Anda di halaman 1dari 3

KAMUS Arteri jantung Tekanan darah : tekanan yang dialami darah pada pembuluh arteri darah ketika darah

di : (pembuluh nadi) pembuluh darah berotot yang membawa darah dari

pompa oleh jantung ke seluruh anggota tubuh manusia. Systole Diastole usia lanjut : tekanan ke atas pembuluh arteri akibat denyutan jantung : tekanan saat jantung beristirahat di antara pemompaan : fase menurunnya kemampuan akal dan fisik, yang di mulai dengan

adanya beberapa perubahan dalam hidup Hipertensi maligna : hipertensi yang sangat parah, yang bila tidak diobati, akan menimbulkan

kematian dalam waktu 3-6 bulan. arteriosklerosis sirkulasi darah ginjal : dinding arteri yang menebal dan kaku akibat endapan kapur : suatu sistem organ yang berfungsi memindahkan zat ke dan dari sel : organ ekskresi dalam vertebrata yang berbentuk mirip kacang sebagai

bagian dari sistem urin Hipertensi esensial : (hipertensi primer) kombinasi antara berbagai faktor genetik dan

lingkungan yang menyebabkan fenotipe hipertensif yang tidak diketahui penyebabnya hipertensi sekunder : beberapa perubahan pada jantung dan pembuluh darah yang

kemungkinan bersama-sama yang menyebabkan meningkatnya tekanan darah dan penyebabnya diketahui Stres tekanan mental : bentuk ketegangan dari fisik, psikis, emosi maupun mental : keadaan emosi seseorang pd saat mengalami tekanan berbagai hal

sehingga dapat menimbulkan gangguan jiwa, biasanya tercermin pd perilaku yg menyimpang alcohol : (ethanol) senyawa organik dimana memilkiki gugus fungsional hidroksil

(-OH) terikat pada atom karbon pil KB elastisitas arteri : salah satu alat kontrasepsi yang banyak digunakan oleh wanita : arteri tidak dapat lentur dan cenderung kaku, sehingga volume darah

yang mengalir sedikit dan kurang lancar Kegemukan (obesitas) : suatu kondisi medis berupa kelebihan lemak tubuh yang terakumulasi sedemikian rupa sehingga menimbulkan dampak merugikan bagi kesehatan, yang kemudian menurunkan harapan hidup dan/atau meningkatkan masalah kesehatan

Kelelahan

: kondisi yang ditandai oleh kapasitas berkurang untuk bekerja dan

mengurangi efisiensi prestasi, biasanya disertai dengan perasaan letih dan lemah sesak napas :kesulitan bernapas atau dalam medis disebut sebagai dispnea :penderita hipertensi berat yang mengalami penurunan kesadaran

ensefalopati hipertensif

dan bahkan koma karena terjadi pembengkakan otak


1. Hipertensi : tekanandarahataudenyutjantung yang lebihtinggidaripada normal karenapenyempitanpembuluhdarahataugangguanlainnya 2. Korteks : bagianluarsuatu organ --Adrenal :bagianluarkelenjar adrenal vertebrata yang membentuklebihdariseratusmacamhormon 3. Renin : enzimpengurai protein susu (kasein) yang lazimdiperolehdari pancreas anaksapi 4. Hemodialisis : pencuciandarahdenganmaksudmengeluarkanbahantertentudaridarahdenganmenggunakanalat yang dinamakanginjalbuatan 5. Metabolisme : pertukaranzatpadaorganisme yang meliputi proses fisikadankimia, pembentukandanpenguraianzat di dalambadan yang memungkinkanberlangsungnyahidup 6. Risiko : akibat yang kurangmenyenangkan (merugikan, membahayakan) darisuatuperbuatanatautindakan 7. Stroke : seranganotak, biasanyadisertaidengankelumpuhan 8. Deteksi : usahamenemukandanmenentukankeberadaan, anggapan, ataukenyataan -terdeteksi :dapatdideteksi 9. Kortison : hormon yang dikeluarkanolehkelenjarkulit adrenal ; C21H28O5 10. Inflamasi : reaksitubuhthdmikroorganismedanbendaasing yang ditandaiolehpanas, bengkak, nyeri, dangangguanfungsi organ tubuh anti-inflamasi : anti peradangan 11. Nikotin : racun yang terdapat di dalmtembakau, digunakandalampengobatandanuntukinsektisida 12. Alkohol : cairantidakberwarna yang mudahmenguap, mudahterbakar, dipakaidalam industry danpengobatan, merupakanunsurramuan yang memabukkandalamkebanyakanminuman keras;C2H5OH;etanol 13. Kronis : 1terus menerusberlangsungtahandalamwaktu yang lama (tentengkeadaan); 2berjangkitterusdalamwaktu yang lama;menahun (tentangpenyakit yang melandadiriseseorang)yang tidaksembuh-sembuh 14. Diabetes : penyakit yang ditandaidngsekresidanekskresi urine dalamjumlah yang banyak, terutamadiabetes mellitus, penyakitkencingmanis;penyakitgula --insipidus :penyakit yang disebabkankekurangan hormone antidiuretikakibatgangguanpadakelenjarpituitary yang ditandaidenganpembentukan urine yang berlebihan, hausterusmenerus yang disebabkanolehkerusakankelenjarhipofisis

15. 16. 17. 18.

19. 20. 21.

--melitus :gangguanmetabolismekarbohidatkarenakelenjar pancreas tidakmampumenyekresi insulin yang cukupdengangejalaadanyaguladalam urine, turunnyaberatbadan, selaluhausdanlapar, danbanyakkencing; keadaankekurangan insulin dengankaibatglukosatidakdapatdiolholehbadan, sehinggakadarglukosadalamdarahmeninggidandikeluarkandalam urine Progresif : kea rah kemajuan; berhaluan kea rah perbaikankeadaansekarang Gejala : perihal (keadaan, peristiwa,dsb) yang tidakbiasadanpatutdiperhatikan (adakalanyamenandakanakanterjadisesuatu) Pasien : orang sakit (yang dirawatdokter); penderita (sakit) Kolesterol : 1 lemak yang menyerupai alcohol, berkilausepertimutiara, terdapat di dalamseluruhtunuhmanusiadanhewan, terutamaselsarafdanotak, mempunyaiperananpentingdalampengangkutanlemakdanpembuatan hormone; C27H45OH; 2 lemak yang biasaterdapatdalamdarah, otak, empedu, danbatuempedu3 steroid yang banyakterdpatdalamminyakdanlemakhewan, kuningtelur, jaringansaraf, empedu, danbatuempedu. AlatSkrining : alatuntukmenayangkangambardsb Permanen : tetap (berlangsung lama)tanpaperubahan yang berarti Dialisis : pemisahzatdalamlarutan --peritoreal :cucidarahmelaluironggaperut

22. Sitrat : ester atau anion yang diturunkandariasamsitrat 23. Urine : zatcairbuangan yang terhimpun di dalamkandungkemihdandikeluarkandaridalamtubuhmelaluisalurankemih; air kemih air seni 24. Retroperitoneal : terikat (terletak) kebelakangselaputronggaperut 25. Reabsorbsi : proses penyerapankembali