Anda di halaman 1dari 6

Strategistrategibisnisdancontohcontohnya

Kompleksitas kehidupan perekonomian telah membawa dampak terhadap strategistrategi bisnis sebuah organisasi/perusahaan. Kondisi tersebut masih ditambahkan dengan kondisi perekonomian global yang dapat sangat cepat berubahubah arahnya. Tingkat volatilitas kondisi kehidupan sosial saat ini telah memaksa para pembuat kebijakan strategistrategi bisnis meningkatkan frekuensi mereka dalam mereview strategistrategi yang sudah ditentukan sebelumnya. Offensivedandefensive Bisnis ketika telah berhasil mencapai skala tertentu membutuhkan pemikiranpemikiran dan strategistrategi yang jauh lebih matang didalam meraih keberhasilan yang berkelanjutan. Strategi strategi yang diambil tentu saja merupakan langkah pertama yang sangat penting didalam menentukan nasib bisnis tersebut kedepannya. Seperti layaknya sebuah pertandingan sepak bola, peran serta pelatih/manager saat ini menjadi jauh lebih signifikan dibandingkan dengan era 80an maupun 90an. Ketersediaan sumber daya yang paling berlimpah sekalipun (kumpulan para bintang pemain sepakbola dalam hal ini) tidak akan menjamin keberhasilan sebuah tim didalam meraih kemenangan tanpa didukung strategi yang tepat. Kita bisa melihat bagaimana keberhasilan seorang Guus Hiddink melatih beberapa tim nasional yang hanya memiliki kemampuan teknis terbatas, tetapi dengan strategistrategi yang tepat dapat membawa timtim nasional asuhannya kepada tingkat yang lebih tinggi. Kita juga dapat melihat bagaimana sebuah klub sepak bola Eropa ternama yang pada akhir tahun 90an mendatangkan para bintang sepakbola dengan menguras keuangan yang sangat besar, namun hasil yang didapatkan tidak jauh berbeda dengan kondisi sebelum didatangkannyaparabintangsepakbolasejagattersebut. Seperti juga layaknya pertandingan sepak bola, strategistrategi pada bisnis didasari pada kemampuaninternaldanjugakondisieksternalyangdihadapi.Sepertilayaknyatimsepakbolaharus dapatmemainkanpermainanoffensivedandefensive,strategistrategibisnisjugaharusdinamisdan disesuaikan dengan kondisi eksternal yang dihadapi. Oleh sebab itu kita juga dapat mengklasifikasikan strategistrategi bisnis menjadi dua macam, yaitu strategistrategi offensive dan strategistrategidefensive. StrategistrategiOffensive Dua faktor penting yang menentukan keberhasilan sebuah bisnis adalah pasar (yang paling sering dibicarakan adalah kemampuan bersaing) dan produk (baik produk berbentuk fisik maupun produk yang bersifat intangible, jasa). Untuk memudahkan pemahaman, cobalah perhatikan matriks kombinasi antara pasar dan produk yang terdapat di slide ke23 pada materi pokok. Istilah yang dipakai pada materi pokok adalah Strategi Pertumbuhan. Ada empat macam kemungkinan strategi yangdapatdipilihberdasarkankondisikondisipadamatriks.

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.

PenetrationStrategy Kondisi yang terjadi adalah pasar yang memang sudah exist serta produk/jasa yang ditawarkan juga memang sudah exist. Salah satu alasan paling utama dipilihnya strategi penetrasi ini adalah ketika perusahaan tersebut merasakan dan meyakini pasar yang sekarang ini telah exist akan dapat bertumbuh lagi (demand pada pasar existing tersebut akan terus bertambah). Untuk mengantisipasi kondisi tersebut, yang umum dilakukan adalah penambahan jumlah sales force dan intensifikasi promosi. Salah satu contohnya: Persaingan industri telekomunikasi selular di Indonesia. Kita dapat melihat bahwa hampir semua operator selular melakukan intensifikasi promosi baik secara above the line maupun below the line campaign. Hal ini diyakini bahwa pasar selular Indonesia masih akan terus tumbuh, demandnya akan terus meningkat. Produkproduk utama yang mereka tawarkan bukanlah produkproduk yang benarbenar memiliki nilai yang baru, pasar dimana mereka berusaha melakukan penetrasi secara intensif juga adalah pasar yang secara umum sudah mereka kuasai. Bagaimana menjadi penguasa market share terbesar dalam pasar yang diyakini demandnya masih akanterusmeningkatadalahmenjadifokusutamadipilihnyastrategipenetrasipasarini. Productdevelopmentstrategy Kondisi yang terjadi adalah produk/jasa yang ditawarkan baru (dapat berupa penyempurnaan produk yang telah ada, ataupun benarbenar inovasi baru), namun pasar yang menyerapnya adalah pasar yang existing. Salah satu contohnya: General Motors pada awal 90an memasarkan mobil sedan listrik GM yang pertama dengan nama EV1, dengan segala kelebihan dan kekurangannya. Berdasarkan laporan investigatif pada salah satu media, mobil yang seluruhnya digerakkan tenaga listrik ini memang akhirnya ditarik kembali semuanya, namun bukan karena keluhan dari para pelanggan.Haltersebutterjadilebihdikarenakaninfrastruktur(tempatpengisianlistriknyaterbatas) dan teknologi baterai yang masih terlalu konvensional pada saat itu serta konflik kepentingan yang cukup besar diantara para produsen otomotif, para produsen minyak dan bahan bakar, serta pemerintah daerah California. Ketika harga minyak dunia menembus USD100/barel, kita dapat menyaksikan bagaimana produsenprodusen otomotif dunia kembali berupaya memasarkan mobil yang hemat bahan bakar, hybrid car. Mobil hybrid diyakini dapat menjembatani konflik kepentingan tersebut, karena masih menggunakan bahan bakar fosil. Perbedaannya adalah pada pemanfaatan bateraipadakendaraanyanglebihdioptimalkan.Daricontohtersebutkitadapatmelihatbagaimana produsen berupaya merebut pasar dengan menawarkan produk substitusi (produk yang memiliki nilai lebih) terhadap produk sebelumnya. Pertumbuhan pasar bukanlah menjadi dasar yang utama padasaatdipilihnyaProductDevelopmentStrategy. MarketDevelopmentStrategy Kondisi yang terjadi dimana produk yang ditawarkan adalah produk existing, tetapi pasar yang menyerapnya adalah pasar yang baru. Salah satu motif utama dipilihnya Market Development Strategy ini adalah potensi keuntungan yang dilewatkan apabila tidak masuk ke emerging markets. Kondisi keuntungan pada pasar yang saat ini dikuasai masih baik, namun growth pada emerging markets terlalu menggoda untuk dilewatkan. Salah satu contohnya: Pabrikpabrik otomotif kelas dunia melebarkan sayap mereka ke pasar China ketika perkenomian China membaik yang membuat daya beli rakyatnya juga meningkat. Kondisi tersebut ditambah dengan transportasi umum di China yang belum sebaik negaranegara maju. Produkproduk yang ditawarkan tidaklah berbeda dengan

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.

produkproduk yang telah dipasarkan pada pasarpasar sebelumnya seperti di Amerika, negara negara Eropa dan negaranegara Asia. Pada artikel utama majalah The Economist edisi terakhir, tulisan yang sangat menarik mengenai dipertanyakannya posisi dominan Toyota sebagai produsen otomotif dunia. Bagaimana pada artikel tersebut disebutkan penjualan VW dan Hyundai secara global meningkat dibandingkan dengan penjualan GM, Honda, dan Toyota belakangan ini. Memang yang menarik dari pasar otomotif China ini adalah Toyota dan Honda tidak mendominasi pasar seperti yang kita rasakan di Indonesia. VW, General Motors, serta Hyundai kelihatannya lebih dominan sampai dengan saat ini dibandingkan Toyota dan Honda. Efek krisis global yang masih terasa tentu saja membuat penjualan dinegaranegara maju merosot yang mana justru Toyota dan Honda mendominasi. Pasar China sebagai the least loser pada krisis kali ini tentu membawa angin segar bagi VW dan Hyundai. Pada Market Development Strategy adalah sangat penting untuk dapat membaca kondisi yang akan terjadi didalam sebuah pasar. Ketertinggalan didalam menggarap sebuah pasar yang baru dapat membawa kemungkinan ketertinggalan secara total dibandingkan denganpesaingpesainglainnya. DiversificationStrategies Secaraumum,strategistrategidiversifikasidapatkitabagimenjadiduamacamstrategi,yaitu: 1. IntegrationStrategies. Beberapa tujuan utama dalam memilih strategistrategi integrasi ini antara lain untuk bisa mendapatkan market share lebih besar dan cepat atau mengintegrasikan produk/jasanya darihulusampaihilir. Strategistrategiintegrasidapatkitabagimenjaditiga,yaitu: a. Forwardintegration Kondisi yang terjadi adalah dimana sebuah perusahaan mengakuisisi (dapat juga membentuk) perusahaan lain yang masih terdapat dalam rantai pasokan barang/jasa yang sama yang mana akan membawa posisi akhir kepada semakin dekatnya perusahaan tersebut kepada pengguna akhir barang/jasa tersebut. Sebagai contohcontohnya: Toyota Astra Motor memasarkan produkproduknya melalui anak usahanya Auto 2000 serta Apple dalam memasarkan produknya melalui istorenya dan masih banyak lagi. Selain motif mendapatkan keuntungan yang lebih banyak, salah satu motif utama dilakukannya forward integration adalah untuk meyakinkan bahwa konsumen akhir memang mendapatkan informasi penuh dari produk/jasa yang diberikan. Hal ini tercermin dengan pihakpihak yang menerapkan strategi ini banyak yang merupakan perusahaanperusahaan yang bergerak dibidang teknologi atau mereka yang bergerak pada niche market. Mereka mau meyakinkan diri bahwa jalur distribusi yang dipakai memang dapat mengkomunikasikandenganbaikdandetailkemampuanteknisprodukproduk yang mereka hasilkan dan kelebihannya dibandingkan dengan kompetitor serta memastikan pelayanan purna jual yang prima, tidak sematamata jalur distribusi yang menitikberatkan kepada penjualan seperti layaknya menjual komoditas yang manafungsidanfeaturenyasudahdiketahuisecaraumum.

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.

b. Backwardintegration Kondisi yang terjadi dimana sebuah perusahaan mengakuisisi (dapat juga membentuk) perusahaan lain yang masih terdapat dalam rantai pasokan barang/jasa yang sama yang mana akan membawa posisi akhir kepada semakin dekatnya perusahaan tersebut kepada bahan dasar produk yang dihasilkan. Sebagai contohcontohnya: Olympic ketika mengakuisisi salah satu supplier penghasil kayu lapisnya sebagai bahan dasar pembuatan furniturenya. Adhi Karya sebagai salah satu kontraktor BUMN saat ini telah memiliki anak usaha Adhi Mix yang bergerak dibidang penyediaan ready mix concrete. Salah satu alasan utama dipilihnya backward integration adalah ketika perusahaan yang mengkonsumsi bahan baku tersebut merasakan bahwa perusahaan tersebut sudah merupakan salah satu konsumen terbesar dari suppliernya saat ini dan profit yang diraih oleh suppliernya tersebut sangat memadai untuk dilakukannya backward integration. Pengakuisisian kapasitas produksi juga merupakan motif yang umum terjadi, dimana keuntungan tambahanakanmerupakanmilikperusahaanpengakuisisitersebut. c. Horizontalintegration Kondisi yang terjadi dimana sebuah perusahaan mengakuisisi (dapat juga membentuk) perusahaan lain yang terdapat dalam rantai pasokan barang/jasa yang samadanjugaberadadilevelyangsamadalamrantaipasokanbarang/jasatersebut. Sebagai salah satu contohnya: TransTV mengakuisisi TV7 yang sekarang menjadi Trans7. Salah satu tujuan utama dipilihnya strategi ini adalah untuk meningkatkan porsi market share yang saat ini sudah diraih, disamping juga dimaksudkan agar mampu melayani segmen pasar yang lebih luas daripada yang sudah dikuasai sekarangini. 2. ConglomerationStrategy Dari namanya, tentu kita sudah jelas apa yang dimaksud dengan strategi konglomerasi. Strategi offensive yang satu ini tidak akan membatasi diri pada industri mana yang sebelumnya mereka kuasai, tanpa membatasi diri kepada pada posisi mana sebelumnya mereka berada dalam sebuah mata rantai pasokan, dan seterusnya dan seterusnya. Strategi yang satu ini sangat popular pada era 80an. Banyak sekali contoh dalam strategi ini, antar lain: Grup Bakrie, Grup Salim dan sebagainya. Para penganut kapitalisme sejati ini memfokuskan pada kesempatan yang tersedia dan akan merealisasikan kesempatan kesempatantersebutberdasarkanintuisidanjugamemaksimalkansegalasumberdayayang merekamiliki. StrategistrategiDefensive Setelah kita membicarakan strategistrategi offensive, strategistrategi defensive juga tidak kalah menariknya. Kondisikondisi yang sangat volatile sekarang ini menuntut kedinamisan dalam mereview strategistrategi yang telah ditentukan. Situasi ekonomi, yang merupakan bagian dari kondisi eksternal dalam SWOT analisis, dapat berubah arah dengan cepat. Sebagai contoh, tahun 1997yangdikenalsebagaikrisisAsiadimanapasarAsia,khususnyaAsiaTenggara,sangatlesuwaktu

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.

itu. Siapa yang dapat menyangka bahwa 10 tahun kemudian justru krisis melanda negaranegara majuyangseharusnyasecaratextbookmampubelajardarikrisisAsia1997tersebut? Kita juga dapat melihat bagaimana teknologi dapat merubah situasi yang telah kita kenal dengan baik. Saat ini beberapa negara tengah melakukan penelitian mengenai energi terbarukan seperti energi matahari dan energi angin yang teknologinya masih jauh dari sempurna sampai saat ini.Dapatkitabayangkanapabilaaplikasiteknologiyangsaatinihanyamampumenyerapantara15 20% dari tenaga surya dimasa depan mampu menyerap jauh lebih signifikan. Demikian pula apabila aplikasi teknologi energi angin dapat jauh lebih matang daripada saat ini, tentu kehidupan akan sangatberbeda,asalkantidakterganjalolehmasalahjangkawaktuHAKI(jangansampaipenguasaan terhadap teknologi strategis semacam ini diberikan jangka waktu yang tidak terbatas). Oleh sebab itu dapat kita simpulkan bahwa bukan hanya faktor ekonomi dan teknologi yang dapat membawa dampak perubahan, namun juga faktorfaktor seperti sosial budaya, kondisi pasar, maupun kondisi politikdapatmembawaperubahanyangmungkintidakdiperhitungkansebelumnya. Pandanganpandang makro semacam itu dapat kita bawa kepada tingkatan yang lebih mikro. Apakah lanskap kondisi persaingan dalam sebuah industri akan tetap selamanya? Mari kita ambil dua contoh lanskap industri yang telah berubah secara radikal dalam 10 tahun terakhir ini. Yang pertama, industri penerbangan komersial. Industri yang tadinya diyakini adalah industri padat modal dan hanya bergerak pada segmen pasar premium, ternyata berubah secara total ketika RyanAir dan easyJet mampu merombaknya. Komisi penjualan tiket kepada agenagen perjalanan dipangkas habis dengan memanfaatkan teknologi internet. Biayabiaya pendaratan yang tinggi pada bandarabandara udara kelas satu dipangkas secara signifikan dengan memakai bandarabandara udara kelas dua yang jaraknya masih dapat ditoleransi para konsumen. Pemberian kenyamanan sepertimakananjugadipangkashabis. Contoh berikutnya adalah industri wine yang kental dengan tradisi untuk memperoleh wine premium. Saat ini, perkebunan wine tidak hanya terletak dibenua Eropa atau Prancis tepatnya. Australia, USA, Chili, Afrika Selatan, China, India, Maroko, dan Bali sudah banyak terdapat perkebunan wine. Walaupun para pecinta fanatik wine tradisional mengatakan bahwa produksi masal wine sangat buruk hasilnya, memproduksi wine layaknya CocaCola, toh lebih banyak konsumen ternyata tidak mengeluh dengan hasil wine yang diproduksi dengan basis teknologi tersebut. Proses yang menggunakan gentonggentong yang terbuat dari serbuk oaks jelas lebih murahdibandingkanpenggunaangentonggentongdengankayugelondonganaslioaks.Penggunaan sistem freezer juga lebih memberikan kepastian dibandingkan penantian akan musim dingin dalam memproduksi ice wine. Masih banyak inovasiinovasi yang telah dilakukan didalam bidang proses produksi untuk industri wine saat ini. Dengan pemanfaatan aplikasi teknologi terkini, produksi wine tentu saja meningkat pesat, bahkan saat ini total hasil produksi wine Eropa ternyata kurang dari setengahtotalproduksiwinesecaraglobal.Sekalilagilanskappersaingantelahberubah. Masih banyak contohcontoh lanskap persaingan yang telah berubah. Bagaimana perusahaanperusahaan yang memang sudah ada sebelumnya dalam menyikapi hal ini? Dengan mengaplikasikan strategistrategi offensive? Seperti layaknya permainan sepakbola, permainan offensive sepanjang waktu terkadang tidak bijaksana. Ada waktunya bagi perusahaan untuk melakukan konsolidasi dan juga memperkuat pertahanan. Secara garis besar, ada dua macam strategidefensive,yaituretrenchmentdanliquidation.

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.

Retrenchment Kondisi dimana penghematanpenghematan dilakukan oleh perusahaan, tanpa ada menjual apapun kepihak lain. Biasanya yang paling awal dilakukan adalah penggabungan beberapa divisi atau bagian untukmenjagakeutuhanperusahaansecarakeseluruhan.Asetasetproduktifakansemakindigenjot untuk menjaga keselamatan perusahaan, baik aset tangible maupun aset intangible. Pemborosan yang sekecilkecilnya pun akan dihilangkan untuk menghindari penurunan lebih lanjut dan menghindari PHK karyawan. Salah satu contoh paling umum yang terjadi adalah pada industri penerbangan komersial. Bagaimana mereka harus secara dinamis menutup ruterute penerbangan tertentu untuk tetap menjaga keutuhan perusahaan dan tetap memaksimalkan ruterute gemuk untuktetapbertahan. Liquidation Kondisi dimana perusahaan menjual sebagian atau bahkan seluruh divisi maupun asetnya. Kondisi yang terjadi memang ada dua macam, dimana kondisi pertama masih memungkinkan untuk diselamatkan dan masih ada harapan kedepannya dapat bangkit kembali, atau kemungkinan kedua bahwa memang lebih baik dijual sebelum terlambat. Apabila hanya sebagian (anak perusahaan ataupun divisi), kita dapat memandangnya telah terjadi kesalahan dimasa lampau dan masih ada peluang kedepannya apabila diambil keputusan dan tindakan yang tepat. Sebagai contohcontoh: Harley Davidson yang mengalami kesulitan ditahun 80an akibat serangan motormotor Jepang, namun berhasil bangkit dan sekarang tetap memimpin untuk motormotor kelas berat (diatas 600cc). General Motors yang tahun 2008 diselamatkan oleh pemerintah Amerika karena diyakini masih memiliki harapan kedepannya asalkan keputusan dan tindakan yang diambil manajemen puncaktepat. Penentuan strategistrategi bisnis adalah hal yang penting sebelum diambil tindakan nyata lebih lanjut. Namun yang perlu diingat adalah penentuan strategistrategi bisnis bukanlah sesuatu yang sepenuhnya didasarkan kepada penilaian secara science. Intuisi serta jam terbang memainkan perananyangsignifikandidalampenentuanstrategistrategibisnis.

Thisarticleiswrittenbasedonpersonalview,byaverylimitedofhumanunderstandingtotheeconomy.