Anda di halaman 1dari 37

PETUNJUKPRAKTIS

TERAPIINSULIN PADAPASIENDIABETESMELITUS

PerkumpulanEndokrinologiIndonesia PERKENI 2011

KATA PENGANTAR Saat ini ilmu pengetahuan dan teknologi di bidang terapi insulin semakin berkembang. Hal ini membuat penggunaan insulin semakin aman, nyaman dan mudah. Dalam rangka mencapai target kadar glukosa darah yang mendekati nilai normal, klinisi dapat memberikan insulin sebagai pilihan sesuai indikasi. Keuntungan insulin yang lain adalah mencegah komplikasi diabetes di kemudian hari. Penggunaan insulin dalam kehidupan sehari-hari oleh para penyandang diabetes melitus telah dipermudah dengan kemajuan ilmu pengetahuan dan penemuan alat-alat bantu penyuntikan, serts jenis-jenis insulin baru. Di rumah sakit, tempat spesialis penyakit dalam dan konsultan endokrin metabolisme dan diabetes memegang peranan penting, penggunaan insulin disesuaikan dengan perkembangan ilmu kedokteran. Pengurus Besar Perkumpulan Endokrinologi Indonesia (PB PERKENI) periode tahun 2010-2012 membentuk tim khusus yang diketuai oleh Prof. Dr. dr. Ketut Suastika, SpPD KEMD, untuk mempelajari, menilai, dan mengkaji penggunaan insulin dalam klinik. Dalam buku ini dijelaskan mekanisme kerja insulin, temuam beberapa insulin baru, kelebihan dan kekurangan berbagai jenis insulin, tehnik penyuntikan yang lebih baik, pemanfaatan insulin dalam klinik, serta pemantauan hasilnya. Buku ini diharapkan dapat menjadi petunjuk bagi para dokter spesialis penyakit dalam, para konsultan endokrin metabolisme dan diabetes, serta spesialis lain sesuai kewenangan klinik dalam melaksanakan tugasnya. Dalam rangka untuk memaksimalkan manajemen kendali glukosa darah pada pasien diabetes maupun pada kondisi selain diabetes yang mengalami hiperglikemia. Bagi tenaga kesehatan lainnya, buku ini diharapkan dapat memberikan gambaran umum penggunaan insulin yang baik dan benar baik dalam pelayanan rawat jalan maupun rawat inap. Hal ini dapat memberikan manfaat bagi perbaikan kualitas pelayanan kesehatan dan dapat menurunkan angka morbiditas dan mortalitas. Buku petunjuk ini merupakan salah satu buku konsensus yang diterbitkan berdasarkan pengkajian, penilaian, dan telaah kritis PERKENI terhadap berbagai laporan penelitian di bidang endokrinologi secara umum khususnya masalah diabetes melitus. PB PERKENI mengucapkan terima kasih kepada semua pihak yang membantu perencanaan, persiapan, dan pelaksanaan program pembuatan konsensus ini. Untuk evaluasi selanjutnya kami tetap membuka pintu untuk masukan-masukan baru untuk lebih menyempurnakan buku ini. Selamat membaca dan menerapkan dalam praktik!

dr. Pradana Soewondo, SpPD KEMD Ketua PB PERKENI

DAFTAR ISI
I. II. III. PENDAHULUAN FARMAKOKINETIK OBAT INSULIN EFEK INSULIN DAN MANFAAT TERAPI INSULIN III.A Efek Insulin III.B Hiperglikemia Sebagai Petanda Luaran Klinik III.C Manfaat Terapi Insulin IV. TERAPI INSULIN UNTUK PASIEN DIABETES MELITUS RAWAT JALAN IV.A Indikasi Terapi Insulin IV.B Konsep Insulin Basal dan Insulin Prandial IV.C Memulai dan Alur Pemberian Terapi Insulin IV.D Strategi Praktis Terapi Insulin IV.E Cara Pemberian Insulin IV.F Sasaran Terapi V. TERAPI INSULIN UNTUK PASIEN HIPERGLIKEMIA YANG DIRAWAT DI RUMAH SAKIT V. A Terapi Insulin Pasien Rawat Inap V. B. Terapi Insulin Intensif Pada Pasien Kritis VI. TERAPI INSULIN PADA PASIEN PERIOPERATIF VII. TERAPI INSULIN PADA KETOASIDOSIS DIABETIK DAN STATUS HIPERGLIKEMIA HIPEROSMOLAR VIII. KEAMANAN DAN EFEK SAMPING INSULIN VIII.A. Penggunaan Pada Wanita Hamil VIII.B Hipoglikemi VIII.C Peningkatan Berat Badan VIII.D Edema Insulin VIII.E Lipoatrofi dan Lipoohipertrofi IX TEHNIK PENYUNTIKAN DAN PENYIMPANAN INSULIN IX.A Tehnik Penyuntikan Insulin IX.B Tehnik Penyimpanan Insulin DAFTAR PUSTAKA 1 3 6 6 7 8 9 9 9 10 13 16 16 19 19 20 23 25 28 28 28 28 29 29 30 30 31 32

I. Ditemukannya insulin hampir 90 tahun yang lalu merupakan salah satu tonggak sejarah terbesardalambidangkedokteranpadaabadke20.Sangatpantaskemudianpenemunya mendapatkan hadiah nobel di bidang kedokteran. Dalam kurun waktu yang tidak terlalu lama,terutamadalam20tahunterakhirtelahbanyakkemajuandalamterapiinsulin.Mulai dari pemurnian sediaan insulin (dari insulin polikomponen menjadi monokomponen yang berasal dari insulin binatang) hingga ditemukannya insulin manusia dengan cara rekayasa genetik serta yang terakhir adalah ditemukannya insulin analog. Kemajuan terapi insulin juga terletak pada konsep sekresi insulin endogen, pola alamiah sekresi insulin, yang membawa perbaikan di dalam perbaikan konsep terapi insulin. Dengan adanya insulin analog, makin mendekatkan terapi insulin yang menyerupai pola sekresi insulin endogen, sehinggahasilpengobatanmenjadilebihbaikdanmenurunkanefeksamping. Diabetes merupakan penyakit yang progresif, jika tidak dikelola dengan baik maka cepat jatuh pada komplikasi khususnya penyakit pembuluh darah. Secara garis besar ada 2 tipe diabetes yang utama, yaitu diabetes melitus tipe 1 (DMT1) dan diabetes melitus tipe 2 (DMT2). DMT1 merupakan diabetes yang disebabkan oleh karena kerusakan sel beta, sehingga terjadi kegagalan fungsi sel beta dalam mensekresikan insulin secara mutlak. Pasien seperti ini memerlukan insulin untuk hidupnya. Mekanisme DMT2 umumnya didahului oleh resistensi insulin dan akhirnya akan terjadi disfungsi sel beta untuk mencukupikebutuhaninsulinendogen.DemikianjugayangterjadipadaDMT2.Meskipun pada pasien DMT2 belum terjadi kekurangan insulin endogen yang mutlak, namun dalam perjalanannya sebagian besar akan membutuhkan insulin untuk mengendalikan glukosa darahnya. Pengetahuan dasar mengenai terapi insulin penting diketahui oleh semua dokter, diantaranya meliputi jenis, farmakokinetik, rejimen, keuntungan, kendala, keamanan, dan efek samping penggunaan insulin. Keuntungan penggunaan insulin adalah bahwa insulin merupakan obat alamiah (suplemen insulin endogen) dan dapat digunakan menyerupai pola sekresi insulin endogen oleh sel beta, serta dosisnya tidak ada batasnya. Kendala utama dari terapi insulin adalah karena bentuknya masih dalam bentuk suntikan dan harganyarelatiflebihmahaldibandingkanobathipoglikemikoral.Walaupunparaahlitelah berusaha meneliti sediaan bukan suntikan, seperti inhalan, tempelan di kulit, dan tablet, PENDAHULUAN

namun kenyataannya baru bentuk suntikan yang sudah sempurna dan tersedia di Indonesia. Bukukonsensusinidapatdigunakansebagaipanduanbagidokterspesialispenyakitdalam, konsultan endokrin, dan spesialis lainnya dalam pengelolaan pasien diabetes yang membutuhkan insulin. Sedangkan untuk memulai terapi insulin pada pasien diabetes melitus tipe 2 di tingkat layanan primer dapat digunakan panduan pada buku Konsensus PengelolaandanPencegahanDiabetesMelitusTipe2.

II. Insulin merupakan obat tertua yang digunakan untuk pengobatan diabetes, yakni sejak tahun 1922.Insulinjugamerupakantonggaksejarahyangamatfenomenaldalambidangkedokteran. Awalnyainsulindibuatdariekstrakbinatang,sepertibabidansapi.Kemudiandengankemajuan teknologi berhasil dibuat insulin manusia dengan teknologi rekayasa genetik yang kemudian dipasarkan pada tahun 1980an. Seiring perjalanan waktu, insulin sebagai terapi terus dikembangkan dengan harapan kerjanya dapat menyerupai insulin endogen. Sehingga pada pertengahantahun1990andiperkenalkaninsulinanalogpertamadengankerjacepat. Saatinidipasarantersediaberbagaijenisinsulin.Ditinjaudariasalnya,terdapatinsulinmanusia dan insulin analog (sudah direkayasa dengan kerja yang lebih baik dari insulin manusia). Sedangkan biladitinjau dari segi kerjanyaterdapatinsulinkerjapendek(insulinmanusia)atau cepat (insulin analog), kerja menengah (insulin manusia), dan kerja panjang (insulin analog). Insulinkerjapendekataucepatseringdisebutdenganinsulinprandialkarenadigunakanuntuk menurunkan glukosa darah setelah makan, sedangkan insulin kerja menengah dan panjang seringdisebutinsulinbasalkarenadigunakanuntukmenurunkanglukosadarahdalamkeadaan puasa dan sebelum makan. Selain itu di pasaran juga tersedia insulin campuran (premixed). Insulin campuran ini merupakan campuran antara insulin kerja pendek dan kerja menengah (insulin manusia) atau insulin kerja cepat dan kerja menengah (insulin analog). Umumnya campurantersediadenganperbandingantetapantarainsulinkerjapendekataucepatdankerja menengah(25%:75%atau30%:70%). Mengenal farmakokinetik setiap insulin yang tersedia adalah wajib bagi dokter dalam praktik seharihari.Halinibertujuanagarsetiapdokterdapatmemanfaatkaninsulindenganbaiktanpa efeksampingyangserius.Yangperludiketahuiterkaitfarmakokinetikinsulinadalahawalkerja, puncak kerja, dan lama kerja. Sesuai dengan karakteristiknya, setiap insulin dapat dipilih dan digunakan sesuai dengan kebutuhan pasien. Jenis dan profil kerja insulin dapat dilihat pada TabelII.1sedangkanperbandinganfarmakokinetikberbagaiinsulineksogendapatdilihatpada GambarII.1. FARMAKOKINETIKOBATINSULIN

TabelI.1.Farmakokinetiksediaaninsulin InsulinManusiaatauInsulinAnalog Kerjacepat(insulinanalog) Insulinlispro(Humalog) Insulinaspart(Novorapid) Insulinglulisin(Apidra) Kerjapendek(insulinmanusia,insulinreguler) HumulinR Actrapid Kerjamenengah(insulinmanusia,NPH) HumulinN Insulatard Kerjapanjang(longinsulinanalog) Insulinglargine(Lantus) Insulindetemir(Levemir) Campuran(premixed,insulinmanusia) 70/30Humulin(70%NPH,30%reguler) 70/30Mixtard(70%NPH,30%reguler) Campuran(premixed,insulinanalog) 75/25Humalog(75%NPL,25%lispro) 70/30Novomix(70%protamineaspart,30%aspart) 0,20,5 0,20,5 0,51 14 14 13 Hampirtanpa puncak 312 1,54 410 ProfilKerja(jam) Awal 0,20,5 0,20,5 0,20,5 0,51 Puncak 0,52 0,52 0,52 0,51

NPH,neutralprotamineHagedorn;NPL,neutralprotaminelispro.DimodifikasidariMooradian et al. Ann Intern Med 2006; 145: 12534. Nama obat disesuaikan dengan yang tersedia di Indonesia

GambarII.1.Profilfarmakokinetikinsulinmanusiadaninsulinanalog. Tampakawaldanlamakerjarelatifberbagaijenisinsulin.Lamakerjanyabervariasiantardan intraindividu.HirshIB.NEnglJMed2005;352:17483

III. EFEKINSULINDANMANFAATTERAPIINSULIN A. EfekInsulin Sudah lama diketahui bahwa insulin mempunyai efek metabolik terhadap metabolisme karbohidrat, lipid dan protein. Secara umum insulin bersifat anabolik, yang diantaranya berfungsiuntukmemasukkanglukosakedalamseldanmencegahpelepasanglukosaolehhati, mencegahlipolisis,danmeningkatkansintesisprotein. Kini,insulintidaksajadikenalmempunyaiefekmetabolismesepertidiatas,namunjugaterlibat dalam berbagai efek di dalam tubuh. Insulin mempunyai efek antiinflamasi dengan menekan faktortranskripsiproinflamasisepertinuclearfactor(NF)kB,Egr1,danactivatingprotein1(AP 1). Di dalam tubuh, insulin menekan NFkB binding activity, terbentuknya spesies oksigen reaktif, kadar intercellular adhesion molecule1 dan monocyte chemotactic protein1, matrixmetalloproteinase9, tissue factor (TF), PAI1, interleukin (IL)1b, IL6, macrophage migrationinhibitionfactor (MIF), dantumornecrosisfactor (TNF)a. Disampingitu,insulinjuga mempunyaiefekantiapoptosis,protektifterhadapjantung.Efekinsulinyanglaindanmanfaat pemberianinsulindapatdilihatpadaGambarIII.1.

Efek Biologis Lain Insulin

Gambar III.1. Efek baru insulin dengan sasaran sel endotel, platelet, dan leukosit yang menghasilkanvasodilatasi,antiagregasiplatelet,efekantiinflamasi,danefekterkaitlainnya. DandonaPetal.Circulation2005;111:144854. 6

B. HiperglikemiaSebagaiPetandaLuaranKlinik Hiperglikemiapadapasienyangdirawatdirumahsakitmerupakankeadaanyangcukupsering ditemukan. Kadar glukosa darah yang tinggi merupakan keadaan yang serius, walaupun sebelumnya tidak ditemukan riwayat diabetes. Adanya hiperglikemia merupakan petanda pentingburuknyaluaranklinis(morbiditasmaupunmortalitas)pasien,baikdenganatautanpa riwayat diabetes sebelumnya. Penelitian Umpierrez et al. (2002) merupakan contoh yang baik bagaimanahubunganantarahiperglikemiadenganluaranklinikbagipenderitayangdirawatdi rumahsakit.Penelitianretrospektiftersebutmenunjukkanbahwapasienyangdirawatdirumah sakit dengan hiperglikemia yang baru terdiagnosis mempunyai angka mortalitas yang lebih tinggi dibandingkan dengan pasien yang telah diketahui menderita diabetes dan pasien normoglikemia(GambarIII.2).

Gambar III.2 Persentase mortalitas pasien yang dirawat di rumah sakit dengan normoglikemia,diabetesyangtelahdiketahui,danhiperglikemiayangbaruterdiagnosis,baik yangdirawatdibangsalmaupundiruangrawatintensif. Umpierrezetal.JClinEndocrinolMetab2003;87:97882,. Hiperglikemia berdampak buruk terhadap luaran klinis karena dapat menyebabkan gangguan fungsi imun sehingga lebih rentan terhadap infeksi, perburukan sistem kardiovaskuler, trombosis, peningkatan inflamasi, disfungsi endotel, stres oksidatif, dan kerusakan otak. Stres oksidatif merupakan keadaan yang sering ditemukan pada diabetes dan diduga sebagai salah satu penyebab penting dalam terjadinya komplikasi diabetes. Hiperglikemia akut dapat menyebabkanstresoksidatifdanpeningkatangenerasistresoksigenreaktifakanmengaktifkan faktor transkripsional, faktor pertumbuhan, dan mediator sekunder. Melalui jejas jaringan secara langsung atau melalui aktivasi mediator sekunder, stres oksidatif akibat hiperglikemia menyebabkanjejasseldanjaringan(GambarIII.3). 7

GambarIII.3. Hubunganantarahiperglikemiadanburuknyaluaranrumahsakit. ALB=asamlemakbebas.Clementetal.DiabetesCare2004;27:55391 c.ManfaatTerapiInsulin Berdasarkan berbagai hasil uji klinik, terbukti bahwa terapi insulin dapat memperbaiki luaran klinik pada pasien dengan hiperglikemia. Hal ini dapat dimengerti karena insulin, di samping dapatmemperbaikistatusmetabolikterutamaperbaikankadarglukosadarah,jugamempunyai efeklainyangmenguntungkanbagipasien,sepertidiuraikandiatas. Infus insulin (glukosainsulinkalium) terbukti dapat memperbaiki luaran klinik pasien gawat yang dirawat di ruang terapi intensif akibat penyakit jantung atau stroke. Hal ini terutama disebabkanolehpenurunanangkakejadiangagalorganmultipelakibatsepsis.Padapasienkritis bedah yang dirawat di ruang terapi intensif dengan hiperglikemia juga menunjukkan luaran klinik seperti mortalitas di rumah sakit secara keseluruhan, sepsis, gagal ginjal akut yang membutuhkan dialisis atau hemofiltrasi, transfusi sel darah merah, polineuropati, penurunan penggunaan ventilasi mekanis yang berkepanjangan, dan lama perawatan di ruang terapi intensif. Ujiklinikbelakangan,menunjukkanbahwakendaliglukosadarahyangterlaluketatpadapasien kritisataugawatmedikyangdirawatdiruangterapiintensifmenunjukkankematianyanglebih tinggi. Hal ini dikaitkan dengan kejadian hipoglikemia yang lebih sering terjadi pada pasien dengan sasaran glukosa darah yang lebih ketat. Buruknya luaran bukan dikaitkan secara langsungdenganterapiinsulin,namunterletakpadasasaranterapi. 8

IV.TERAPIINSULINUNTUKPASIENDIABETESMELITUSRAWATJALAN A. IndikasiTerapiInsulin Diabetes merupakan penyakit yang progresif, di mana tanpa pengelolaan yang baik pasien mudahmendapatkankomplikasiakutdankronik.Kendaliglikemikyangburukmerupakansalah satu penyebab terpenting terjadinya komplikasi. Karenanya dibutuhkan strategi terapi yang lebihagresifagarkendaliglikemikyangbaikdapattercapai,baikdenganobathipoglikemikoral (OHO)ataukombinasiOHOdaninsulin(padapasienDMT2),maupundenganterapiinsulinsaja (misalnyapasienDMT1atauDMT2). TabelIV.1.Indikasiterapiinsulin IndikasiMutlak DMT1 IndiasiRelatif GagalmencapaitargetdenganpenggunaankombinasiOHOdosisoptimal(36bulan) DMT2rawatjalandengan: Kehamilan Infeksiparu(tuberkulosis) Kakidiabetikterinfeksi Fluktuasiglukosadarahyangtinggi(brittle) Riwayatketoasidosisberulang Riwayatpankreotomi Selainindikasidiatas,terdapatbeberapakondisitertentuyangmemerlukanpemakaianinsulin, sepertipenyakithatikronis,gangguanfungsiginjal,danterapisteroiddosistinggi B. KonsepInsulinBasaldanInsulinPrandial Pada orang normal, jumlah insulin yang disekresi oleh sel beta (insulin endogen) terutama dipengaruhiolehkeadaanpuasadanmakan.Padakeadaanpuasaatausebelummakan,selbeta mensekresiinsulinpadakadartertentuyanghampirsamasepanjangwaktupuasadansebelum makan.Konsepinidisebutdenganinsulinbasal,yangbertujuanuntukmempertahankankadar glukosadarahpuasaatausebelummakanselaludalambatasnormal(padaorangnormalkadar glukosa darah dibawah 100 mg/dL). Pada setiap kali makan (makan pagi, makan siang, dan makan malam) ketika glukosa darah naik akibat asupan dari luar, dibutuhkan sejumlah insulin yangdisekresikanolehselbetasecaracepatdalamkadaryanglebihtinggiuntukmenekankadar

glukosa darah setelah makan agar tetap dalam batas normal (tidak lebih dari 140 mg/dL). Konsep ini disebut insulin prandial (setelah makan) yang bertujuan untuk mempertahankan kadarglukosadarahsetelahmakantetapdalambatasnormal. Padaorangdiabetes,baikDMT1maupunDMT2,terjadikekuranganbaikinsulinbasalmaupun insulin prandial endogen. Berdasarkan konsep ini, sedian insulin eksogen disesuaikan dengan kebutuhansepertihalnyapadaorangnormal,yaituinsulinbasal(yangbekerjamenengahatau panjang) dan insulin prandial (yang bekerja pendek/cepat). Insulin basal eksogen umumnya diberikansebanyak1sampai2kalisehari,sedangkaninsulinprandialeksogendiberikansetiap kalisebelummakan. C. MemulaidanAlurPemberianTerapiInsulin C.1.DiabetesMelitusTipe1 SemuapasienDMT1diberikanterapiinsulinbegitudiagnosisditegakkan.Karenapadapasienini ditemukan kekurangan insulin secara mutlak, maka seluruh kebutuhan insulin tubuh harus diganti dari luar. Prinsipnya, pada DMT1 terjadi kekurangan insulin endogen baik basal (pada saat puasa atau sebelum makan) maupun prandial (setelah makan); oleh karena itu terapi insulinyangdiberikanharusmengandungduakomponeninsulintersebut.Disampingitu,agar sesuaidenganpolasekresiinsulinendogen,makaterapiinsulinwajibdiberikanmultipelsesuai denganjadwalmakan.Untukmenurunkankadarglukosadarahsetelahmakandigunakaninsulin prandialdanuntukmempertahankankadarglukosabasaldigunakaninsulinbasal. Pada umumnya, dosis insulin yang diberikan pada pasien DMT1 yang baru adalah 0,5 unit/kgBB/hari.Kemudiandosisinsulinhariantotalberdasarkanperhitunganini,dibagimenjadi 60% bagian yang diberikan dalam bentuk insulin prandial (selanjutnya dibagi tiga, diberikan sebelummakanpagi,makansiangdanmakanmalam)dan40%bagiandiberikandalambentuk insulin basal pada malam hari. Insulin basal yang bekerja intermediet jika diberikan satu kali sebaiknyadiberikanmalamhari,namundemikianjugabisadiberikanduakalisehariyaitupagi dan malam hari. Untuk insulin basal yang bekerja panjang (mendekati 24 jam) dapat juga diberikan pada pagi hari, yang penting waktunya tetap. Contoh perhitungannya terlihat pada GambarIV.1.

10

GambarIV.1.MemulaiterapiinsulininjeksimultipelharianpadapasienDMT1. ChengandZinman,JoslinsDiabetesMellitus,2005. Walaupun ada rejimen baku terapi insulin pada pasien DMT1 yaitu dengan tiga kali suntikan insulin prandial sebelum makan dan suntikan insulin basal pada malam hari, namun berbagai variasi rejimen dapat diberikan sesuai dengan kenyamanan dan kebutuhan kendali glikemik pasien seperti yang dianjurkan oleh Cheng and Zinman (Tabel IV.1). Yang paling prinsip dalam rejimeniniadalahwajibadainsulinprandialdaninsulinbasal,tidakbolehhanyadiberikansalah satu jenis insulin. Dan, tidak dianjurkan memberikan terapi insulin hanya dengan dua kali suntikan,karenaamatsulitmencapaikendaliglikemikyangbaikdengancaratersebut.Rejimen terapi insulin pada pasien DMT1 juga dapat diberikan dengan menggunakan pompa insulin (continuoussubcutaneousinsulininfusion[CSII])yangdosisinsulinnyadapatdiaturbaikdengan caramanualmaupunautomatis. TabelIV.2.BerbagairejimensuntikaninsulinmultipelpadapasienDMT1 Sebelummakan pagi IP IP+IB IP+IB IP+IB Sebelummakan siang IP IP Tanpainsulin IP+IB Sebelummakan malam IP IP IP IP+IB IB IB IB Tanpainsulin Sebelumtidur

IP=insulinprandial(reguler,lispro,aspart,glulisine);IB=insulinbasal(NPH,glargine,detemir). ChengandZinman.JoslinsDiabetesMellitus,2005

11

C.2DiabetesMelitusTipe2 Terapi insulin pada pasien DMT2 memang mempunyai kendala tersendiri, baik berasal dari dokternyamaupundaripasiennya.TersedianyaberbagaiOHOjugamenjadisalahsatukendala keterlambatan pemberian terapi insulin, walaupun sebenarnya sudah ada indikasi.Meskipun demikian,tidaksemuapasienDMT2membutuhkaninsulin.Sangattergantungderajatglikemik dankepatuhanpasiendalammelaksanakanprinsippengelolaandiabetes(perbaikanpolahidup di samping konsumsi obat). Prinsip dasar dari tujuan pengelolaan diabetes adalah sasaran glikemik; karenanya keberhasilan segala bentuk terapi adalah tercapainya kendali glikemik (A1C). Untuk mencapai A1C yang baik, dibutuhkan seni pengobatan untuk mencapai sasaran yang baik dari kadar glukosa darah baik dalam keadaan puasa atau sebelum makan maupun kadarglukosadarahsetelahmakan. Pertanyaan tentang kapan memulai terapi insulin pada pasien DMT2 memang tidak selalu mudahdijawab.Walaupundemikian,darihasilberbagaiujiklinikpalingtidakadaduaasosiasi besar(ADAEASD,2009danAACE/ACE,2009)yangtelahmengeluarkankesepakatanyangdapat digunakansebagaiacuandasar.BerdasarkankesepakatanADAEASD,untukpasienDMT2baru wajibdiberikanterapipolahidupdanmetformin(Langkah1).Jikadalamkurunwaktu23bulan sasaran terapi belum tercapai (A1C <7%), maka dapat ditambahkan obat oral yang lain atau ditambah insulin basal (Langkah 2). Dan jika dalam kurun waktu 23 bulan berikutnya kendali glikemikbelumjugatercapai,makadiberikanterapiinsulinintensif(basalplus/bolus)(Langkah 3) (Gambar IV.2). Jika telah memulai dengan terapi insulin intensif, maka obat oral golongan pemicu sekresi insulin (insulin secretagogues) seperti sulfonilurea dan glinid hendaknya dihentikan atau dosisnya dikurangi dan dihentikan kemudian, karena tidak menunjukkan efek sinergistik. Ada pertimbangan khusus untuk pasien dengan kendali amat buruk disertai katabolisme, misalnya kadar glukosa darah puasa diatas 250 mg/dl, kadar glukosa darah acak diatas 300 mg/dl, A1C >10%, atau gejala diabetes yang nyata (poliuria, polidipsia, dan berat badan menurun), maka terapi insulin dengan kombinasi pola hidup merupakan terapi pilihan. Pasien tersebut mungkin DMT1 yang belum dikenal atau DMT2 dengan defisiensi insulin yang berat. Terapi insulin secara titrasi diberikan sampai sasaran kadar glukosa darah tercapai dengan cepat.Dansetelahgejalagejalamenghilangdansasaranglukosadarahtercapai,obatoraldapat ditambahkandaninsulinmungkinbisadihentikan.Sedikitvariasisepertiyangdianjurkanoleh 12

AACE/ACE di mana terapi insulin untuk pasien DMT2 baru terdiagnosis juga didasarkan atas kendaliglikemik(A1C>9).

GJK=gagaljantungkongestif. GambarIV.2.AlgoritmepengelolaanDMT2. NathanDMetal.DiabetesCare2009;32:193203. D. StrategiPraktisTerapiInsulin D.1.Insulinbasal Saat ini tersedia beberapa insulin basal di pasar Indonesia, yaitu insulin NPH manusia (kerja menengahatauintermediet),insulinanalogglarginedandetemir(kerjapanjang).Dibandingkan denganinsulinbasalanalog,insulinbasalNPHmempunyaivariasipenyerapanyanglebihlebar dari hari ke hari, tidak cukup panjang kerjanya hingga kurang memadai sebagai insulin basal ideal(bekerjaselama24jam),danlebihseringmenyebabkanefeksampinghipoglikemia. Dosisinsulinbasalpadaawalpemberiannyaadalah10unitperhari,yangdapatdiberikanpada saat sebelum tidur (kerja menengah atau panjang) atau pagi hari (kerja panjang). Untuk penyesuaian dosis harian, dosis insulin dapat dinaikkan 2 unit setiap tiga hari jika sasaran glukosa kadar darah puasa belum tercapai (antara 70130 mg/dl). Dapat juga dinaikkan 4 unit setiaptigaharijikakadarglukosadarahpuasamasihdiatas180mg/dl(TabelIV.2).

13

TabelIV.3.Carapraktispenyesuaiandosisinsulinbasal Kadarglukosadarahpuasa(mg/dl) <70 70130 >130 >180 D.2.Insulinbasalplusdanbasalbolus Seperti telah disebutkan diatas, jika sasaran glikemik belum tercapai dalam waktu 23 bulan, diberikanterapiinsulinyangintensif.Dalampemahamaniniinsulintambahandiberikanuntuk memperbaiki kendali glikemik, yaitu dengan insulin prandial; konsep ini dikenal dengan nama basalplusdanbasalbolus,tergantungdariberapakalidibutuhkaninsulinprandialtambahan. Yang dimaksud dengan basalplus adalah penambahan insulin prandial untuk menurunkan kadarglukosadarahsetelahmakanketikapemberianinsulinbasaldanobatoralgagalmencapai sasaran glikemik akibat pengaruh kadar glukosa darah setelah makan (pada keadaan ini umumnyakadarglukosadarahpuasatelahmencapaisasaran).Insulinprandialdapatdiberikan satu, dua, atau tiga kali mengikuti pola makan. Pemberian satu kali insulin prandial dapat diberikan untuk menurunkan glukosa darah dua jam sesudah makan pada porsi makan yang menaikkanglukosadarahprandialtertinggi(kadarglukosadarah12jamsetelahmakandiatas 160180mg/dl).Ataudalampraktikseharihari,jikakadarglukosadarahtidakbisadiukursetiap saat, maka insulin prandial ini bisa diberikan pada saat makan dengan jumlah makanan terbanyak. Jika ada dua kadar glukosa darah setelah makan yang belum mencapai sasaran, makainsulinprandialdapatdiberikanduakali.Jikadiperlukanpemberianterapiinsulinprandial sebanyaktigakalidalamsehari,makainidisebutdengankonsepbasalbolus(insulinbasal+ tiga prandial). Insulin prandial yang diberikan dimulai dengan dosis 4 unit sehari dan dapat disesuaikan(dinaikkandosisnyasebanyak2unit)setiap3harijikasasaranglukosadarahsetelah makanbelumtercapai(GambarIV.3).Penggunaankonsepbasalbolusiniharusdisertaidengan pemahamanperencanaanmakanyangtepatdanpemantauanglukosadarahyangketat.Basal bolus dapat juga digunakan lebih awal pada keadaan tertentu seperti: DMT1, kontrol glukosa darahyangburuk,dimanadibutuhkanpenurunankadarglukosadarahsecaracepat. Dosisinsulinbasal Turunkandosis2unit Pertahankandosis Naikkandosis2unittiap3hari Naikkandosis4unittiap3hari

14

InsulinBasal sekalisehari Obatoraltetap dilanjutkan

Gambar IV.3. Langkah pendekatan terapi pasien DMT2 dengan konsep insulin basal, basal plusdanbasalbolus. ModifikasidariRaccahD.DiabetesObMet2008;10:7682. D.3.Insulinpremixed Saatinitersediabeberapasediaaninsulin premixed(insulincampurantetapantarainsulinkerja pendek/cepat dan kerja menengah; insulin manusia dan analog). Insulin ini kurang dianjurkan diberikan pada pasien DMT1 oleh karena adanya kesulitan dalam pengendalian glukosa darah dan kurang fleksibel dalam pengaturan dosis insulin basal dan prandial sesuai dengan kebutuhan. Berbeda dengan pasien DMT2, karena masih ada insulin endogen (bukan kekurangan insulin mutlak), maka pemberian insulin premixed masih ada tempatnya dengan keuntungan dalam hal kenyamanan (bisa diberikan dua kali sehari). Yang perlu diperhatikan adalah kapan memulai pemberiannya dan apa keuntungan dan kerugian pemberian terapi insulinpremixeddibandingkanbasalplusataubasalbolus. Terapi insulin premixed sebagai terapi intensif setelah gagal dengan insulin basal merupakan salah satu pilihan dalam pengelolaan pasien DMT2. Oleh karena adanya keterbatasan dalam penyesuaian dosis antara insulin basal dan prandial yang terkandung tetap pada insulin premixed,makamenurutADAEASD(2009)penggunaannyatidakdianjurkanpadamerekayang baru memulai penyesuaian dosis insulin. Namun demikian, berdasarkan kesepakatan para ahli internasional (Unnikrishnan et al., 2009) pemberian insulin premixed dapat diberikan setelah gagaldenganobatoralataudenganinsulinbasal. Insulin premixed yang diberikan sekali sehari juga salah satu strategi yang cukup berhasil memperbaiki kendali glikemik, yang diberikan pada saat sebelum makan malam. Namun demikian,secaraumumhasilnyatidaksebaikjikadiberikanduaatautigakalisehari.Pemberian 15

insulin premixed sekali sehari dapat dimulai dengan penyuntikan pada saat makan terbanyak (untukorangBaratsaatmakanmalam).Biladibutuhkanduakali,makadisuntikkanpadamakan terbesaryangkedua.Carasederhanauntukmenggantiterapiinsulinbasalsekaliatauduakali sehari dengan insulin premixed dua kali sehari adalah: dosis total yang sama dengan dosis insulin sebelumnya, kemudian dibagi menjadi 2 dosis sama besar dimana setengahnya diinjeksikan pada saat sebelum makan pagi dan setengahnya diinjeksikan pada saat sebelum makan malam. Cara praktis untuk mengganti insulin premixed sekali sehari menjadi dua kali sehari adalah: bagi dosis yang diberikan dalam satu kali sehari menjadi dua (50%:50%) untuk pagi dan malam hari. Dan cara praktis untuk mengganti insulin premixed dari dua kali sehari menjaditigakalisehariadalah:tambahkan26unitatau10%dosistotalharianinsulinpremixed sebelum makan siang. Penurunan dosis pagi (2 sampai 4 unit) mungkin diperlukan setelah penambahandosissianghari.Padapenggunaaninsulinpremixedinidianjurkanuntukmentitrasi setiap tiga hari, namun untuk kepentingan praktis dapat dilakukan setiap minggu. Untuk selanjutnya secara bertahap menghentikan sulfonilurea dan tetap meneruskan metformin; glitazonsebaiknyadihentikanpadapenggunaaninsulin. E. CaraPemberianInsulin Carapemberianinsulinyangumumdilakukanadalahdengansempritinsulin(1ccdenganskala 100 unit per cc) dan jarum, pen insulin, atau pompa insulin (Continuous Subcutaneous Insulin Infusion [CSII]). Beberapa tahun yang lalu penggunaan semprit dengan jarum adalah yang terbanyak digunakan, tetapi kini banyak pasien yang lebih nyaman menggunakan pen insulin. Hal ini karena lebih sederhana dan mudah dalam penggunaannya disamping jarumnya juga lebih kecil sehingga lebih nyaman pada saat diinjeksikan. Penggunaan CSII masih terbatas di Indonesia, karena sangat membutuhkan keterampilan pasien dan harganya relatif mahal. Meskipun demikian, cara ini merupakan cara pemberian yang paling mendekati keadaan fisiologis. Penggunaan pen insulin kini lebih mudah dan nyaman dibandingkan semprit dan jarum. Penggunaannya lebih mudah dan nyaman, pengaturan dosisnya lebih akurat, dan bisa dibawa kemanamanadenganmudahpula. F. SasaranTerapi Banyak anjuran yang diajukan oleh berbagai pusat atau asosiasi keahlian dalam hal sasaran kendaliglikemik.ApayangdianjurkanolehADA(2010)merupakansalahsatuanjuranyangbisa

16

digunakandalampraktiksehariharikarenauntukpemeriksaankadarglukosadarahdigunakan darahkapiler.SasaranA1Cdibawah7%jugamerupakansasaranyangmemadaiuntukpasiendi Indonesia. Meskipun demikian, pada pasien dengan keadaan tertentu maka dapat dipertimbangkan sasaran kendali glikemik yang kurang ketat (<7,5%). Perlu diketahui dari laporanbeberapaujiklinikbesarbelakanganinibahwasasaranA1Cyangterlaluketatterutama pada usia lanjut dan penyakit kardiovaskular menyebabkan angka kematian yang lebih tinggi. Salahsatualasannyaadalahkelompokinilebihmudahjatuhkedalamkeadaanhipoglikemiadan mudahterjadifluktuasikadarglukosadarahyangmembahayakanjantungdanotak. TabelIV.4.Sasarankendaliglikemikuntukpasiendiabetesdewasa HbA1c Kadarglukosadarahkapilersebelummakan Puncakkadarglukosadarahkapilersetelahmakam <7.0% 70130mg/dL(3.97.2mmol/l) <180mg/dL(<10.0mmil/l)

*Kadarglukosadarahsetelahmakandiukur12jamsetelahmemulaimakan,yangbiasanya merupakankadarpuncakpadapasiendiabetes. ADA,DiabetesCare2010;33:S11S61 Beberapakeadaanyangperludipertimbangkandalammencapaisasarankendaliglikemik: A1Cmerupakansasarankendaliglikemikutama Sasaranhendaknyaberdasarkankeadaanindividu: o o o o o o Untuk pasien wanita dengan DM gestasi, berdasarkan rekomendasi the Fifth International WorkshopConference on Gestational Diabetes (2007), sasaran kadar glukosa darah kapiler sebelummakanadalah<95mg/dL,1jamsesudahmakan<140mg/dL,atau<120mg/dLpada2 jam setelah makan. Untuk wanita yang memang telah diketahui menderita DMT1 atau DMT2 17 Lamadiabetes Usia/harapanhidup Keadaankomorbid Telahmempunyaikomplikasipenyakitkardiovaskularataumikrovaskularlanjut Hipoglikemiayangtidakdisadari(unawareness) Pertimbanganpasien

Padaindividutertentu,kendaliglikemikbiaslebihataukurangketat JikaA1Cbelummencapaisasaran,makaglukosadarahsetelahmakandapatdijadikan sasaranpengobatanwalaupunsasarankadarglukosadarahsebelummakantelahtercapai

sebelum hamil, direkomendasikan sasaran kadar glukosa darah, jika dapat dicapai tanpa hipoglikemia, adalah glukosa darah sebelum makan, waktu tidur, dan sepanjang malam (overnight glucose) antara 6090 mg/dL; glukosa darah puncak sesudah makan (peak post prandialglucose)antara100129mg/dL;danA1C<6%(TabelIV.5). TabelIV.5.SasaranglukosadarahuntukDMgestasional,danwanitahamildenganDMT1dan DMT2 WaktuPemeriksaan Sasaran GlukosaDarah DMgestasional Puasa SatuJamsetelahmakan Duajamsetelahmakan DMT1danDMT2 Sebelummakan,waktutidurdansepanjangmalam (overnightglucose) Puncaksetelahmakanantara (peakpostprandialglucose) *A1C<6%,dengancatatantidakterjadihipoglikemia. ADA,DiabetesCare2010;33:S11S61 100129mg/dL <95mg/dL <140mg/dL <120mg/dL 6099mg/dL

18

V.TERAPIINSULINUNTUKPASIENHIPERGLIKEMIAYANGDIRAWATDIRUMAHSAKIT Terapi insulin untuk pasien yang dirawat inap tidak saja ditujukan untuk pasien yang telah diketahuimenderitadiabetes,tetapijugapasiendenganhiperglikemiayangbarudiketahuisaat dirawat di rumah sakit. Mereka yang baru diketahui menderita diabetes atau hiperglikemia kalau dibiarkan maka luarannya lebih buruk (angka kesakitan dan kematian lebih tinggi) dari padamerekayangtelahdiketahuimenderitadiabetes.Dansebaliknyamempunyailuaranyang lebihbaikdaripadamerekayangsebelumnyatelahdiketahuimenderitadiabetesjikadikelola glukosadarahnyadenganbaik. Terdapat dua kelompok pasien yang dirawat di rumah sakit yakni kelompok pasien yang sakit kritisdantidakdapatmengkonsumsiobatsecaraoralsertakelompokpasienyangmasihdapat mengkonsumsi obat secara oral. Pada prinsipnya, insulin dapat digunakan pada pasien yang tidakdapatmengkonsumsiOHOdengansyaratterdapatalatpemantauanglukosadarah. A.TerapiInsulinPasienRawatInap Sebenarnya tidak semua pasien yang dirawat di rumah sakit memerlukan terapi insulin. Bagi mereka dengan penyakit ringan, di mana kendali glukosa darahnya tercapai dengan obat oral yang biasa digunakan sebelum dirawat di rumah sakit, terapi obat oralnya dapat diteruskan tanpa harus menggantinya dengan insulin. Namun demikian, sebagian besar pasien yang dirawatdirumahsakitmempunyaistresakutyangmemicupeningkatanglukosadarahseperti adanya penyakit tambahan, komplikasi dari diabetesnya atau yang akan menjalani pembedahan, sehingga memerlukan terapi insulin untuk dapat menurunkan glukosa darahnya dengan cepat. Memang, dalam keadaan yang memerlukan regulasi glukosa darah yang relatif cepat dan tepat, insulin adalah yang terbaik karena kerjanya cepat dan dosisnya dapat disesuaikandenganhasilkadarglukosadarah. Seperti halnya terapi insulin pada pasien diabetes yang menjalani rawat jalan, prinsip terapi insulin untuk pasien yang dirawat inap adalah sama. Mungkin memerlukan terapi kombinasi oral dan insulin atau insulin saja. Terapi insulin diberikan dengan cara subkutan secara terprogramatauterjadwal(tigakaliinsulinprandial,12kaliinsulinbasal,dankalaudiperlukan ditambah insulin koreksi atau suplemen). Pada keadaan tertentu misalnya karena suatu penyakit,stresataupemberianglukokortikoid,selamaperawatanterjadifluktuasikadarglukosa 19

darah dan ini memerlukan injeksi insulin prandial tambahan. Insulin prandial tambahan ini dikenaldengannamainsulinkoreksiatauinsulinsuplemen. Secaraumum,kebutuhaninsulindapatdiperkirakansebagaiberikut:insulinbasalsebanyak50% dari kebutuhan insulin harian total yaitu sekitar 0,2 unit/kg berat badan; insulin prandial sebanyak50%darikebutuhaninsulinhariantotal. Untuksebagianbesarpasienbukanpenyakitkritisyangditerapidenganinsulin,sasaranglukosa darah sebelum makan umumnya <140 mg/dL dengan glukosa darah acak <180 mg/dL, sepanjang sasaran ini dicapai dengan aman (tanpa hipoglikemia). Untuk menghindari hipoglikemia, dosis terapi insulin hendaknya dinilai kembali jika glukosa darah turun <100 mg/dL.Jikaglukosadarahturundibawah70mg/dL,harusdilakukanmodifikasidosis. Pemantauanglukosadarahditempatrawatdenganglukometerdilakukansebelummakandan waktu tidur bagi sebagian besar pasien dengan pola makan seperti biasa. Pasien yang mendapatkan nutrisi enteral berkesinambungan (continuous enteral feeding) atau nutrisi parenteral, pemantauan glukosa darah dilakukan setiap 4 jam. Hingga saat ini belum ada rekomendasi yang mutlak mengenai kapan menggunakan pemantauan glukosa darah mandiri. Hal ini tergantung dari individu, keadaan penyakit, regimen pengobatan, stabilitas gula darah, serta biaya. Langkah pertama dalam melakukan pemantauan glukosa darah mandiri adalah melakukan beberapa kali pemeriksaan glukosa darah dalam satu minggu, yakni pada saat sebelum sarapan, 1,52 jam setelah sarapan, sebelum makan siang, 1,52 jam setelah makan siang, sebelum makan malam, 1,52 jam sesudah makan malam, dan sebelum tidur. Langkah kedua adalah membuat kurva dari hasil pemeriksaan glukosa darah tersebut. Dilanjutkan dengan langkah ketiga berupa modifikasi pola hidup dan mengevaluasi pengaruhnya pada glukosa darah, sebagai contoh: sebelum dan 1,52 jam sesudah mengkonsumsi makanan yang baik/buruk,sebelumdansesudahmelakukanaktivitasfisik,pengaruhjalankakiselama15menit sebelum makan pada glukosa darah, dan pengaruh jalan kaki sore hari pada glukosa darah puasapagihari. B.TerapiInsulinIntensifPadaPasienKritis B.1.Sasaranglukosadarah StuditerakhiryangdilakukanolehADA(2010)menunjukkanbahwasasaranglukosadarahuntuk pasien kritis yang dirawat di ruang terapi intensif secara umum adalah antara 140180 mg/dL 20

(Tabel V.1). Kadar glukosa darah yang sedikit lebih rendah mungkin bermanfaat pada pasien tertentu (misalnya pada pasien kritis bedah), namun sasaran glukosa darah <110 mg/dL tidak dianjurkan. Tabel V.1. Kadar glukosa darah memulai terapi insulin infus intravena dan sasaran glukosa darahuntukpasienkritisyangdirawatdiruangterapiintensif Kadarglukosadarahmemulaiterapi Sasaranglukosadarah B.2.Carapemberiandanprotokolterapiinsulin Terapi insulin secara infus intravena sebaiknya tidak diberikan pada mereka yang dirawat di ruangan tanpa fasilitas glukometer. Dalam konteks perawatan intensif, infus insulin intravena berkesinambunganmerupakancarayangpalingefektifuntukmencapaisasaranglukosadarah. Idealnya insulin intravena diberikan melalui protokol tertulis atau terkomputerisasi yang tervalidasi agar memungkinkan penyesuaian laju insulin infus berdasarkan fluktuasi glukosa darah dan dosis insulin. Keberhasilan perawatan pasien seperti ini sangat tergantung dari kepiawaian staf dan tinjauan periodik data pasien. Berbagai macam protokol tersedia di masingmasing pusat atau yang dianjurkan oleh peneliti, salah satu dapat diikuti atau dimodifikasi sesuai dengan protokol lokal atau sesuai dengan sarana yang tersedia. Protokol manapun yang diacu, yang penting hindari pasien jatuh ke hipoglikemia. Walaupun demikian, luaranyangburukdarimerekayangdirawatdiruangterapiintensifinibukanhanyadisebabkan olehkarenahipoglikemia. Faktorfaktorlainnyayangmenyumbangluaranpasienadalah: sistempemantauan, fluktuasikadarglukosadarah, hipokalemia, asupanhipokalorikselamaperawatan(tunjangannutrisiyangkurangadekuat), hipotensiatauhipovolumia, dan berbagai macam keadaan morbid yang mendasari (gangguan saluran cerna, gagal hatiatauginjal,defisiensihormonkontraregulasiglukosaakibatinsufisiensipituitaridan adrenal). >180mg/dL 140180mg/dL

21

Pasienyangmendapatkanterapiinsulininfusintravenabiasanyaakanmembutuhkantransisike insulin subkutan jika mereka memulai memakan makanan biasa atau mereka akan pindah ke ruang biasa. Biasanya, dosis insulin subkutan diberikan antara 7580% dari dosis insulin infus intravena harian total, yang kemudian dibagi proporsional menjadi komponen basal dan prandial. Perlu dicatat, bahwa insulin subkutan harus diberikan 14 jam sebelum infus insulin intravenadihentikanuntukmencegahhiperglikemia(TabelV.2). Tabel V.2. Contoh perhitungan perubahan dosis insulin dari pemberian infus intravena ke subkutan Misalnya pasien yang diterapi dengan insulin infus intravena adalah 2 unit/jam dalam 6 jamterakhir,berartidosisinsulinhariantotaladalah48unit Kebutuhan insulin subkutan adalah 80% dari insulin harian total yang diberikan secara infusintravena:80%x48unit=38unit Dosisinsulinbasalsubkutan:50%dari38unit=19unit Dosisinsulinprandial:50%dari38unit=19unit;dibagitigamasingmasing6unitsetiap kalisebelummakan(makanpagi,siangdanmalam) ADA,DiabetesCare2010;33:S11S61

22

VI.TERAPIINSULINPADAPASIENPERIOPERATIF

Hiperglikemia

Dosisinisialbolusdandrip:2 GDawaldibagi100,dibulatkanke0,5 Persiapan: PemeriksaanGDper12jam terdekat. Syringepump,spuit50mL Target:GD150200atau Misal:GD236236:100=2,362,5U Buatlarutanregular GD/jam50100 Bolusiv:2,5U insulin1unit/1mLNaCL (selamaGD>200) Drip2,5U/jam 0,9%1 CekGD12jambedside

Targettercapai Dosistetap GD<100 GD100149

Targettidaktercapai

GD>200

GD>100

GD<60

GD6080

GD8199

Dosis50%

DripstopBolus D40%1flInfus D5%/8j

Dripstop BolusD40%fl InfusD5%/8jam

Dripstop+ infusD5%/8jam

GD>400:+34U Dosis50% GD300400:+12U GD200299:+0,5 1U

CekGDtiap15menit

Targettercapai

GD>1001jamkemudiantetap>100drip insulindimulaikembali50%daridosisterakhir. InfusD5%stop

Targettidak tercapai

23


Catatan: Dosisbolusinisial:GDawaldibagi100dandibulatkanke0,5Uterdekat Contoh:GD236dosisbolus236:100=2,362,5U GD281dosisbolus281:100=2,813U Bilainsulinstop,evaluasiGDtiapjam BilaGDbelummencapai100protokolhipoglikemiaditeruskan. BilacekulangGD>1001jamberikutnyadripinsulindimulaikembalidengandosis 50%daridosisterakhir.

PenilaiandanpenyesuaianolehdoktermasihdiperlukanuntukkasuskasusekstrimatauGDyang fluktuatifdansulitdiprediksi.

24

VII.TERAPIINSULINPADAKETOASIDOSISDIABETIKDANSTATUSHIPERGLIKEMIA HIPEROSMOLAR A. DefinisidanDiagnosis Ketoasidosis diabetik (KAD) dan status hiperglikemia hiperosmolar (SHH) merupakan komplikasimetabolikakutpalingseriuspadapasiendiabetesmelitus.Manifestasiutamanya adalahkekuranganinsulindanhiperglikemiayangberat.SHHterjadiketikadefisiensiinsulin yang relatif (terhadap kebutuhan insulin) menimbulkan dehidrasi dan akhirnya menyebabkankondisihiperosmolaritas.KADterjadibilakekuranganinsulinyangberattidak saja menimbulkan hiperglikemia dan dehidrasi yang berat, tapi juga mengakibatkan produksi keton meningkat serta asidosis. Diagnosis KAD ditegakkan bila ditemukan hiperglikemia(>250mg/dL),ketosisdarahatauurin,danasidemia(pH<7,3). B. Terapi Terapi bertujuan mengoreksi kelainan patofisiologis yang mendasari, yaitu gangguan keseimbangan cairan dan elektrolit, kadar glukosa darah, gangguan asam basa, serta mengobatifactorpencetus.PrinsipterapiKADdanSHHterdiridaripemberiancairan,terapi insulin,koreksikalium,danbikarbonat. 1. Insulininfusintravenadosisrendahberkelanjutan Insulinregularintravenamemilikiwaktuparuh45menit,sementarapemberianinsulin secaraintramuskularatausubkutanmemilikiwaktuparuhsekitar24jam.Insulininfus intravena dosis rendah berkelanjutan (continuous infusion of low dose insulin) merupakan standar baku pemberian insulin di sebagian besar pusat pelayanan medis. PanduanterapiinsulinpadaKADdanSHHdapatdilihatpadatabel Pemberianinsulininfusintravenadosisrendah48unit/jammenghasilkankadarinsulin sekitar100U/mLdandapatmenekanglukoneogenesisdanlipolisissebanyak100%. Cara pemberian infus insulin dosis rendah berkelanjutan dikaitkan dengan komplikasi metabolik seperti hipoglikemia, hipokalemia, hipofosfatemia, hipomagnesemia, hiperlaktatemia, dan disekuilibrium osmotik yang lebih jarang dibandingkan dengan caraterapiinsulindengandosisbesarsecaraberkalaatauintermiten. 25

2. Insulinintramuskular Penurunan kadar glukosa darah yang dicapai dengan pemberian insulin secara intramuskular lebih lambat dibandingkan dengan cara pemberian infus intravena berkelanjutan.Terapiinsulinintramuskulardosisrendah(5unit)yangdiberikansecara berkala(setiap12jam)sesudahpemberianinsulindosisawal(loadingdose)sebesar20 mU juga merupakan cara terapi insulin pada pasien KAD. Cara tersebut terutama dijalankan di pusat pelayanan medis yang sulit memantau pemberian insulin infus intravena berkelanjutan. Pemberian insulin intramuskular tersebut dikaitkan dengan kadarinsulinserumsekitar6090U/dL. 3. Insulinsubkutan TerapiinsulinsubkutanjugadapatdigunakanpadapasienKAD.Namun,untukmencapai kadar insulin puncak dibutuhkan waktu yang lebih tahan lama. Cara itu dikaitkan dengan penurunan kadar glukosa darah awal yang lebih lambat serta timbulnya efek hipoglikemialambat(latehypoglycemia)yanglebihseringdibandingkandenganterapi menggunakaninsulinintramuskular. Padamayoritaspasien,terapiinsulindiberikansecarasimultandengancairanintravena. Apabila pasien dalam keadaan syok atau kadar kalium awal kurang dari 3,3 mEq/L, resusitasi dengan cairan intravena atau suplemen kalium harus diberikan lebih dahulu sebelum infus insulin dimulai. Infus insulin intravena 57 U/jam seharusnya mampu menurunkan kadar glukosa darah sebesar 5075 mg/dL/jam serta dapat menghambat lipolisis, menghentikan ketogenesis, dan menekan proses glukoneogenesis di hati. Kecepatan infus insulin harus selalu disesuaikan. Bila faktorfaktor lain penyebab penurunankadarglukosadarahkurangdari50mg/dL/jam,makakecepataninfusinsulin perlu ditingkatkan. Penyebab lain dari tidak tercapainya penurunan kadar glukosa darah,antaralainrehidrasiyangkurangadekuatdanasidosisyangmemburuk. Bila kadar glukosa darah sudah turun <250 mg/dL, dosis insulin infus harus dikurangi menjadi 0,050,1 U/kgBB/jam sampai pasien mampu minum atau makan. Pada tahap ini, insulin subkutan dapat mulai diberikan, sementara infus insulin harus dilanjutkan palingsedikit12jamsetelahinsulinsubkutankerjapendekdiberikan.PasienKADdan SHH ringan dapat diterapi dengan insulin subkutan atau intramuskular. Hasil terapi denganinsulininfusintravena,subkutan,danintravenaintermitenpadapasienKADdan SHH ringan tidak menunjukkan perbedaan yang bermakna dalam hal kecepatan penurunankadarglukosadanketonpada2jampertama.

26

TabelVII.1.PanduancarapemberianinsulinpadapasienKADdanSHHdewasa Pemberianawalintravena10Uatau0,15U/kgBB Infusinsulinregular(insulinkerjapendek)0,1U/kgBB/jamatau5U/jam Tingkatkandosisinsulin1Usetiap12jambilapenurunanglukosadarah<10%ataubila statusasambasatidakmembaik Kurangi dosis 12 U/jam bila kadar glukosa <250 mg/dL (0,050,1 U/kg/jam), atau keadaanklinismembaikdengancepatdankadarglukosaturun>75mg/dL/jam Janganmenurunkaninfusinsulin<1U/jam Pertahankanglukosadarah140180mg/dL Bilakadarglukosadarah<80mg/dLhentikaninfusinsulinpalinglama1jam;kemudian lanjutkaninfusinsulin Bila kadar glukosa darah selalu < 100 mg/dL, ganti infus dengan dekstrosa 10% untuk mempertahankankadarglukosa140180mg/dL Bilapasiensudahdapatmakanpertimbangkanpemberianinsulinsubkutan Insulin infus intravena jangan dulu dihentikan pada saat insulin subkutan mulai diberikan,tetapilanjutkaninsulinintravenaselama12jam Padapasienyangsebelumnyatelahmendapatinsulindanglukosadarahnyaterkendali kembalikansepertidosisawalinsulin Pada pasien yang sebelumnya tidak mendapat insulin berikan dosis subkutan 0,6 U/kgBB/24jam(50%insulinbasal+50%insulinprandial)

27

VIII.KEAMANANDANEFEKSAMPINGINSULIN A. PenggunaanPadaWanitaHamil Pemberian obatobatan pada wanita hamil selalu menjadi perhatian para dokter karena harus mempertimbangkan keamanan terhadap bayi yang dikandungnya disamping keamanan terhadap ibunya. Penggunaan insulin manusia pada wanita hamil sudah teruji keamanannya. Yang perlu diperhatikan adalah keamanan dari insulin analog yang penggunaannyarelatifbaru.Salahsatuinsulinanalogkerjacepat,aspart,telahdilakukanuji keamanan pada wanita hamil baik yang menderita DMT1 maupun DM gestasi. Ternyata obatinidisampingdapatmengendalikanglukosadarahdenganbaikjugaamanuntukbayi. Insulin glargine, jika digunakan dalam kadar terapeutik pada wanita hamil juga aman, karenatidakmelewatiplasenta. Walaupuntelahadaujicobapenggunaaninsulinanaloguntukwanitahamil,namunkarena jumlahpenelitianbelumbanyakdansampaisaatinibelumadasatupunorganisasiprofesi atau badan (seperti Balai POM atau FDA) yang telah menyatakan aman, maka sebaiknya dihindaripenggunaannyasampaikeamananditetapkan. B. Hipoglikemia Efeksampinginsulinyangpalingpentingdiperhatikanadalahhipoglikemia.Sasaranglukosa darahyangterlaluketatterutamauntukpasienyangdirawatdiruangterapiintensifsering menimbulkanefeksampinghipoglikemia.Daninidapatmemperburukluaranklinikpasien kritis.Karenanya,kiniadakecenderunganmemperendahsasaranglukosadarahyangingin dicapai untuk pasien kritis. Penggunaan insulin analog sedikit mengurangi efek samping hipoglikemia dibandingkan insulin manusia. Edukasi kepada pasien rawat jalan yang menggunakanterapiinsulinuntukmengendalikanglukosadarahnyaperludiberikandengan baik dengan harapan mengurangi kejadian hipoglikemia. Edukasi ini meliputi konsep tentang glukosa darah basal dan prandial, fungsi insulin basal dan insulin prandial, serta pemantauanglukosadarahyangmandiri. C. PeningkatanBeratBadan Peningkatanberatbadanpadapasienyangmenggunakanterapiinsulindapatdisebaboleh beberapa keadaan. Insulin sendiri merupakan hormon anabolik, penggunaannya pada pasien dengan kendali glikemik yang buruk akan meningkatkan berat badan karena

28

pemulihan masa otot dan lemak. Adanya asupan tambahan akibat kejadian hipoglikemia, atau asupan makan yang lebih banyak karena merasa menggunakan insulin juga dapat menyebabkan peningkatan berat badan. Penggunaan insulin detemir sebagai insulin basal memberikan peningkatan berat badan yang lebih rendah dibandingkan obat insulin yang lainnya. D. EdemaInsulin Edema dapat terjadi pada pasien yang memiliki kendali glikemik yang buruk (termasuk pasien dengan ketoasidosis) akibat retensi garam dan air yang akut. Edema akan menghilangsecaraspontandalambeberapahari.Kalaudiperlukanuntuksementaradapat diberikan terapi diuretik. Edema pada pemberian insulin juga dapat terjadi pada penggunaannya bersamaan dengan obat oral golongan glitazon. Kalau efek samping tersebut menyebabkan perburukan klinik, maka sebaiknya obat golongan glitazon dihentikan. E. LipoatrofiatauLipohipertrofi Suntikan insulin yang kurang murni ke dalam lemak subkutan kadangkadang dapat menyebabkan kehilangan lemak terlokalisasi. Dengan insulin yang murni yang ada belakangan ini, masalah ini jarang terjadi. Jika insulin disuntikkan di sekitar tempat yang terjadilipoatrofi,makalemaksubkutanakankembalidalambeberapabulansampaitahun. Kebalikandenganliupoatrofi,lipohipertrofimungkinterjadipadatempatsuntikan.Tempat suntikan akan membengkak akibat penumpukan lemak subkutan karena suntikan yang berulang. Sensitivitas nyeri mungkin berkurang pada tempat tersebut, juga akan terjadi peningkatan masa jaringan ikat fibrosa. Penyerapan insulin yang disuntikkan pada tempat lipohipertrofi mungkin tidak teratur dan tidak bisa diramalkan. Penyuntikan dengan cara rotasi akan menghindari kejadian lipohipertrofi. Dan jaringan yang bertambah akan berkurangsecaraperlahanbersamaandenganwaktu.

29

IXTEHNIKPENYUNTIKANDANPENYIMPANANINSULIN A.TehnikPenyuntikanInsulin Tips supaya penyuntikan tidak menyakitkan : gunakan insulin pada suhu kamar; jika menggunakan alkohol, suntik hanya ketika alkohol telah sepenuhnya kering; hindari penyuntikan pada akar rambut, gunakan jarum yang lebih pendek dan diameter lebih kecil,gunakanjarumbaru. Masukkanjarumdengangerakancepatsepertipanahmelaluikulit.Suntikkanperlahan dan pastikan bahwa plunger (jarum suntik) atau tombol (pen) telah sepenuhnya tertekan. Pada penggunaan pen, setelah menekan tombol secara penuh, pasien harus menghitungperlahansampai10sebelummenarikjarum. Jarum 5mm dan 6mm dapat digunakan oleh setiap pasien dewasa termasuk yang obesitas dan umumnya tidak memerlukan pengangkatan lipatan kulit. Selain itu sebaiknyadiberikandengansudut900terhadappermukaankulit. Namun, penggunaan lipatan kulit atau penyuntikan pada sudut 450 harus dipertimbangkanuntukinjeksianggotabadanataukeperutyanglangsing. Tidak ada alasan medis untuk merekomendasikan jarum >8mm. Terapi awal harus dimulaidenganjarumyanglebihpendek.Pasienyangsudahmenggunakanjarum>8mm harus mengangkat lipatan kulit atau menyuntikkan pada 450 untuk menghindari suntikanIM. Urutanyangoptimal:membuatlipatankulit;suntikkaninsulinperlahanpadasudut900 terhadap permukaan lipatan kulit; setelah plunger sepenuhnya tertekan (pada pen) biarkan jarum di kulit selama 10 detik; menarik jarum dari kulit; melepaskan lipatan kulit;membuangjarumsecaraaman. Pasien harus diajarkan untuk memeriksa lokasi injeksi dan mampu mendeteksi lipohipertrofi. Tidak boleh menyuntik ke dalam bidang lipohipertrofi sampai jaringan abnormal kembalinormal(dapatmemakanwaktubulanansampaitahunan) Memindahkan lokasi suntikan dari lipohipertrofi ke jaringan normal sering membutuhkanpenurunandosisinsulinyangdisuntikkan. Strategi pencegahan dan terapi yang terbaik untuk lipohipertrofi adalah dengan penggunaaninsulinmanusiadimurnikan,rotasilokalinjeksi,menggunakanzonainjeksi lebihbesar,tidakmenggunakankembalijarumyangtelahdigunakan.

30

Pasienharusdiajarkanskemarotasiyaitu:membagitempatinjeksikedalamkuadran( atau bagian bila menggunakan paha atau bokong), menggunakan satu kuadran per mingguataubagianharusberjarakminimal1cmdarisatusamalainuntukmenghindari traumaulangjaringan. Wanitahamildengandiabetes:yangmenyuntikkankedalamperutharusmemberikan suntikan dengan mengangkat lipatan kulit; hindari menggunakan lokasi perut sekitar umbilikus selama trimester terakhir; injeksi ke sisisisi perut masih dapat digunakan denganmengangkatlipatankulit. B.TehnikPenyimpananInsulin Simpaninsulinyangdigunakan(pen,cartridgeataubotol)padasuhukamar(maksimal1 bulansetelahpemakaianpertama,danbelumkadaluwarsa).Simpaninsulinyangbelum dibukadidalamkulkastetapijangandisimpandidalamfreezer. Cloudy insulin (misalnya NPH dan premixed insulin) harus secara lembut diputar dan atau dimiringkan (jangan diguncang) selama 20 siklus sampai kristal kembali larut ke dalamsuspensi(larutanmenjadiberwarnaputihsusu)

31

DAFTARPUSTAKA AmericanDiabetesAssociation.StandardsofMedicalCareinDiabetes2010.DiabetesCare 2010;33:S11S61. Balasubramanyam A. Intensive Glycemic Control in the Intensive Care Unit: Promises and Pitfalls.JClinEndocrinolMetab.February2009;94:416417. DandonaP,AljadaA,ChaudhuriA,MohantyP,GargR.MetabolicSyndrome.AComprehensive Perspective Based on Interactions Between Obesity,Diabetes, and Inflammation.Circulation 2005;111:14481454. Gisela Del Carmen De La Rosa GDC, Donado JH, Restrepo AH,Quintero AM, Gonzlez LG, SaldarriagaNE,BedoyaM,ToroJM,VelsquezJB,ValenciaJC,ArangoCM,AlemanPH,Vasquez PM, Chavarriaga JC, Yepes A,Pulido W, Cadavid CA and Grupo de Investigacion en Cuidado intensivo: GICIHPTU. Strict glycaemic control in patients hospitalised in a mixedmedical and surgical intensive care unit: a randomised clinical trial. Critical Care 2008, 12:R120 (doi:10.1186/cc7017). Griesdale DEG, de Souza RJ, van Dam RM,Heyland DK, Cook DJ, Malhotra A, Dhaliwal R, HendersonWR,ChittockDR,FinferS,TalmorD.Intensiveinsulintherapyandmortalityamong criticallyillpatients:ametaanalysisincludingNICESUGARstudydata.CMAJ2009;180:821827. Hod M,Damm P, Kaaja R, Visser GAH, Dunne F,Demidova I,Hansen AP, Mersebach H,for the Insulin Aspart PregnancyStudy Group. Fetal and perinatal outcomes in type 1 diabetes pregnancy:a randomized study comparing insulin aspart with humaninsulin in 322 subjects. Am J Obstet Gynecol2007;XXX:xxxx. MathiesenER,KinsleyB,AmielSA,HellerS,McCanceD,DuranS,BellaireS,RabenA,OnBehalf of The Insulin Aspart Pregnancy Study Group. Maternal Glycemic Control andHypoglycemia in Type 1 DiabeticPregnancy. A randomized trial of insulin aspart versus human insulin in 322 pregnantwomen.DiabetesCare2007;30:771776. 32

Moghissi ES, Korytkowski MT, Dinardo M, Einhorn D, Hellman R, Hirsch IB, Inzucchi SE, Ismail Beigi F, Kirkman MS, Umpierrez GE. American Association of Clinical Endocrinologists and American Diabetes Association Consensus Statement on Inpatient Glycemic Control. Diabetes care2009;32:11191131. Nathan DM,Buse JB, Davidson MB, Ferrannini E, Holman RR, Sherwin R, Zinman B. Medical ManagementofHyperglycemiainType2Diabetes:AConsensusAlgorithmfortheInitiationand Adjustment of Therapy. A consensus statement of the American Diabetes Association and the EuropeanAssociationfortheStudyofDiabetesDiabetesCare2009;32:193203. PollexEK,FeigDS,LubetskyA,YipPM,KorenG.PollexEKInsulinGlargineSafetyinPregnancy.A transplacentaltransferstudy.DiabetesCare2010;33:2933. RaccahD.OptionsfortheIntensificationofInsulinTherapiWhenBasalInsulinisNotEnoughin Type2DiabetesMellitus.DiabetesObMet2008;10:7682. RodbardHW,JellingerPS,DavidsonJA,EinhornD,GarberAJ,GrunbergerG,HandelsmanY,Horton ES,LebovitzH,LevyP,MoghissiES,SchwartzSS.AACE/ACEConsensusStatement.Statementby anAmerican Association of Clinical Endocrino logists /American College of

EndocrinologyConsensusPanelonType2DiabetesMellitus:AnAlgorithmforGlycemicControl AACE/ACEDiabetesMellitusClinicalPracticeGuidelinesTaskForce.AACEguidelines.American Association of Clinical Endocrinologist Medical Guidelines for Clinical Practice for The managementofDiabetesMellitus.EndocrPract2009;15:540559. The NICESUGAR Study Investigators.Intensive versus Conventional Glucose Controlin Critically IllPatients.NEnglJMed2009;360:128397. Unnikrishnan AG, Tibaldi J, HadleyBrown M, Krentz AJ, Ligthelm R,Damci T,Gumprecht J,Gero L,MuY,RazI.PracticalguidanceonintensificationofinsulintherapywithBIAsp30:aconsensus statement.JClinPract,November2009;63:15711577. Wiener RS; Wiener DC; Larson RJ. Benefits and Risks of Tight Glucose Controlin Critically Ill Adults.AMetaanalysis.JAMA.2008;300:933944.

33

TIM REVISI PETUNJUK PRAKTIS TERAPI INSULIN PADA PASIEN DIABETES MELITUS Ketua Prof. Dr. dr. Ketut Suastika, SpPD-KEMD Anggota dr. Mardianto, SpPD dr. Eva Decroli, SpPD-KEMD dr. Alwi Shahab, SpPD-KEMD dr. Em Yunir, SpPD-KEMD dr. IGN Adhiarta, SpPD-KEMD dr. Heri Nugroho, SpPD-KEMD dr. Luthfan Budi Pramono, SpPD-KEMD Prof. Dr. dr. Djoko Hardiman, SpPD-KEMD Prof. Dr. dr. Agung Pranoto, MSc., SpPD-KEMD dr. Fabiola Adam, SpPD dr. Yuanita Langi, SpPD dr. Putu Moda Arsana, SpPD-KEMD