memilikisertifikatpendidik. (13) Tulislah tanggal, bulan, dan tahun periode penilaian kinerja Kepala Perpustakaandimaksud (14) Tulislah pernyataan persetujuan dari penilai dan Kepala Perpustakaan yang dinilai dengan cara mencoret kata SETUJU atau mencorat kata TIDAKSETUJU. (15a), Bubuhkan nama jelas dan tandatangan Kepala Perpustakaan yang (15b),(15c) dinilaisertatanggalpersetujuanhasilpenilaiankinerja. (16a), Bubuhkan nama jelas, tandatangan penilai serta tanggal persetujuan (16b),(16c), hasilpenilaiankinerjaKepalaPerpustakaan.

181

Lampiran3D

INSTRUMENPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL(IPKKLS/M) A. PETUNJUKPENILAIAN 1. Petugas penilaian kinerja kepala laboratorium/bengkel adalah Kepala sekolah,dimana kepala laboratorium/bengkel bertugas. Guru dan siswa sebagai pengguna laboratorium/bengkel dapat juga dilibatkan sebagai responden yang tujuannya untuk lebih mendalami kinerja dari guru dengan tugas tambahan sebagaikepalalaboratorium/bengkelsekolah. 2. Petugas penilai adalah kepala sekolah yang kompeten dan telah mengikuti pembekalan bagaimana menggunakan instrumen penilaian kinerja kepala laboratorium. 3. Setiap petugas penilaian wajib: (i) Memberikan penilaian, secara objektif berbasis bukti; (ii) Berkoordinasi dengan pihak terkait (guru kepala laboratorium/bengkel); (iii) Memberikan komentar dan rekomendasi perbaikan; dan (iv) Menghitung hasil penilaiandanmembuatlaporan. 4. Pengumpulan data dan informasi dilakukan melalui beberapa cara agar mendapatkan penilaian yang objektif yaitu: (i) Observasi dilakukan dengan cara mengamati lingkungan sekitar laboratorium/bengkel, baik internal maupun eksternal dan mencatat hal yang positif dan hal yang negatif terkait tugas kepala laboratorium/bengkel; (ii) Wawancara dilakukan dengan mewawancarai sumber sumber yang relevan, antara lain kepala sekolah, wakasek, guru dan siswa pemakai fasilitas laboratorium/bengkel dan staf tata usaha yang terkait; dan (iii) Studi Dokumentasi dilakukan dengan cara menelaah dokumendokumen dan catatan yang ada kaitannya dengan pengelolaan kepala laboratorium/bengkel sesuaidenganstandar. 5. Skala penilaian masingmasing komponen dinyatakan dengan angka 4, 3, 2, atau 1 denganketentuansebagaiberikut: Skor 4, diberikan apabila kepala sekolah mampu menunjukkan buktibukti yang lengkap dan sangat meyakinkan bahwa kepala sekolah yang bersangkutan secara konsisten atau selalu berkinerja sesuai dengan masing masingindikatorkomponenyangdinilai. Skor3,diberikanapabilakepalasekolahmampumenunjukkanbuktibuktiyang meyakinkan bahwa kepala sekolah yang bersangkutan lebih banyak berkinerja sesuaidenganmasingmasingindikatorkomponenyangdinilai. Skor 2, diberikan apabila kepala sekolah menunjukkan buktibukti tidak meyakinkan bahwa yang bersangkutan berkinerja sesuai dengan masing masingindikatorkomponenyangdinilai. Skor 1, diberikan apabila tidak ditemukan bukti bahwa kepala sekolah yang bersangkutan berkinerja sesuai dengan masingmasing indikator komponen yangdinilai. 6. RumusPerhitunganPenilaianKinerjaGurusebagaiKepalaLaboratorium/bengkel: PerolehanSkor PS SA== KriteriaKinerjaKK 182

SA (SA1+SA2+SA3+SA4+SA5+SA6+SA7) NAK=x100=x100 Ax4 28 Keterangan: SA =JumlahSkorKomponenKinerjaratarata(SA1s.dSA7) PS =JumlahPerolehanSkorsetiapKomponen KK =JumlahKriteriaKinerjasetiapKomponen A =AspekKinerja NAK =NilaiAkhirKinerja 7. Klasifikasi Nilai Akhir. Adapun Nilai Akhir (NA) yang telah dihitung, maka kinerja gurudengantugastambahansebagaikepalabengkeldapatdiklasifikasikansebagai berikut: No Klasifikasi NilaiAkhirKinerja 1 Sangatbaik 91100 2 Baik 7690 3 Cukup 6175 4 Sedang 5160 5 Kurang 050 8. Nilai Akhir Kinerja (NAK) yang telah diklasifikasikan dalam 5 (lima) level di atas, kemudian dikonversikan angka kredit yang telah ditentukan dengan cara perhitungansebagaiberikut: a. Nilai sangat baik diberikan angka kredit 125% dari jumlah angka kredit yang harusdicapaisetiaptahun. b. Nilai baik diberikan angka kredit 100% dari jumlah angka kredit yang harus dicapaisetiaptahun. c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang harusdicapaisetiaptahun. d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit yangharusdicapaisetiaptahun. e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit yangharusdicapaisetiaptahun.

183

B. FORMATIDENTITASDIRI IDENTITASKEPALALABORATORIUM/BENGKELYANGDINILAI a. Nama :..........................(1) NIP :..........................(2) :/...........................(3) :........................(4) :.......................(5) :......Tahun..Bulan(6) : L/P(7) Tempat/TanggalLahir TMTsebagaiguru MasaKerja JenisKelamin

Pangkat/Jabatan/Golongan

PendidikanTerakhir/Spesialisasi :..........................(8) JenisLaboratorium/bengkelyang dikelola(Fisika,KImia,dsb) b. NamaInstansi/Sekolah Telp/Fax Kelurahan Kecamatan Provinsi IDENTITASPENILAI a. Nama NIP Nomor :.........................(16) :.........................(17) :.........................(18) :.........................(19) :.........................(20) .,,............(21) KepalaLaboratorium/Bengkelyangdinilai, :.........................(9) :........................(10) :........................(11) :........................(12) :........................(13) :........................(14) :.......................(15)

Kota/Kabupaten

b. SKPenugasan(Jikaada) Tanggal Penilai, ................................... NIP.......

Berlakusampaidengan

........(22) NIP....

184

C. FORMATPENILAIANKINERJA 1. Kompetensi:Kepribadian NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKOR (24)

Berperilakuarifdalambertindakdan 1 2 3 4 memecahkanmasalah 2. Berperilakujujuratassemua 1 2 3 4 informasikedinasan 3. Menunjukkankemandiriandalam 1 2 3 4 bekerjadibidangnya 4. Menunjukkanrasapercayadiriatas 1 2 3 4 keputusanyangdiambil 5. Berupayameningkatkankemampuan 1 2 3 4 diridibidangnya 6. Bertindaksecarakonsistensesuai dengannormaagama,hukum,sosial, 1 2 3 4 danbudayanasionalIndonesia 7. Berperilakudisiplinataswaktudan 1 2 3 4 aturan 8. Bertanggungjawabterhadaptugas 1 2 3 4 9. Tekun,teliti,danhatihatidalam 1 2 3 4 melaksanakantugas 10. Kreatifdalammemecahkanmasalah yangberkaitandengantugas 1 2 3 4 profesinya 11. Berorientasipadakualitasdan kepuasanlayananpemakai 1 2 3 4 laboratorium/bengkel PerolehanSkor(PS) (25) Skorratarata(SA1)=PerolehanSkor:11= (26) DeskripsiKinerjaYangTelahDilakukan:(27)

185

2. Kompetensi:Sosial NO. 1. 2. 3. 4. KRITERIAKINERJA Menyadarikekuatandankelemahan baikdirimaupunstafnya BUKTIYANG TERIDENTIFIKASI (23) 1 1 1 SKOR (24) 2 2 2 3 3 3 4 4 4

Memilikiwawasantentangpihaklain yangdapatdiajakkerjasama Bekerjasamadenganberbagaipihak secaraefektif

Berkomunikasidenganberbagai pihaksecarasantun,empatik,dan 1 2 3 4 efektif 5. Memanfaatkanberbagaiperalatan TeknologiInformasidankomunikasi 1 2 3 4 (TIK)untukberkomunikasi PerolehanSkor(PS) (25) Skorratarata(SA2)=PerolehanSkor:5= (26) DeskripsiKinerjayangTelahDilakukan:(27)

186

3. Kompetensi:PengorganisasianGuru/Laboran/Teknisi NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) 1 1 1 1 1 1 SKOR (24) 2 2 2 2 2 2 3 3 3 3 3 3 4 4 4 4 4 4 (25) (26) (27)

Mengkoordinasikankegiatan praktikumdenganguru 2. Merumuskanrinciantugas teknisidanlaboran 3. Menentukanjadwalkerjateknisi danlaboran 4. Mensupervisiteknisidan laboran 5. Menilaihasilkerjateknisidan laboran 6. Menilaikinerjateknisidan laboranlaboratorium/bengkel PerolehanSkor(PS) SkorAspekratarata(SA3)=PerolehenSkor:6= DeskripsiKinerjayangTelahDilakukan:

187

4. Kompetensi:PengelolaandanAdministrasi NO. 1. 2. 3. 4. 5. 6. 7. KRITERIAKINERJA Menyusunprogrampengelolaan laboratorium/bengkel Menyusunjadwalkegiatan laboratorium/bengkel Menyusunrencanapengembangan laboratorium/bengkel Menyusunproseduroperasistandar (POS)kerjalaboratorium/bengkel Mengembangkansistemadministrasi laboratorium/bengkel Menyusunjadwalkegiatan laboratorium/bengkel Menyusunlaporankegiatan laboratorium/bengkel BUKTIYANG TERIDENTIFIKASI (23) 1 1 1 1 1 1 1 SKOR (24) 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 (25)

PerolehanSkor(PS)

SkorAspekratarata(SA4)=PerolehanSkor:7= (26) DeskripsiKinerjayangTelahDilakukan:(27)

188

5. Kompetensi:PengelolaanPemantauandanEvaluasi BUKTIYANG SKOR NO. KRITERIAKINERJA TERIDENTIFIKASI (24) (23) 1. Memantaukondisidankeamanan bahansertaalat 1 2 3 4 laboratorium/bengkel 2. Memantaukondisidankeamanan 1 2 3 4 bangunanlaboratorium/bengkel 3. Memantaupelaksanaankegiatan 1 2 3 4 laboratorium/bengkel 4. Membuatlaporanbulanandan tahunantentangkondisidan 1 2 3 4 pemanfaatanlaboratorium/bengkel 5. Membuatlaporansecaraperiodic 1 2 3 4 6. Mengevaluasiprogram laboratorium/bengkeluntuk 1 2 3 4 perbaikanselanjutnya 7. Menilaikegiatan 1 2 3 4 laboratorium/bengkel PerolehanSkor(PS) (25) SkorAspekratarata(SA5)=PerolehanSkor:7= (26) DeskripsiKinerjayangTelahDilakukan:(27)

189

6. Kompetensi:PengembangandanInovasi NO. 1 KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKOR (24)

Mengikutiperkembanganpemikiran tentangpemanfaatankegiatan 1 2 3 4 laboratorium/bengkelsebagaiwahana pendidikan 2 Menerapkanhasilinovasiataukajian 1 2 3 4 laboratorium/bengkel 3 Merancangkegiatan laboratorium/bengkeluntukpendidikan 1 2 3 4 danpenelitian 4 Melaksanakankegiatan laboratorium/bengkeluntuk 1 2 3 4 kepentinganpendidikandanpenelitian 5 Mempublikasikankaryatulisilmiahhasil 1 2 3 4 kajian/inovasilaboratorium/bengkel PerolehanSkor(PS) (25) SkorAspekratarata(SA6)=PerolehanSkor:5= (26) DeskripsiKinerjayangTelahDilakukan:(27)

190

7. Kompetensi:PengelolaanLingkungandanP3 NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKOR (24)

Menyusunpanduan/penuntun 1 2 3 4 (manual)praktikum Menetapkanketentuanmengenai 2. kesehatandankeselamatankerja 1 2 3 4 (K3) Menerapkanketentuanmengenai 3. kesehatandankeselamatankerja 1 2 3 4 (K3) Menerapkanprosedurpenanganan 4. 1 2 3 4 bahanberbahayadanberacun Memantaubahanberbahayadan 5. beracun,sertaperalatan 1 2 3 4 keselamatankerja PerolehanSkor(PS) (25) SkorAspekratarata(SA7)=PerolehanSkor:5= (26) DeskripsiKinerjayangTelahDilakukan:(27)

191

D. REKAPITULASIHASILPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL KOMPETENSI SKOR (28) 1 Kepribadian 2 Sosial 3 PengorganisasianGuru/Laboran/Teknisi 4 PengelolaandanAdministrasi 5 PengelolaanPemantauandanEvaluasi 6 PengembangandanInovasi 7 PengelolaanLingkungandanP3 JUMLAHSKOR (29) NilaiAkhir=JumlahSkor/28X100=................x.............................(30) ,(31) KepalaLaboratorium/Bengkel(32)Penilai(33) KepalaSekolah(34) yangdinilai, Nama Nama Nama NIP NIP NIP

192

PETUNJUKPENGISIANFORMAT3D NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislah nama Kepala Laboratorium/Bengkel yang dinilai sesuai dengan yang tercantum dalam SK pengangkatan sebagai Kepala Laboratorium/Bengkel 2. (2) Tulislah Nomor Induk Pegawai Kepala Laboratorium/Bengkel yang bersangkutan 3. (3) Tulislah tempat dan tanggal lahir Kepala Laboratorium/Bengkel yang dinilai sesuai SK pengangkatan sebagai Kepala Laboratorium/Bengkel 4. (4) Tulislah pangkat, jabatan, dan golongan ruang terakhir Kepala Laboratorium/Bengkel tersebut terhitung mulai tanggal berlakunya SK 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkan SK pengangkatan sebagai Kepala Laboratorium/Bengkel 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala Laboratorium/Bengkeltersebutbertugas. 7. (7) Tulislah jenis kelamin Kepala Laboratorium/Bengkel yang dinilai dengancaramencorethurufLatauP 8. (8) Tulislah kualifikasi pendidikan terakhir Kepala Laboratorium/Bengkelbesertaspesialisasinya. 9. (9) Tulislah jenis Laboratorium/Bengkel yang dikelola Kepala Laboratorium/Bengkelyangdinilai 10. (10) Tulislah nama instansi atau sekolah sebagai tempat bekerja Kepala Laboratorium/Bengkelyangdinilai 11. (11) Cukupjelas 12. (12) Cukupjelas 13. (13) Cukupjelas 14. (14) Cukupjelas 15. (15) Cukupjelas 16. (16) Tulislahnamapenilai 17. (17) TulislahNomorIndukPegawaipenilaiyangbersangkutan 18. (18) Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala Laboratorium/Bengkel(jikaada) 19. (19) Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala Laboratorium/Bengkel 20. (20) Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK penugasansebagaipenilaikinerjaKepalaLaboratorium/Bengkel 21. (21) Tulislahtanggal,bulan,dantahunpengisianformatini 22. (22) Bubuhkan tanda tangan, nama jelas, dan NIP penilai dan Kepala Laboratorium/Bengkelyangdinilai.

193

NO 23.

NOMOR KODE (23)

URAIAN Tulislah bukti yang relevan dan teridentifikasi, sesuai masing masingkriteriapadasetiapkompetensiyangdinilaidalampenilaian KepalaLaboratorium/Bengkel Berikan skor untuk masingmasing kriteria berdasarkan bukti yang relevanyangteridentifikasi Jumlahkan semua skor kriteria pada kompetensi dalam penilaian kinerjaKepalaLaboratorium/Bengkel HitunglahskorrataratakompetensidalampenilaiankinerjaKepala Laboratorium/Bengkel dengan cara membagi jumlah skor dengan banyaknyakriteriayangbersangkutan Tulislahdeskripsikinerjayangtelahdilakukanuntukmasingmasing kompetensiberdasarkankriteria,buktifisikyangteramati,danskor rataratakompetensitersebut. Pindahkan skor ratarata ketujuh kompetensi dalam penilaian kinerja ke dalam format rekapitulasi hasil penilaian kinerja Kepala Laboratorium/Bengkel Jumlahkan semua skor kompetensi dalam penilaian kinerja Kepala Laboratorium/Bengkel Hitunglah Nilai Akhir dengan cara membagi jumlah semua skor kompetensi penilaian kinerja Kepala Laboratorium/Bengkel dengan 28 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai(bilangan)dalamduadesimal. Tulislah nama kota, tanggal, bulan, dan tahun pengisian format rekapitulasihasilpenilaiankinerjaKepalaLaboratorium/Bengkel Tulislah nama, NIP, dan bubuhkan tandatangan Kepala Laboratorium/Bengkelyangdinilai. Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja KepalaLaboratorium/Bengkel. Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

24. 25. 26.

(24) (25) (26)

27.

(27)

28.

(28)

29. 30.

(29) (30)

31. 32. 33. 34.

(31) (32) (33) (34)

194

FORMATTAMBAHANPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL FormatWawancara WAWANCARAPENDALAMAN(GURUTEMANSEJAWAT*/SISWA*) // Jams/d Namaguruyangdinilai Tanggal Waktuwawancara wawancara Petunjuk: Wawancara dilakukan untuk pedalaman hasil observasi dan studi dokumentasi. Wawancara sebaiknya dilakukan tidak terlalu formal. Penilai dapat mengawali wawancara dengan menulis KRITERIA yang ingin didalami pada kotak dibawah ini. Kemudian penilai meminta respon pada guru atau siswa yang biasa menggunakan fasilitas laboratorium/bengkel sekolah untuk memberikanpenjelasansingkat.PenilaimencatathalpentingyangdariKRITERIAyangditanyakan. 1. ASPEKKEPRIBADIAN(A1). Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat*/siswa*: ............................................................................... ............................................................................... ...............................................................................

2. ASPEKSOSIAL(A2)
Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat/siswa)*: .............................................................................. ............................................................................... ............................................................................... *(coretyangtidakperlu) 3. ASPEKPENGORGANISASIANGURU,LABORAN/TEKNISI(A3) Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat/siswa)*: .............................................................................. ............................................................................... ...............................................................................

195

4. ASPEKPENGELOLAANPROGRAMDANADMINISTRASI(A4)
Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat*/siswa*: .............................................................................. ............................................................................... ...............................................................................

5. ASPEKPENGELOLAANPEMANTAUANDANEVALUASI(A5)
Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat/siswa)*: ............................................................................... .............................................................................. .............................................................................. 6. ASPEKPENGEMBANGANDANINOVASI(A6) Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat/siswa)*: ............................................................................... ............................................................................... ...............................................................................

7. ASPEKLINGKUNGANDANK3(A7)
Pertanyaan:(Kriteriayangperludidalami) 1................................................................? 2................................................................? 3................................................................? Catatanjawabangurutemansejawat/siswa)*: ............................................................................... ............................................................................... ...............................................................................
*)coretyangtidakperlu

........,.......20... Penilai,

NIP.................

196

8. FormatBeritaAcara

BERITAACARA Padahariini,.........tanggal.......bulan......tahun...,bertempatdi........ . . . . . . . . . . . . . . . . .. mulai pukul . . . . . s/d . . . . . . telah dilaksanakan konsultasi PenilaianKinerjaGurudengantugastambahansebagai............ Guru yang dinilai menyatakan, bahwa hasil penilaian kenerja guru terkait sebagai .............. telah dibaca dan dipahami berdasarkan aspek dan kriteria yang tercantumdalaminstrumenpenilaiankinerja,selanjutnyaasesimenyatakan: SETUJU/TIDAKSETUJU)* Demikianlah berita acara ini dibuat dengan benar dan sesuai dengan keadaan yangsebenarbenarnya.

NamaPenilai TandaTangan

NamaGuru yangdinilai TandaTangan

Tanggal

Tanggal

*)coretyangbukanpilihan

197

Lampiran3E

INSTRUMENPENILAIANKINERJAKETUAPROGRAMKEAHLIAN A. PETUNJUKPENILAIAN 1. Petugas penilaian kinerja Ketua Program Keahlian dapat secara individu atau berbentuk tim yang terdiri atas Kepala sekolah dan atau Wakil Kepala Sekolah. Bidang sarana/prasarana dan atau Wakil Kepala Sekolah lingkup sekolah yang ditunjuk. Guru dan siswa pada lingkup program keahlian dapat juga dilibatkan sebagai responden untuk lebih mendalami kinerja ketua program keahlian di sekolah. 2. Petugas penilai adalah orang yang kompeten yang telah ditugaskan dengan surat tugasdarikepalasekolahsertatelahmengikutipembekalan. 3. Setiap petugas wajib: (i) Memberikan penilaian secara objektif berbasis bukti; (ii) Berkoordinasi dengan pihak terkait; (iii) Menghitung hasil penilaian, dan (iv) membuatlaporan. 4. Pengumpulan data dan informasi dilakukan melalui beberapa cara agar mendapatkan penilaian yang objektif yaitu: (i) Observasi dilakukan dengan cara mengamati hal yang positif dan hal yang negatif terkait tugas ketua program keahlian; (ii) Wawancara dilakukan dengan mewawancarai sumbersumber yang relevan, antara lain kepala sekolah, wakil kepala sekolah, guru dan peserta dididk dan staf tata usaha yang terkait; dan (iii) Studi Dokumen dilakukan dengan cara menelaahdokumendokumendancatatanyangadakaitannyadenganpengelolaan ketuaprogramkeahliansesuaistandar. 5. Skala penilaian masingmasing kriteria dinyatakan dengan angka 4, 3, 2, atau 1 denganketentuansebagaiberikut: Skor 4 diberikan apabila ketua program/kompetensi keahlian mampu menunjukkan buktibukti yang lengkap dan sangat meyakinkan bahwa yang bersangkutan berkinerja sesuai dengan masingmasing kriteria kinerja yang dinilai atau yang bersangkutan selalu melaksanakan pekerjaan sebagaimana pernyataankriteriakinerjaatauhasilkinerjanyabermutusangattinggi. Skor 3 diberikan apabila ketua program/kompetensi keahlian mampu menunjukkan buktibukti yang meyakinkan bahwa yang bersangkutan berkinerja sesuai dengan masingmasing kriteria kinerja yang dinilai atau yang bersangkutanseringmelaksanakanpekerjaansebagaimanapernyataankriteria kinerjaatauhasilkinerjanyabermututinggi. Skor 2 diberikan apabila ketua program/kompetensi keahlian menunjukkan buktibukti yang kurang atau tidak meyakinkan bahwa yang bersangkutan berkinerja sesuai dengan masingmasing kriteria kinerja yang dinilai atau yang bersangkutan kadang melaksanakan pekerjaan sebagaimana pernyataan kriteriakinerjaatauhasilkinerjanyabermutusedang. Skor 1 diberikan apabila tidak ditemukan bukti bahwa ketua program/ kompetensi keahlian berkinerja sesuai dengan masingmasing kriteria kinerja yang dinilai atau yang bersangkutan jarang atau tidak pernah melaksanakan pekerjaan sebagaimana pernyataan kriteria kinerja atau hasil kinerjanya bermuturendah.

198

6. RumusperhitunganpenilaiankinerjagurusebagaiKetuaProgram NAKn NAK=x100 (KK)x4 (A1+A2+AK3+A4+A5+A6+A7+A8) NAK=x100 32 Keterangan: NAK =NilaiAkhirKinerja An =NilaiRataratasetiapkompetensi KK =KriteriaKinerja 7. Nilaiakhirkinerja(NAK)yangtelahdihitungdiklasifikasikansebagaiberikut: No Klasifikasi NilaiAkhirKinerja 1 Sangatbaik 91100 2 Baik 7690 3 Cukup 6175 4 Sedang 5160 5 Kurang 050 8. Nilai Akhir Kinerja (NAK) yang telah diklasifikasikan dalam 5 (lima level) diatas, kemudian dikonversikan kepada angka kredit yang telah ditentukan dengan cara perhitungansebagaiberikut: a. Nilai sangat baik diberikan angka kredit 125% dari jumlah angka kredit yang harusdicapaisetiaptahun. b. Nilai baik diberikan angka kredit 100% dari jumlah angka kredit yang harus dicapaisetiaptahun. c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang harusdicapaisetiaptahun. d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit yangharusdicapaisetiaptahun. e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit yangharusdicapaisetiaptahun.

199

B. FORMATIDENTITASDIRI IDENTITASKETUAPROGRAMKEAHLIAN a. Nama :........................(1) NIP :........................(2) :/.........................(3) :........................(4) :........................(5) :........Tahun....Bulan(6) : L/P(7)

Tempat/TanggalLahir

Pangkat/Jabatan/Golongan TMTsebagaiguru MasaKerja JenisKelamin

PendidikanTerakhir/Spesialisasi :.......................(8) ProgramKeahlianyangdiampu :.......................(9) b. NamaInstansi/Sekolah Telp/Fax Kelurahan Kecamatan :.......................(10) :.......................(11) :.......................(12) :.......................(13) :.......................(14) :......................(15)

Kota/Kabupaten Provinsi IDENTITASPENILAI a. Nama NIP

:........................(16) :........................(17)

b. SKPenugasan(Jikaada) Nomor Tanggal :........................(18) :........................(19) :.........................(20) .,,..........(21)

Berlakusampaidengan

Penilai, ................................... NIP.......

KetuaProgramKeahlianyangdinilai,

(22) NIP....

200

C. FORMATPENILAIANKINERJA 1. KompetensiKepribadian NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKALASKOR (24)

Berperilakuarifdalambertindak 1 2 3 4 danmemecahkanmasalah 2. Berperilakujujuratassemua 1 2 3 4 informasikedinasan 3. Menunjukkankemandirian 1 2 3 4 dalambekerjadibidangnya 4. Menunjukkanrasapercayadiri 1 2 3 4 ataskeputusanyangdiambil 5. Bertindaksecarakonsisten sesuaidengannormaagama, 1 2 3 4 201ocia,201ocial,danbudaya nasionalIndonesia 6. Berperilakudisiplinataswaktu 1 2 3 4 danaturan JUMLAHSKORASPEK1 (25) SKORRATARATA(A1)=JUMLAHSKOR:6= (26) DeskripsiKinerjayangTelahDilakukan:(27)

201

2. KompetensiSosial NO. 1. KRITERIAKINERJA Menyadarikekuatandan kelemahanbaikdirimaupun stafnya Memilikiwawasantentang pihaklainyangdapatdiajak kerjasama Bekerjasamadenganberbagai pihaksecaraefektif BUKTIYANG TERIDENTIFIKASI (23) 1 1 1 2 2 3 3 4 4 SKALASKOR (24) 2 3 4

2.

3. 4.

Berkomunikasidengan berbagaipihaksecarasantun, 1 2 3 4 empatik,danefektif JUMLAHSKORASPEK2 (25) SKORRATARATA(A2)=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan:(27)

202

3. KompetensiPerencanaan NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKALASKOR (24)

Menyusunrencanakegiatan tahunanlingkupprogram/ 1 2 3 4 kompetensikeahlianpadaformat yangtelahdisediakanolehsekolah 2. Menyusunkebutuhanalatdan bahanpraktikpadalingkup program/kompetensikeahlian 1 2 3 4 padaformatyangtelahdisediakan olehsekolah 3. Melibatkangurulaindalam menyusunrencanakegiatan 1 2 3 4 tahunanpadalingkup program/kompetensikeahlian 4. Dalamrencanakegiatantahunan terkandungunsurpengembangan 1 2 3 4 program/kompetensikeahlian 5 Menganalisisketercapaianrencana kegiatantahunanlingkup program/kompetensikeahlian 1 2 3 4 padaformatyangtelahdisediakan olehsekolah JUMLAHSKORASPEK3 (25) SKORRATARATA(A3)=JUMLAHSKOR:5= (26) DeskripsiKinerjayangTelahDilakukan:(27)

203

4. KompetensiPengelolaanPembelajaran NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKALASKOR (24)

Mengkoordinasikankegiatan pengembangankurikulum sepertimenyusunsilabusdan 1 2 3 4 RPPpadalingkupprogram/ kompetensikeahlian 2. Mengkoordinasikankegiatan pembelajarandalamrangka 1 2 3 4 menciptakaniklimkerjayang kondusif. 3. Menyediakanmediapresentasi denganmenggunakankomputer 1 2 3 4 dandigitalprojector 4. Menyediakan/mengelola ketersediaanbahanajaruntuk 1 2 3 4 pembelajaran 5 Memotivasipesertadidikdalam pembelajarandan 1 2 3 4 pengembangankapasitas pesertadidik. 6 Mengkoordinasikankegiatan pesertadidikdalam pembelajarandan pengembangankapasitas pesertadidik. JUMLAHSKORASPEK4 (25) SKORRATARATA(A4)=JUMLAHSKOR:6= (26) DeskripsiKinerjayangTelahDilakukan:(27)

204

5. KompetensiPengelolaanSumberDayaManusia BUKTIYANG SKALASKOR NO. KRITERIAKINERJA TERIDENTIFIKASI (24) (23) 1. Menyusunjadwalmengajarguru padalingkupprogram/ 1 2 3 4 kompetensikeahlian 2. Melakukanpembagiantugas kepalabengkel/sanggar/ laboratoriumdanatau 1 2 3 4 teknisi/laboranpadalingkup program/kompetensikeahlian 3. Memberikanmotivasipositif kepadaguru,kepala bengkel/sanggar/laboratorium 1 2 3 4 danteknisi/laborandalam melaksanakantugasnya. 4. Melakukankoordinasikegiatan guru,kepalabengkel/ sanggar/laboratoriumdan 1 2 3 4 teknisi/laborandalam melaksanakantugasnya. JUMLAHSKORASPEK5 (25) SKORRATARATA(A5)=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan:(27)

205

6. KompetensiPengelolaanSaramaPrasarana NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKALASKOR (24)

Menyusunjadwalpenggunaan bengkel/sanggar/laboratorium 1 2 3 4 padalingkup program/kompetensikeahlian 2. Memilikiperangkatadminsitrasi pengelolaansaranadan prasarana 1 2 3 4 bengkel/sanggar/laboratorium dalamrangkatertibadministrasi saranadanprasarana. 3. Mengkoordinasikan pemeliharaankondisisaranadan prasaranabengkel/sanggar/ 1 2 3 4 laboratoriumdengankepala bengkel/sanggar/laboratorium danatauteknisi/laboran 4. Mengkoordinasikankebersihan ruangan,gedungdanhalaman 1 2 3 4 denganpetugaskebersihan JUMLAHSKORASPEK6 (25) SKORRATARATA(A6)=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan:(27)

206

7. KompetensiPengelolaanKeuangan NO. 1. KRITERIAKINERJA Memilikirencanaanggarandan pendapatanprogram/kompetensi keahlian Memilikiperangkatadministrasi keuanganlingkupprogram/ kompetensikeahlian. Menggunakandanasecaraefektif danefisienuntukkegiatandan kemajuanprogram/kompetensi keahlianyangdiampunya. Mendelegasikanpengelolaan keuangankepadabendahara BUKTIYANG TERIDENTIFIKASI (23) 1 1 1 2 3 4 2 3 4 SKALASKOR (24) 2 3 4

2.

3.

4.

JUMLAHSKORASPEK7 (25) SKORRATARATA(A7)=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan:(27)

207

8. KompetensiEvaluasidanPelaporan NO. 1. KRITERIAKINERJA BUKTIYANG TERIDENTIFIKASI (23) SKALASKOR (24)

Memantaupelaksanaan kegiatanpembelajaranpada 1 2 3 4 lingkupprogram/kompetensi keahlian 2. Memantauketersediaandan kondisialatdanbahan 1 2 3 4 praktikum 3. Menyusunlaporankeuangan padalingkupprogram/ 1 2 3 4 kompetensikeahlian 4. Menyusunlaporankegiatan tahunanpadalingkupprogram/ 1 2 3 4 kompetensikeahlian JUMLAHSKORASPEK8 (25) SKORRATARATA(A8)=JUMLAHSKOR:4= (26) DeskripsiKinerjayangTelahDilakukan:(27)

208

D. REKAPITULASIHASILPENILAIANKINERJAKETUAPROGRAMSEKOLAH/MADRASAH KOMPETENSI SKOR (28) 1 Kepribadian 2 Sosial 3 Perencanaan 4 PengelolaanPembelajaran 5 PengelolaanSumberDayaManusia 6 PengelolaanSaramaPrasarana 7 PengelolaanKeuangan 8 EvaluasidanPelaporan JUMLAHSKOR (29) NILAIAKHIR: (A1+A2+A3+A4+A5+A6+A7+A8) NA = X 100 32 NA = . X 100 = (30) 32 KlasifikasiNilaiAkhir=.(AmatBaik,Baik,Sedang,Kurang) ,(31) KetuaProgramKeahlian(32) Penilai(33) KepalaSekolah(34) yangdinilai, Nama Nama Nama NIP NIP NIP

209

PETUNJUKPENGISIANFORMAT NOMOR NO URAIAN KODE 1 2 3 1. (1) TulislahnamaKetuaProgramKeahlianyangdinilaisesuaidenganyang tercantumdalamSKpengangkatansebagaiKetuaProgramKeahlian 2. (2) Tulislah Nomor Induk Pegawai Ketua Program Keahlian yang bersangkutan 3. (3) Tulislah tempat dan tanggal lahir Ketua Program Keahlian yang dinilai sesuaiSKpengangkatansebagaiKetuaProgramKeahlian 4. (4) Tulislahpangkat,jabatan,dangolonganruangterakhirKetuaProgram KeahliantersebutterhitungmulaitanggalberlakunyaSK 5. (5) Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan berdasarkan SK pengangkatan sebagai Ketua Program Keahlian 6. (6) Tulislah sejak kapan (berapa tahun dan berapa bulan) Ketua Program Keahliantersebutbertugas 7. (7) TulislahjeniskelaminyangsesuaiKetuaProgramKeahlianyangdinilai dengancaramencorethurufLatauP 8. (8) Tulislah kualifikasi pendidikan terakhir Ketua Program Keahlian besertaspesialisasinya. 9. (9) Tulislah program keahlian yang diampu Ketua Program Keahlian yang dinilai 10. (10) Tulislah nama instansi atau sekolah Ketua Program Keahlian yang dinilai 11. (11) Cukupjelas 12. (12) Cukupjelas 13. (13) Cukupjelas 14. (14) Cukupjelas 15. (15) Cukupjelas 16. (16) Tulislahnamapenilai 17. (17) TulislahNomorIndukPenilaiyangbersangkutan 18. (18) Tulislah Nomor SK penugasan sebagai penilai kinerja Ketua Program Keahlian(jikaada) 19. (19) Tulislah tanggal SK penugasan sebagai penilai kinerja Ketua Program Keahlian 20. (20) Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK penugasansebagaipenilaikinerjaKetuaProgramKeahlian 21. (21) Tulislahtanggal,bulan,dantahunpengisianformatini 22. (22) Bubuhkan tandatangan, nama jelas, dan NIP penilai dan Ketua ProgramKeahlianyangdinilai. 23. (23) Tulislah bukti yang relevan dan teridentifikasi sesuai masingmasing kriteria pada setiap kompetensi yang dinilai dalam penilaian Ketua ProgramKeahlian 24. (24) Berikan skor untuk masingmasing kriteria berdasarkan bukti yang relevanyangteridentifikasi

210

NO 25. 26.

27.

28.

29. 30.

31. 32. 33. 34.

NOMOR URAIAN KODE (25) Jumlahkan semua skor kriteria pada kompetensi dalam penilaian kinerjaKetuaProgramKeahlian (26) Hitunglah skor ratarata kompetensi dalam penilaian kinerja Ketua Program Keahlian dengan cara membagi jumlah skor dengan banyaknyakriteriakompetensiyangbersangkutan (27) Tulislah deskripsi kinerja yang telah dilakukan untuk masingmasing kompetensi berdasarkan kriteria, bukti fisik yang teramati, dan skor rataratakompetensitersebut. (28) Pindahkan skor ratarata kedelapan kompetensi dalam penilaian kinerja ke dalam format rekapitulasi hasil penilaian kinerja Ketua ProgramKeahlian (29) Jumlahkan semua skor kompetensi dalam penilaian Ketua Program Keahlian (30) Hitunglah Nilai Akhir (NA) dengan cara membagi jumlah semua skor kompetensi dalam penilaian kinerja Ketua Program Keahlian dengan 32 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai (bilangan)dalamduadesimal. (31) Tulislah nama kota, tanggal, bulan, dan tahun pengisian format rekapitulasihasilpenilaiankinerjaKetuaProgramKeahlian (32) Tulislah nama, NIP, dan bubuhkan tandatangan Ketua Program Keahlianyangdinilai. (33) Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja Ketua ProgramKeahlian. (34) Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

211

212

LAMPIRAN4 FORMATPERHITUNGAN ANGKAKREDITTUGASTAMBAHAN

213

FORMATREKAPITULASIHASILPENILAIANKINERJAGURUDENGANTUGASTAMBAHAN SEBAGAI:.............................................(1)
a. Namaguruyangdinilai :........................................... (2) NIP :........................................... (3) Tempat/TanggalLahir :/............................................ (4) Pangkat/Jabatan/Golongan :........................................... (5) TMT :........................................... (6) Tahunmulaibekerjasebagaiguru :(7) MasaKerjasebagaiguru :.......Tahun......Bulan(8) Mulaimengembantugastambahan :(9) :.......Tahun......Bulan(10) Masakerjatugastambahan JenisKelamin :L/P(11) PendidikanTerakhir/Spesialisasi :..............................................(12) ProgramKeahlianyangdiampu :............................................(13) b. NamaSekolah/madrasah :............................................(14) Alamat :............................................(15) Kelurahan :............................................(16) Kecamatan :............................................(17) :............................................(18) Kabupaten/kota Provinsi :........................................... (19) Telp/fax :.(20) NilaiPKGURUuntuk: (21) Pembelajaran/Pembimbingan (22) Tugastambahansebagai..(1) KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPANdanRBNo.16Tahun2009
Nilai PKG (skala 100) = Nilai PKG 100 Nilai PKG Maksimum

(23) Pembelajaran/Pembimbingan (24) Tugastambahansebagai.(1) SebutandanprosentaseangkakreditsesuaidenganPermennegPANdanRBNo.16Tahun2009 Sebutan(25) Pembelajaran/Pembimbingan Sebutan(27) Tugastambahansebagai..(1) Perolehanangkakredit(pembelajaran/pembimbingan)pertahunbagigurudengan tugastambahansebagai..(1) (AKKAKPKBAKP)x(JM/JWM)xNPK AngkaKreditpertahun=x..%(29) 4 Perolehanangkakredittugastambahanpertahunsebagai.(1) (AKKAKPKBAKP)xNPK AngkaKreditpertahun=x...%(31) 4 Totalperolehanangkakredittahun.(33) Guruyangdinilai ((36)) Penilai (26) (28)

(30)

(32) (34)

..,..(35)
KepalaDinasKab/Kota ((38))

((37))

214

PETUNJUKPENGISIANFORMATREKAPITULASIHASILPENILAIANKINERJAGURU DENGANTUGASTAMBAHAN NO NOMOR URAIAN KODE 1. (1) IsikantugastambahanyangdiembanolehGuruyangdinilai 2. (2) Tuliskan nama guru yang dinilai sesuai dengan yang tercantum dalam SK pengangkatansebagaiguru. 3. (3) TuliskanNomorIndukPegawaiguruyangbersangkutan. 4. (4) Tuliskan tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan sebagaiguru. 5. (5) Tuliskan pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitung mulaitanggalberlakunyaSKpengangkatansebagaipemberiantugastambahan. 6. (6) Tuliskan terhitung mulai tanggal berlakunya pangkat/jabatan/golongan berdasarkanSKpengangkatantugastambahanyangdiemban. 7. (7) Tuliskantahunmulaibekerjasebagaigurudisekolahini. 8. (8) Tuliskanmasakerjasebagaiguru(berapatahundanberapabulan). 9. (9) Tuliskanmulaikapangurumengembantugastambahantersebut 10. (10) Tuliskan masa kerja guru dalam mengamban tugas tambahan (berapa tahun, berapabulan) 11. (11) TuliskanjeniskelaminguruyangdinilaidengancaramencorethurufLatauP. 12. (12) Tuliskankualifikasipendidikanterakhirgurubesertaspesialisasinya. 13. (13) Tuliskanprogramkeahlianyangdiampuguruyangdinilai. 14. (14) Tuliskannamasekolah/madrasahtempatbertugasnyaguruyangdinilai. 15. (15) Tuliskanalamatsekolah/madrasahtempatbertugasnyaguruyangdinilai. 16. (16) Tuliskanlokasikelurahansekolah/madrasah. 17. (17) Tuliskanlokasikecamatansekolah/madrasah. 18. (18) Tuliskanlokasikabupaten/kotasekolah/madrasah. 19. (19) Tuliskanlokasiprovinsisekolah/madrasah. 20. (20) Tuliskannomortelepondanfaxsekolah/madrasah. 21. (21) IsikanhasilPKGURUsesuaiformatrekapPKGURUsubunsur pembelajaran/pembimbingan. 22. (22) DiisidenganhasilPKGURUsesuaiformatrekapPKGURUdengantugas tambahanyangsesuai. 23. (23) IsikannilaiPKGURUsubunsurpembelajaran/pembimbinganyangtelah dikonversikedalamskala0100sesuaiPermennegPANdanRBNo.16Tahun 2009melaluiperhitunganmenggunakanrumus: Nilai PKG Nilai PKG (skala 100) = 100
Nilai PKG Maksimum

Keterangan: Nilai PKG skala 100 adalah nilai PK GURU subunsur pembelajaran/pembimbingan atau tugas tambahan yang relevan dengan fungsisekolah/madrasahdalamskala0100(sesuaiPermennegPANdanRB No.16Tahun2009).

215

NO

NOMOR KODE

URAIAN Nilai PKG adalah nilai total PK GURU subunsur pembelajaran/pembimbingan atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang diperolehsebelumdiubahkedalamskala0100. Nilai PKG maksimum adalah nilai tertinggi PK GURU, untuk pembelajaran adalah 56 (= 14 x 4), untuk pembimbingan adalah 68 (= 17 x 4) atau untuk tugas tambahan yang relevan dengan fungsi sekolah/madrasah sesuai dengan instrumenmasingmasing. IsikannilaiPKGURUuntuktugastambahanyangtelahdikonversikedalamskala 0100sesuaidenganPermennegPANdanRBNo.16Tahun2009melalui perhitungandenganmenggunakanrumussepertipada(23). Isikan sebutan yang diperoleh guru untuk subunsur pembelajaran/ pembimbingan sebagaimana ditetapkan dalam Permenneg PAN dan RB No. 16 Tahun2009(berdasarkanhasil(23)). NilaiHasilPK Persentase Sebutan Angkakredit GURU 91100 Amatbaik 125% 7690 Baik 100% 6175 Cukup 75% 5160 Sedang 50% 50 Kurang 25% Isikan persentase angka kredit yang diperoleh guru untuk subunsur pembelajaran/pembimbingansesuaisebutanpada(25). Isikan sebutan yang diperoleh guru untuk subunsur tugas tambahan sebagaimana ditetapkan dalam Permenneg PAN dan RB No. 16 Tahun 2009 (berdasarkanhasil(24)). Isikan persentase angka kredit yang diperoleh guru untuk subunsur tugas tambahansesuaisebutanpada(27). Isikan persentase bobot subunsur pembelajaran/pembimbingan sesuai tugas tambahan yang diemban guru (25% untuk kepala sekolah, 50% untuk wakil kepalasekolahatautugaslainnya) Isikanperolehanangkakreditsubunsurpembelajaran/pembimbinganpertahun yang dihitung berdasarkan rumus sistem paket tersebut dikalikan dengan persentasesesuaiperolehan(29). Rumussistempaketpembelajaran/pembimbingan: (AKKAKPKBAKP)x(JM/JWM)xNPK AngkaKreditpertahun= 4 Keterangan: AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikanpangkat. AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri,karyailmiah,dan/ataukaryainovatif). AKP adalah angka kredit unsur penunjang yang ditetapkan menurut

24.

(24)

25.

(25)

26. 27.

(26) (27)

28. 29.

(28) (29)

30.

(30)

216

NO

NOMOR KODE

URAIAN PermennegPANdanRBNo.19Tahun2009. JM adalah jumlah jam mengajar (tatap muka) guru di sekolah/madrasah ataujumlahkonseliyangdibimbingolehguruBK/Konselorpertahun. JWM adalah jumlah jam wajib mengajar (24 40 jam tatap muka per minggu) bagi guru pembelajaran atau jumlah konseli (150 250 konseli per tahun)yangdibimbingolehguruBK/Konselor. NPK adalah persentase perolehan angka kredit sebagai hasil penilaian kinerja 4adalahwakturataratakenaikanpangkatreguler,(4tahun). JM/JWM = 1 bagi guru yang mengajar 2440 jam tatap muka per mingguataumembimbing150250konselipertahun. JM/JWM=JM/24bagiguruyangmengajarkurangdari24jamtatapmuka per minggu atau JM/150 bagi guru BK/Konselor yang membimbing kurangdari150konselipertahun. Isikan persentase bobot subunsur tugas tambahan yang diemban guru (75% untuk kepala sekolah, 50% untuk wakil kepala sekolah atau tugas tambahan lain) Isikan perolehan angkakredit tugastambahan berdasarkanrumus sistem paket berikut: (AKKAKPKBAKP)xNPK AngkaKreditpertahun= 4 Keterangan: AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikanpangkat. AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri,karyailmiah,dan/ataukaryainovatif). AKP adalah angka kredit unsur penunjang yang ditetapkan menurut PermennegPANdanRBNo.19Tahun2009. NPK adalah persentase perolehan angka kredit sebagai hasil penilaian kinerja. 4adalahwakturataratakenaikanpangkatreguler,(4tahun). Isikantahundilaksanakannyapenilaiankinerja. Isikan total perolehan angka kredit bagi guru dengan tugas tambahan yang dinilai. Tulislahtempatdantanggaldilakukannyapengisianformatini. Isilah dengan tanda tangan dan nama guru yang dinilai sebagai bukti bahwa guru telah mengetahui dan setuju dengan estimasi hasil penilaian kinerja yang diperoleh. Isilahtandatangandannamapenilai. Isilah dengan tanda tangan dan nama kepala sekolah/madrasah tempat guru bekerja, sebagai bukti bahwa kepala sekolah/madrasah telah mengetahui dan menyetujuidenganhasilnilaikinerjaguruyangdiberitugastambahan.

31.

(31)

32.

(32)

33. 34. 35. 36.

(33) (34) (35) (36)

37. 38.

(37) (38)

217

218

LAMPIRAN5 LAPORANKENDALIKINERJAGURU

219

LAPORANKENDALIKINERJAGURU (Laporandibuatdalamkurunwaktu3tahununtukmenunjukkanterjadinyakemajuan/peningkatankinerjaguru) Namasekolah: TandatanganKepala (3) (1) Sekolah: Alamatsekolah: (2) NamaKepalaSekolah: (4) Jumlah Hasil Jumlah Hasil Jumlah Hasil Tahunajaran Tahunajaran Tahunajaran penilaian guru penilaian guru penilaian guru (5) Tercapai (6) (5) Tercapai (6) (5) Tercapai (6) Tidak (7) Tidak (7) Tidak (7) tercapai tercapai tercapai Tidakdinilai (8) Tidakdinilai (8) Tidakdinilai (8) Jumlahtotalguru (9) Jumlahtotalguru (9) Jumlahtotalguru (9) Tahunajaran: Tahunajaran: Tahunajaran: (11) (11) (11) No NamaGuru Catatan PK PK PK PKGuru PKGuru PKGuru Sasaran Guru Sasaran Guru Sasaran Guru Formatif Formatif Formatif Sumatif Sumatif Sumatif 1 (10) (12) (13) (14) (12) (13) (14) (12) (13) (14) (15) 2 3 4 5 .. dst.
Catatan:Kohortdatadalambeberapatahunakademikakanmemberikangambarantentangkemajuan/peningkatankinerja PKGuruformatifadalahnilaiPKGuruyangdiperolehgurupadapenilaiandiawalsemester1 SasaranadalahnilaiPKGuruyangditargetkanakandicapaisetelahmelaksanakanPKB PKGurusumatifadalahnilaiPKGuruyangdiperolehgurupadapenilaiandiakhirsemester2

220

PETUNJUKPENGISIANLAPORANKENDALIKINERJAGURU NOMOR NO URAIAN KODE 1 2 3 1. (1) Tulislahnamasekolahyangmelaporkankendalikinerjaguru 2. (2) Tulislahalamatsekolahlengkapdengannamajalan,nomor,kota, provinsi 3. (3) BubuhkantandatanganKepalaSekolahyangmelaporkankendali kinerjaguru 4. (4) TulislahnamaKepalaSekolahyangmelaporkankendalikinerja guru 5. (5) Tulislahtahunpelajaranpelaporankendalikinerjagurusecara terurutmulaidaritahunpertamadikotakpalingkirihinggatahun ketigadikotakpalingkanan 6. (6) Tulislahjumlahguruyanghasilpenilaiankinerjanyamencapai standar 7. (7) Tulislahjumlahguruyanghasilpenilaiankinerjanyatidakmencapai standar 8. (8) Tulislahjumlahguruyangkinerjanyatidakdinilai 9. (9) Tulislahtotaljumlahguru,baikyangtelahdinilaikinerjanya (mencapaistandaratautidakmencapaistandar)maupunyang kinerjanyatidakdinilai 10. (10) Tulislahnamagurudisekolahyangtelahdinilaikinerjanya 11. (11) Tulislahtahunpelajaranpelaporankendalikinerjagurusecara terurutmulaidaritahunpertamadikotakpalingkirihinggatahun ketigadikotakpalingkanan 12. (12) TulislahhasilPKGuruFormatifuntuksemuaguruyangdilaporkan dalamlaporankendalikinerjaguru 13. (13) Tulislahharapan(target)hasilPKGuruuntuksemuaguruyang dilaporkandalamlaporankendalikinerjagurusetalhguru melakukanPKB 14. (14) TulislahhasilPKGuruSumatifuntuksemuaguruyangdilaporkan dalamlaporankendalikinerjaguru 15. (15) Tuliskankomentar(catatan)berdasarkanhasilPKGuruselama3 (tiga)tahununtuksemuaguruyangdilaporkandalamlaporan kendalikinerjaguru

221