Anda di halaman 1dari 12

TUGAS JARINGAN KOMPUTER DASAR

Nama - namaAnggotaKelompok 5 # Aditya Fadhli (29110924) # IkaRetnaningsih (23110406) # RianNandang (29110168)

Materikelompok 5 MediumAcces Control Kelas : 3KB05

UNIVERSITAS GUNADARMA 2013


Pengertian Medium Access Control

Medium Access Control adalahsebuahmetodeuntukmentransmisikansinyal yang dimilikioleh node-node yang terhubungkejaringantanpaterjadikonflik. Ketikaduakomputermeletakkansinyal "collision" (tabrakan) akanterjadi di atasmediumjaringan (sebagaicontoh: data yang yang data

kabeljaringan) secarasimultan (berbarengan), makakondisi yang disebutsebagai yang akanmengakibatkan ditransmisikanakanhilangataurusak. Solusiuntukmasalahiniadalahdenganmenyediakanmetodeaksesmediumjaringan, bertindaksebagai collision. "lampulalulintas" yang data mengizinkanaliran dalamjaringanataumencegahadanyaaliran

untukmencegahadanyakondisi

Jenis-jenisMetode Medium Access Control : Metodemediumakses padatujuhlapisan control model diimplementasikan referensi di dalamlapisan data-link

OSI.

Secaraspesifik,

metodeinibahkandiimplementasikandalamlapisankhusus di dalamlapisan data link, yakni Medium Access Control Sublayer, selaintentunya Logical Link Control Sublayer. Ada empatbuahmetodemedium access control yang digunakandalamjaringanlokal, yakni: Carrier Sense Multiple Access with Collision Detection (CSMA/CD): metode ini digunakan di dalam jaringan Ethernet half-duplex (jaringan Ethernet full-duplex menggunakan switched medium ketimbang menggunakan shared medium sehingga tidak membutuhkan metode ini). CSMA/CD merupakan metode akses jaringan yang paling populer digunakan di dalam jaringan lokal, jika dibandingkan dengan teknologi metode akses jaringan lainnya. CSMA/CD didefinisikan dalam spesifikasi IEEE 802.3 yang dirilis oleh Institute of Electrical and Electronic Engineers (IEEE). Carrier Sense Multiple Access with Collision Avoidance (CSMA/CA): metode ini digunakan di dalam jaringan dengan teknologi AppleTalk dan beberapa bentuk jaringan nirkabel (wireless network), seperti halnya IEEE 802.11a, IEEE 802.11b, serta IEEE 802.11g. Untuk AppleTalk, CSMA/CA

didefinisikan dalam spesifikasi IEEE 802.3, sementara untuk jaringan nirkabel didefinisikan dalam IEEE 802.11. Token passing: metode ini digunakan di dalam jaringan dengan teknologi Token Ring dan Fiber Distributed Data Interface (FDDI). Standar Token Ring didefinisikan di dalam spesifikasi IEEE 802.5, sementara FDDI didefinisikan oleh American National Standards Institute (ANSI). Demand priority: digunakan di dalam jaringan dengan teknologi 100VGAnyLAN dan didefinisikan dalam standar IEEE 802.12.

Teknik Media Access Control tidakberbagimedia : Media access control protocols untuk non-shared media Membutuhkan sedikit atau tanpa kontrol sebelum menempatkan frame pada media.. Protocol ini mempunyai aturan dan prosedur yang sederhana untuk media access control. Topologi point-to-point .

Dalamimplementasijaringan,

beberapaperangakatpendukungjaringansemacam MAC untuk algorithm dan (algoritma Token Ring

network interface card, switch, atau router, metodemedium access control diimplementasikandenganmenggunakan MAC).Meskipunalgoritma MAC kedalam chip untuk Application specific MAC Ethernet Ethernet integrated circuit

telahdidefinisikanolehstandar IEEE dantersediauntukpublik, beberapaalgoritma full-duplex hard-code yang (ASIC) dipatenkanolehperusahaanpembuatnyadanseringnyatelahditulissecara dimilikiolehperangkattersebut. Teknik Media Access Control Menggambarkan tujuan dari topologi logical dan identifikasi beberapa topologi logical yang umum.

Indetifikasi karakteristik dari topologi multi-access dan mendiskripsikan implikasi media akses bila menggunakan topologi ini.

Identifikasikarakteristikdaritopologi ringdanmendiskripsikanimplikasi media aksesbilamenggunakantopologiini.

Lokaldan Metropolitan Area Network Metropolitan Area Network (MAN) pada dasarnya merupakan versi LAN yangberukuran lebih besar dan biasanya memakai teknologi yang sama dengan LAN. Didalam jaringan MAN hanya memiliki satu atau dua buah kabel yang fungsinya untukmengatur paket melalui kabel output. Local Area Network (LAN) Jaringan ini digunakan untuk menghubungkan komputer pribadi dan workstation dalam suatu perusahaan yang menggunakan peralatansecara bersama-sama dan saling bertukar informasi. KarakteristikLAN : Garis tengah tidak lebih dari beberapa km Total data rate beberapa Mb/sekon Dipunyai oleh suatu organisasi

WAN : Terbentang diseluruh daerah/negara Data rate < 1 Mb/s Dipunyai oleh beberapa organisasi Umumnya pakai existing public telephonenetwork

MAN :antara WAN dan MAN(Metropolitan Area Network) Meliputi seluruh daerah/kota Menggunakan teknologi LAN Menggunakan kabel TV (CATV) sebagai medium

LAN menarikkarena : Menghubungkan beberapa komputer lokal Dapat dikembangkan secara incremental Harga dan performance memadai Reliable (error rate 1000 X lebih rendahdari WAN) Protokol lebih sederhana dan efisien

Yang terpenting dapat Berbagi pakai

Alokasikanalstatispada LAN danMAN : FDM (Frequency Division Multiplexing)adalahteknikmenggabungkanbanyaksaluran input menjadisebuahsaluran output berdasarkanfrekuensi. sub-sub Jadi total bandwithdarikeseluruhansalurandibagimenjadi (denganlebar pita frekuensi yang saluranolehfrekuensi. dimanamasing-

Prinsipdari FDM adalahpembagian bandwidth salurantransmisiatassejumlahkanal samaatauberbeda) masingkanaldialokasikankepasanganentitas yang berkomunikasi. Bandwidth dibagimenjadi N bagian yang samadimanatiappemakaimemilikifrekwensi band sendiri, tanpaadainterferensi. FDM sederhanadanefisienuntukpemakai yang terbatas, tetapimasingmasingmempunyaitrafiktinggidanUtilisasikanalrendah. Terutamauntukjumlahpemakai traffic = 1000 : 1) Pemanfaatankanalpadatiapsaat :<< N tidakefisien Mean time delay T : C :kapasitaskanal (bps) : laju kedatangan frame/sekon 1/ : frame length (mean) bits Bilakanaldibagi N sub kanal : kapasitas per sub kanal: C/N bps mean input rate :/N frame/sekon Berarti : Mean time delay = N x lebihjelekdari T yang

besardantrafiknyabursty.sistemkomputerumumnya data bursty (Peak traffic : mean

AlokasiSaluranDinamikpadaLANdan MAN Asumsi yang dibuat : 1. Model stasiun : N buahstasiun yang independent,mempunyaiprogramatau user frame frame

yangmenghasilkanframebilasebuah dihasilkanstasiunakandiblokirsampaiframetersebutditransmisikanprobilitas dihasilkanselama t = . t( konstanta laju kedatangan dari frame baru)

2. Asumsisalurantunggal Hanya 1 kanaltersediauntukkomunikasisemuastasiunberprioritassama,

kecualibiladiatur lain. 3. Asumsitabrakan (Collision) Semuastasiundapatmendeteksitabrakanframe ditransmisiulang 4.a.Waktukontinu Transimisi frame dapatdilakukansetiapsaatdantidakterdapat master clock. b.Waktu slot (Slotted time) waktudibagimenjadi interval-intervaldiskrit (slot)dantransmisi frame

selaludimulaipadaawalsebuah slot. 5.a. Carrier Sense Stasiundapatmengetahuisuatusaluransedangdipakaisebelummencobamenggunakan nya. b. No Carrier Sense

Stasiuntidakmendeteksikeadaansalurandansetelahbeberapasaatbarudiketahuitra nsmisiberhasil / gagal.

Multiple Access Protocol Lapisan sub-Media Access Control (MAC) berfungsiuntukmembuat frame dari bit 1 dan0 yang diterimaolehlapisan physical sertamemberikan hardware address kesuatunetwork interface card. MAC address ataudisebutjuga hardware address terdiridariduabagian, yaitu 3 byte untukkodepabrik yang diberikanoleh IEEE dan 3 byte untuknomorserial unik. Semuaperalatanaktif di LAN, baik network interface card computer, maupuninterface peralatan router dan switch menggunakan MAC address untukmemberikanidentitasdirinya di dalamjaringan computer.Lapisan MAC menggunakan Cyclic Redundancy Cheksum (CRC) untukmenjagakeutuhandalampengiriman frame. ALOHA Carrier Sense Multiple Access Protocols Collision-Free Protocols Limited-Contention Protocols Wavelength Division Multiple Access Protocols Wireless LAN Protocols

ALOHA Dengan ALOHA jika station memilikisebuah frame untukdikirim, maka frame ituakandikirim. Kemudian station akanmendengarbeberapawaktu yang samadengan delay perambatanroundtripmaksimum yang mungkinterjadipadajaringan (dua kali waktu yang digunakanuntukmengirimsebuah terpisahpadajarakterjauh), station Station plus frame diantaradua station yang Bila station sedikittambahanwaktutertentu.

mendapatbalasanpadawaktuitu, makadiaakanmakadiaakanmegirim frame lagi. Bila gagalmenerimabalasansetelahpengulangantransmisi, penerimamenetapkankebenaran makaiaakanmenyerah. frame frame yang valid,

datangdengancaramenentukanbidang

frame-check-sequence.Bila

station

segeramengirimkanbalasan.

Frame station

dikatakantidak yang lain

valid

berkenaandenganderaupadakanalataukarena frame kira-kirapadasaat yang sama. Padakasusberikutnya, yang diterimadianggaptidak dua frame

mentransmisikan

salingbertabrakansatusama

lain

pada frame

receiver sehinggakeduanyatidakdapatditeruskan, halinidisebut collision. Bila frame valid, station penerimaakanmengabaikan yang station tersebutbegitusaja. ALOHA bisatampaksederhana. Baik ALOHA maupun slotted ALOHA menunjukkanfungsi tidakterlalubaik. relative Keduannyagagalmengambilkeuntungandarisalahsatusifatutama radio paketdan LAN danbiasanyapenundaanpropagasidiantara lebihkecildibandingkandenganwaktupentransmisian frame. Protokol Aloha terbagidua, yaitu : 1. Aloha Murni (Pure) Membiarkan pengguna untuk melakukantransmisi kapan saja bila memiliki data. Pengirim akan mengetahui frame yangdikirimkan rusak atau tidak setelah270 mdetik. No Sense system Menggunakan sistem contention (persaingan) Rata-rata frame terkirim per satuan waktu: S = G e-2G ; dimana : S :mean new frame sent per frame time,menurut poisson G : mean old (retrans) and new framescombined per frame time (poisson) frame time : Jumlah waktu yang diperlukan untukmentransmisikan frame standard denganpanjangyang tetap = Yaitu panjang frame dibagi bit rate Bila S > 1 :Pengguna menghasilkan frame padakecepatan yang lebih tinggi dari yang dapatditangani saluran Akibatnya : hampir seluruh frame mengalami tabrakan Besar throughput yang layak :O < S < 1, G pada umumnya S Pada beban rendah : no collision = G S Pada beban tinggi = G > S

2. Aloha Berslot (Slotted) Pure ALOHA dikembangkan dengan memberikan slot/batas pengiriman yang dapat dilakukan oleh sebuah stasiun, sehingga setiapstasiun selalu memulai mengirimkan data padaawal sebuah slot. Hal ini menyebabkan kemungkinan waktu yang terbuang hanya t (waktu transmisi sebuahframe), sehingga efisiensi meningkat. Carrier Sense Multiple Access Kolisi dapat dikurangi/dihindari jika stasiun dapat mendeteksi terlebih dahulu apakah mediumsedang digunakan. Sistem ini dapat diterapkan pada jaringan yangmemiliki latency rendah, seperti pada LAN masih mungkin terjadi tabrakan, jika 2 stasiun bersamaan mendeteksi medium, dan melakukan pengiriman. variant CSMA: 1-persistent, non-persistent, ppersistent, CSMA/CD. Collision free protocol Kolisi dapat dihindarkan dengan mengatur waktu penggunaan (sama dengan TDM) saat trafik rendah, banyak kapasitas terbuang, karena alokasi kanal statis bitmap protocol setiap node memiliki slot reservasi, 1 bit per node binary countdown

menggunakan penomoran biner untuk menentukan siapa yang memiliki prioritas lebih tinggi. fairness ditangani dengan menggunakan penomoran virtual Limited contention protocol contention protocol bagus untuk beban rendah: delay rendah, namun utilisasi rendah pada saatbeban tinggi, karena sering kolisi contention free protocol bagus untuk bebantinggi: utilisasi tinggi, namun delay tinggi saatbeban rendah hibrid protocol: limited contention protocol:contention pada saat beban rendah, contention free pada saat beban tinggi Wireless LAN (LAN tanpa kabel) adalah merupakan metode terbaru yang sedang diperkembangkan dan makin popular karena instalasi LAN karena tidak memerlukan distribusi kabel. Pada dasarnya, cara bekerja WLAN mirip dengan cara bekerja telpon tanpa kabel (wireless phone), yaitu computer satu dengan lain berhubungan menggunakan gelombang radio. Sebagai system pengamanan, WLAN biasanya menggunakan peralatan yang dinamakan Access Point yang berfungsi mirip dengan hub tempat computer berhubungan dengan perantaraan gelombang radio. Computer harus memiliki Wireless Adapter untuk dapat berhubungan dengan Access point tersebut. Agar semua computer berkomunikasi dengan WLAN yang sama, penggunaan Access Point memungkinkan penggunaan Service Set Identification (SSID), yaitu semua computer dikonfigurasikan memiliki SSID yang sama. WLAN diatur oleh lembaga IEEE berdasarkan spesifikasi 802.11. Pada saat ini telah tersedia tiga spesifikasi yang dapat anda pergunakan : 802.11a : menggunakan frekuensi 5 Ghz dengan kecepatan 54 Mbps. Ini adalah spesifikasi yang sedang popular. 802.11b : menggunakan frekuensi 2.4 Ghz dengan kecepatan 11 Mbps. Ini adalah spesifikasi yang pertama yang dipakai. 802.11g : menggunakan frekuensi 2.4 Ghz dengan kecepatan 54 Mbps. Ini adalah spesifikasi terakhir yang diperkenalkan oleh lembaga IEEE. The 802.11 Protocol Stack The 802.11 Physical Layer

The 802.11 MAC Sublayer Protocol The 802.11 Frame Structure Services