Anda di halaman 1dari 19

MAKALAH BIOINFORMATIKA

ANALISIS PERBANDINGAN SEQUENCE DNA VIRUS H1N1 dengan SOFTWARE BLAST

M. IVAN ARIFUL FATHONI RENI UMILASARI

1213201009 1213201011

DOSEN PENGAMPU Dr. IMAM MUKHLAS, MT.

PROGRAM MAGISTER JURUSAN MATEMATIKA FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM INSTITUT TEKNOLOGI SEPULUH NOPEMBER SURABAYA 2013

BAB 1. PENDAHULUAN

1.1 Latar Belakang Komparasi sekuens merupakan metode modern untuk mempelajari interaksi evolusi antar gen. Komparasi sekuens biologi bertujuan untuk mengidentifikasi kemiripan (similarity) dan perbedaan antara sekuens-sekuens biologi. Pendekatan untuk menyelesaikan masalah ini biasanya dilakukan dengan mensejajarkan sekuens tersebut. Pensejajaran sekuens adalah proses penyusunan atau pengaturan dua atau lebih sekuens sehingga persamaan antar sekuens tersebut nampak nyata. Informasi tingkat kemiripan atau ketidakmiripan (dissimilarity) antara sekuens ini digunakan untuk mempelajari proses evolusi suatu sekuens biologi. Berkaitan dengan hal ini, dengan pensejajaran sekuens maka dapat ditunjukkan posisi yang dipertahankan (conserved) dan tidak dipertahankan (unconserved) selama evolusi. Posisi yang dipertahankan merupakan posisi yang penting dalam struktur atau fungsi dari sekuens tersebut. Sedangkan posisi unconserved adalah posisi yang mengalami perubahan baik oleh mutasi yang ditunjukkan dengan adanya subsitusi ataupun adanya penambahan gap yang ditunjukkan dengan insersi atau delesi.

Pensejajaran sekuens juga digunakan untuk mencari sekuens yang mirip atau sama dalam pangkalan data sekuens. Berdasarkan informasi tingkat kemiripan ini dapat digunakan untuk analisis homologi, jika dua sekuens juga memiliki struktur dan fungsi yang sama. Sehingga pensejajaran sekuens adalah topik yang fundamental dalam bioinformatika. Oleh karen itu, dalam makalah ini akan dibahas mengenai sequence alignment untuk beberapa contoh sequence DNA virus H1N1 dengan software BLAST.

1.2 Rumusan masalah Bagaimana tingkat kesamaan sequence alignment dari beberapa sequence DNA virus H1N1 dengan menggunakan software BLAST?

1.3 Tujuan Penelitian Untuk mengetahui tingkat kesamaan sequence alignment dari beberapa sequence DNA virus H1N1 dengan menggunakan software BLAST.

BAB 2. TINJAUAN PUSTAKA 2.1. NCBI Database biologi merupakan kumpulan dari semua informasi biologis yang tersedia dalam bentuk format database. Keberadaan database tersebut adalah syarat utama dari analisis bioinformatika. Bioinformatika muncul sebagai desakan ledakan kebutuhan untuk mengumpulkan, menyimpan, dan menganalisa data-data biologi berupa database DNA, RNA maupun protein. informasi tersebut banyak diakses oleh para ahli biologi maupun pengguna umum secara luas yang dikelola dalam situs NCBI.

Gambar 1. National Center For Biotechnology Information Office

NCBI (National Center For Biotechnology Information) atau Pusat informasi Bioteknologi Nasional adalah sebuah lembaga maya yang dididirikan tahun 1988, sebagai bagian dari NLM (National Library of Medicine) dan bekerjasama dengan NIH (National Institute of Health). NCBI menyediakan database, mengembangkan alat bantu sofware, sekaligus tempat menelusuri informasi serta menyebar luaskan dalam rangka penelitian dan pengembangan kesehatan manusia. Cara yang paling banyak digunakan untuk pengambilan informasi dari database biologi adalah sistem entrez NCBI. Entrez adalah sebuah sistem untuk pencarian dan menemukan kembali informasi secara terpadu tentang sekuen nukleotida, sekuen protein, struktur makromolekul seluruh genom, pemetaannya serta literatur ilmiah.

Database yang tersedia di NCBI : Bank Gen sekuen DNA yang mengandung lebih dari 7 juta sekuen yang meliputi hampir 9 milyar sekuen nukleotida dan beberapa miliar sekuen asam amino. database sekuen DNA/nukleotida dan data base protein/sekuen asam amino.

Data Base Model Molekuler (MMDB) : database struktur dan visualisasi molekuler yang terdiri dari struktur tiga dimensi protein sebagai alat bantu visualisasi dan analisis perbandingan, dimana kita diperkenalkan dengan konsep dasar tentang struktur protein. Data Base Taxonomy : menjelejahi garis keturunan dan mengenalkan urutan data dari berbagai spesies berbeda yang ada di bumi yang meliputi organisme punah seperti manusia neanderthal. Database pola pewarisan mendel pada manusia (OMIM) Database paper pada pubmed di Medline : perpustakaan obat nasional yang menyediakan pubmed. Kelebihan sistem entrez NCBI, bahwa dengan menggunakan sistem ini memungkinkan kita dapat mengakses dengan mudah semua database yang tersedia yang saling berhubungan satu dengan yang lainnya, semuanya dapat dilakukan hanya dengan mengklik satu tombol. Ruang informasi entrez meliputi : Kutipan pubmed. Data sekuen protein dan nukleotida. Informasi struktur tiga dimensi. Informasi pemetaan genom. NCBI(the US National Center for Biotechnology Information) saat ini merupakan salah satu implementasi dari BLAST (Basic Local Alignment Search Tool)

2.2. BLAST dan FAST Metode pensejajaran yang berbasis heuristik diantaranya FASTA (Fast-All) dan BLAST (Basic local Alignment Search Tools). FASTA diperkenalkan pada tahun 1988 oleh W. Pearson dan D. Lipman. FASTA merupakan metode pertama yang mencari pensejajaran local non-gap kemudian meningkatkan hasilnya dengan menghitung pensejajaran SW pada daerah pensejajaran non-gap. Untuk pensejajaran sekuens DNA dan Protein masing masing menggunakan FAST-N dan FAST-P. BLAST (Basic Local Alignment Search Tool) yaitu sebuah metode yang digunakan secara luas untuk menilai sekuens asam nukleat atau protein dalam database.kesamaan yang signifikan terhadap sekuen query. BLAST diperkenalkan pada tahun 1990 oleh Eugene Myers, Stephen Altschul, Warren Gish, David J. Lipman, and Webb Miller. BLAST juga termasuk pensejajaran non-gap dan gap dalam metode ini baru dibawa kedalam catatan. Metode-metode berbasis heuristik ini memangkas ruang pencarian dengan menggunakan metode aproksimasi yang sangat cepat untuk memilih sekuens pada

database yang agak mirip dengan sekuens query dan untuk mencari daerah kemiripan didalamnya. FASTA dan BLAST lebih cepat (50-100 kali) dari kedua metode sebelumnya. Bagaimanapun, sejumlah konteks ilmiah penting melibatkan komparasi hanya dari dua sekuens dan tidak memerlukan suatu pencarian pada database yang cukup besar dan memakan waktu. Untuk memenuhi kebutuhan ini, banyak tools penting untuk pencarian database yang besar. Seperti yang dijelaskan dalam penelitian Tatiana dan Thomas pada tahun 1999 mengenai tools EMBOSS (European Molecular Biology Open Software Suite) dan BLAST (dalam WBLAST2) yang berkembang cukup pesat untuk mendapatkan pensejajaran global dari sekuens DNA dan protein. Kedua tools ini menyediakan profil global dari tingkat kemiripan.

2.3. DNA Penemuan teknik sekuensing DNA yang lebih cepat pada pertengahan 1970-an menjadi landasan terjadinya ledakan jumlah sekuens DNA yang berhasil diungkapkan pada 1980-an dan 1990-an, menjadi salah satu pembuka jalan bagi proyek-proyek pengungkapan genom, meningkatkan kebutuhan akan pengelolaan dan analisis sekuens, dan pada akhirnya menyebabkan lahirnya bioinformatika. Bioinformatika merupakan ilmu yang mempelajari penerapan teknik komputasional untuk mengelola dan menganalisis informasi biologi. Bidang ini mencakup penerapan metode matematika, statistika, dan informatika untuk memecahkan masalah biologi. Terutama yang terkait dengan penggunaan sekuens DNA (Deoxyribonucleic acid), RNA (Ribonucleic acid) dan asam amino. Bioinformatika, sebagai suatu kajian multidisiplin, merupakan sebuah terobosan baru dalam dunia biomedis. Berbagai penyakit, seperti flu babi, kanker, AIDS, dan lainnya memiliki potensi untuk diatasi dengan bantuannya. Contoh topik utama dalam bioinformatika meliputi pangkalan data untuk mengelola informasi biologi, pensejajaran sekuens (sequences alignment), prediksi struktur untuk meramalkan struktur protein atau pun struktur sekunder RNA, analisis filogenetik, dan analisis ekspresi gen. Sekuens biologi dalam hal ini meliputi sekuens DNA, RNA dan protein. Rantai DNA yang menyandi protein disebut gen. Gen ditranskripsikan menjadi ribonucleic acid messenger (mRNA). Kemudian mRNA ditranslasikan menjadi protein. DNA merupakan polimer yang terdiri dari tiga komponen utama yaitu gugus fosfat, gula dioksiribosa dan basa nitrogen. DNA tersusun dari empat jenis monomer nukleotida yang diwakili oleh empat abjad yaitu adenin (A), timin (T), guanin (G), dan citosin (C). Adenin berikatan dengan Timin, dan Sitosin berikatan dengan

Guanin. Urutan basa nitrogen dalam setiap organisme selalu berbeda, data inilah yang digunakan dalam pensejajaran sekuens. DNA dapat melakukan replikasi, di mana ketika replikasi DNA ini dilakukan, terbentuklah DNA baru yang memiliki informasi genetik yang serupa dengan induknya. RNA dibentuk dengan transkripsi dari DNA, sehingga informasi yang dikandung RNA juga terdapat di dalam DNA cetakannya sehingga sekuens DNA cetakan tersebut sudah cukup untuk membaca informasi pada RNA (kecuali pada eukariota). Oleh karena itu, pensejajaran sekuens lebih banyak dilakukan ditingkat sekuens DNA dan protein. Berdasarkan banyaknya sekuens yang disejajarkan maka, pensejajaran sekuens dikelompokkan menjadi dua yaitu: pensejajaran yang hanya melibatkan sepasang sekuens (disebut pairwise alignment) dan pensejajaran yang melibatkan lebih dari dua sekuens (disebut multiple alignment).

2.4. Virus H1N1 H1N1 ( flu babi) adalah infeksi flu yang disebabkan oleh strain baru virus influenza A. Virus flu babi H1N1 ini merupakan kombinasi dari virus influenza pada manusia, babi, dan burung (avian). Flu babi H1N1 dapat menyebar dengan mudah dari orang ke orang, sama seperti virus flu biasanya. Seseorang tidak dapat terkena flu babi H1N1 akibat memakan daging babi, dan hampir tidak pernah juga dari kontak dengan babi. Gejala yang timbul seperti flu biasa, yaitu berupa demam, batuk, sakit tenggorokan, sakit di badan, sakit kepala, menggigil, hidung berair, dan kelelahan. Selain itu, mual, muntah, dan diare juga sering terjadi.

Gambar 2. Penyebaran virus H1N1

Pada kebanyakan orang, gejala tampaknya mulai muncul 1-5 hari setelah terpapar virus dan berlangsung sampai sekitar 1 minggu. Penderita dapat menularkan infeksi sampai sekitar 8 hari, yaitu sejak satu hari sebelum gejala muncul sampai gejala hilang. Gejala-gejala yang muncul biasanya ringan, tetapi dapat juga menjadi berat, terjadi infeksi paru (pneumonia) dan gagal nafas. Infeksi flu babi H1N1 dapat menyebabkan penyakit kronis menjadi lebih buruk (misalnya penyakit jantung dan paru, serta diabetes). Infeksi juga dapat menyebabkan komplikasi pada kehamilan (misalnya keguguran atau kelahiran prematur). Risiko tinggi terjadi pada orang-orang dengan gangguan ginjal atau hati, atau pada orang-orang dengan sistem kekebalan tubuh yang lemah, akibat obat atau penyakit (misalnya AIDS). Komplikasi yang berat dapat terjadi dan berkembang dengan cepat.

BAB 3. HASIL DAN PEMBAHASAN Langkah 1 Buka menu BLAST pada alamat berikut: http://blast.ncbi.nlm.nih.gov/Blast.cgi

Langkah 2 Pilih nucleotide untuk mencari sequence DNA virus H1N1, ketik H1N1 pada kolom search, lalu klik search. Setelah muncul beberapa pilihan sequence alignment, centang salah satu sequence yang diinginkan, kemudian pilih genbank untuk melihat kode gennya.

Langkah 3 Copy kode GenBank yang muncul, lalu dengan cara yang sama (Langkah 2 dan 3) dapatkan kode GenBank untuk sequence kedua.

Berikut ini hasil rincian serta barisan dua sequence DNA virus H1N1 yang digunakan : Influenza A virus (A/Weiss/43 (H1N1)) neuraminidase (NA) gene, complete cds GenBank: AF250365.2 FASTA Graphics Go to:
LOCUS 2001 DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM Influenza A virus (A/Weiss/43 (H1N1)) neuraminidase (NA) gene, complete cds. AF250365 AF250365.2 . Influenza A virus (A/Weiss/1943(H1N1)) Influenza A virus (A/Weiss/1943(H1N1)) Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE AUTHORS TITLE JOURNAL PUBMED REFERENCE AUTHORS TITLE JOURNAL Department of Cellular Pathology, Armed Forces Institute of Pathology, 14th Street and Alaska Avenue, N.W., Washington, DC 20306-6000, USA COMMENT FEATURES source On Mar 9, 2001 this sequence version replaced gi:8572186. Location/Qualifiers 1..1410 /organism="Influenza A virus (A/Weiss/1943(H1N1))" /mol_type="mRNA" /strain="A/Weiss/43 (H1N1); ATCC VR-96" /db_xref="ATCC:VR-96" /db_xref="taxon:191090" gene 1..1410 /gene="NA" 1 (bases 1 to 1410) Reid,A.H., Fanning,T.G., Janczewski,T.A. and Taubenberger,J.K. Characterization of the 1918 'Spanish' influenza virus neuraminidase gene Proc. Natl. Acad. Sci. U.S.A. 97 (12), 6785-6790 (2000) 10823895 2 (bases 1 to 1410) Reid,A.H., Fanning,T.G., Janczewski,T.A. and Taubenberger,J.K. Direct Submission Submitted (29-MAR-2000) Division of Molecular Pathology, GI:13260589 AF250365 1410 bp mRNA linear VRL 09-MAR-

CDS

1..1410 /gene="NA" /codon_start=1 /product="neuraminidase" /protein_id="AAF77045.1" /db_xref="GI:8572187"

/translation="MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGSQN HTGICNQSIITYKNSTWVNQTYVNISNTNVVAGKGTTSVILAGNSSLCPIRGWAIYSK DNGIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMS CPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDDEAVAVLKYNGIITETIKS WRKKILRTQESECVCVNGSCFTIMTDGPSDGQASYKIFKIEKGKVTKSIELDAPNSHY EECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRSKDGKGS CGPVYVDGANGVKGFSYRYGNGVWIGRTKSDSSRQGFEMIWDPNGWTETDSNFFVKQD IVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSGSSISFCGVNS DTVDWSWPDGAELPFTIDK" ORIGIN 1 atgaatccaa atcagaaaat aataaccatt ggatcaatct gtatggtagt cggaataatt 61 agcctaatat tgcaaatagg gaatattatc tcaatatgga ttagccattc aattcaaact 121 ggaagtcaaa accatactgg aatatgcaac caaagcatca ttacctataa aaatagcacc 181 tgggtaaatc aaacatatgt taatattagc aacactaacg ttgttgctgg aaaaggcaca 241 acttcagtga tattagccgg caattcatct ctttgtccta tccgtgggtg ggctatatac 301 agcaaagata acggcataag aattggttcc aaaggagatg tttttgtcat aagagagcct 361 tttatttcat gttctcactt ggaatgcagg actttttttc tgacccaagg cgccctgttg 421 aatgacaagc attcaaatgg gaccgttaag gacagaagcc cttatagggc cttgatgagc 481 tgccctgtcg gtgaagctcc gtccccgtac aattcaaggt ttgaatcggt tgcttggtca 541 gcaagtgcat gtcatgatgg catgggctgg ctaacaatcg gaatttctgg tccagatgat 601 gaagcagtgg ctgtgttaaa atacaacggc ataataactg aaaccataaa aagttggagg 661 aagaaaatat tgagaacaca agagtctgaa tgtgtctgtg taaatggttc atgttttact 721 ataatgaccg acggcccgag tgatggccag gcctcgtaca aaattttcaa gatcgagaag 781 gggaaggtta ctaaatcaat agagttggat gcacctaatt ctcactacga ggaatgttcc 841 tgttaccctg ataccggcaa ggtgatgtgt gtgtgcagag acaattggca cggttcgaac 901 cgaccatggg tgtctttcga tcaaaatctg gattatcaaa taggatacat ctgcagtggg 961 gttttcggtg acaatccgcg ttccaaagat ggaaaaggca gctgtggtcc ggtgtatgtt

1021 gatggagcaa acggagtaaa gggattttca tacaggtatg gtaatggtgt ttggatagga 1081 aggactaaaa gtgacagttc cagacagggg tttgagatga tttgggatcc taatgggtgg 1141 acagagactg atagtaattt ctttgtgaaa caagatatag tggctatgac tgattggtca 1201 gggtacagcg gaagtttcgt tcaacatcct gagctaacag ggctggactg tatgaggcct 1261 tgcttctggg ttgaattaat caggggacga cctaaagaaa aaacaatctg gactagtggg 1321 agcagcattt ctttttgtgg cgtgaatagt gatactgtag actggtcttg gccagacggt 1381 gccgaattgc cattcaccat tgacaagtag //

Influenza A virus (A/Iowa/1943(H1N1)) segment 6, complete sequence GenBank: CY020463.1 FASTA Graphics
LOCUS 2007 DEFINITION sequence. ACCESSION VERSION KEYWORDS SOURCE ORGANISM CY020463 CY020463.1 . Influenza A virus (A/Iowa/1943(H1N1)) Influenza A virus (A/Iowa/1943(H1N1)) Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. REFERENCE AUTHORS 1 (bases 1 to 1411) Ghedin,E., Spiro,D., Miller,N., Zaborsky,J., Feldblyum,T., Subbu,V., Shumway,M., Sparenborg,J., Groveman,L., Halpin,R., Sitz,J., Koo,H., Salzberg,S.L., Webster,R.G., Hoffmann,E., Krauss,S., Naeve,C., Bao,Y., Bolotov,P., Dernovoy,D., Kiryutin,B., Lipman,D.J. and Tatusova,T. TITLE JOURNAL REFERENCE CONSRTM TITLE JOURNAL The NIAID Influenza Genome Sequencing Project Unpublished 2 (bases 1 to 1411) The NIAID Influenza Genome Sequencing Consortium Direct Submission Submitted (19-MAR-2007) on behalf of TIGR/St. Jude Children's Research Hospital/NCBI, National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA FEATURES source Location/Qualifiers 1..1411 GI:133754174 Influenza A virus (A/Iowa/1943(H1N1)) segment 6, complete CY020463 1411 bp cRNA linear VRL 19-MAR-

/organism="Influenza A virus (A/Iowa/1943(H1N1))" /mol_type="viral cRNA" /strain="A/Iowa/1943" /serotype="H1N1" /host="Human" /db_xref="taxon:425563" /segment="6" /lab_host="E57 passage(s)" /country="USA: Iowa" /collection_date="1943" gene CDS 1..1410 /gene="NA" 1..1410 /gene="NA" /codon_start=1 /product="neuraminidase" /protein_id="ABO38376.1" /db_xref="GI:133754175" /translation="MNPNQKIITIGSICMVVGIISLILQIGNIISIWISHSIQTGSQN HTGTCNQSIITYKNSTWVNQTYVNISNTNVVAGKDTTSVILAGNSSLCPIRGWAIYSK DNGVRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMS CPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDDGAVAVLKYNGIITETIKS WRKEILRTQESECACVNGSCFTIMTDGPSGGPASYKIFKIEKGKVTKSIELDAPNSHY EECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQMGYICSGVFGDNPRPKDGKGN CGPVYVDGANGVKGFSYRYGNGVWIGRTKSNSSRQGFEMIWDPNGWTETDSNFFVKQD VVAVTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSGSSISFCGVNS DTVDWSWPDGAELPFTIDK" ORIGIN 1 atgaatccaa atcagaaaat aataaccatt ggatcaatct gtatggtagt cggaataatt 61 agcctaatat tgcaaatagg gaatattatc tcaatatgga tcagccattc aattcaaact 121 ggaagtcaaa accatactgg aacttgcaac caaagcatca ttacctataa aaatagcacc 181 tgggtaaatc aaacatatgt taatattagc aacactaacg ttgttgctgg aaaggataca 241 acttcagtga tattagccgg caattcatct ctttgtccta tccgtgggtg ggctatatac

301 agcaaagata atggcgtaag aattggttcc aaaggagatg tttttgtcat aagagaaccc 361 tttatttcat gttctcactt ggaatgcagg accttttttc tgacccaagg cgccctgttg 421 aatgacaagc attcaaatgg gaccgttaag gacagaagcc cttatagggc cttaatgagc 481 tgccctgtcg gtgaagctcc gtccccgtac aattcaaggt ttgaatcggt tgcttggtca 541 gcaagtgcat gtcatgatgg catgggctgg ctaacaatcg gaatttctgg tccagatgat 601 ggagcagtgg ctgtgttaaa atacaacggt ataataactg aaaccataaa aagttggagg 661 aaggaaatat tgagaacaca agagtctgaa tgtgcctgcg taaatggttc atgtttcact 721 ataatgaccg acggcccgag tggtgggccg gcctcgtaca aaattttcaa gatcgagaag 781 gggaaggtta ctaaatcaat agaattggat gcacctaatt ctcactatga ggaatgttcc 841 tgttaccctg ataccggcaa ggtgatgtgt gtgtgcagag acaattggca cggttcgaac 901 cgaccatggg tgtctttcga tcaaaatctg gattatcaaa tgggctacat ctgcagtggg 961 gttttcggtg acaatccgcg tcccaaagat ggaaaaggca actgtggtcc agtgtatgtt 1021 gatggagcaa acggagtaaa gggattttca tacaggtatg gtaatggtgt ttggatagga 1081 aggactaaaa gtaacagttc cagacagggg tttgagatga tttgggatcc caatgggtgg 1141 acagagactg atagtaattt ctttgtgaaa caagatgtag tggcagtgac tgattggtca 1201 gggtacagcg gaagtttcgt tcaacatcct gagttaacag ggctggactg tatgaggcct 1261 tgcttctggg ttgaattaat caggggacgg cctaaagaaa aaacaatctg gaccagtggg 1321 agcagcattt ctttttgtgg cgtgaatagt gatactgtag attggtcttg gccagacggt 1381 gccgagttgc cattcaccat tgacaagtag t //

Langkah 4 Pilih nucleotide blast untuk merunning kedua sequence tersebut

Setelah muncul tampilan berikut, masukkan kedua kode GenBank pada dua kolom berikut lalu klik pilihan BLAST yang ada di pojok kiri bawah.

Langkah 5 Berikut interpretasi dari perbandingan dua sequence DNA virus H1N1 yang diperoleh : 1. Graphic Summary Grafik ini menunjukkan kecocokan sequence, di dalamnya terdapat color key for alignment scores yang terdiri dari lima bagian warna yaitu hitam, biru, hijau, ungu, dan merah dengan interval tertentu yang telah diberikan. Berdasarkan grafik tersebut tampak bahwa kecocokan antara dua sequence DNA tersebut mencapai 200 karakter. Interval (>=200) menunjukkan suatutingkat kemiripan (similarity) yang tertinggi, sedangkan warna hitam dengan interval (<40) menunjukkan suatu tingkat kemiripan (similarity) yang terendah. kemiripan

Sehinggadenganmenggunakan color key ini, maka dapat dilihat tingkat (similarity) antaraquery sequence dan subject sequence.

2. Dot Matrix Grafik ini menunjukkan pasangan dua sequence DNA H1N1. Sumbu horisontal menunjukkan sequence pertama dengan jumlah karakter sebanyak 1410 dan sequence kedua ditunjukkan pada sumbu vertikal dengan karakter yang sama jumlahnya.

3. Description Description menunjukkan persentase kesamaan antara dua sequence alignment DNA virus H1N1 sebesar 97% serta maximal dan total scorenya senilai 2394 dengan Query cover mencapai 100%.

4. Alignment Alignment menunjukkan pasangan pensejajarannya, antara dua sequence alignment DNA virus H1N1 dan dapat dilihat dalam tabel berikut ini: ScoreExpectIdentities GapsStrand Score Expect Identities 2394 bits(1296) 0.0 1372/1410(97%)
Query Sbjct Query Sbjct Query Sbjct 1 1 61 61 121 121

Gaps 0/1410(0%)

Strand Plus/Plus
60 60 120 120 180 180

ATGAATCCAAATCAGAAAATAATAACCATTGGATCAATCTGTATGGTAGTCGGAATAATT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ATGAATCCAAATCAGAAAATAATAACCATTGGATCAATCTGTATGGTAGTCGGAATAATT AGCCTAATATTGCAAATAGGGAATATTATCTCAATATGGATTAGCCATTCAATTCAAACT ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| AGCCTAATATTGCAAATAGGGAATATTATCTCAATATGGATCAGCCATTCAATTCAAACT GGAAGTCAAAACCATACTGGAATATGCAACCAAAGCATCATTACCTATAAAAATAGCACC |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| GGAAGTCAAAACCATACTGGAACTTGCAACCAAAGCATCATTACCTATAAAAATAGCACC

Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct

181 181 241 241 301 301 361 361 421 421 481 481 541 541 601 601 661 661 721 721 781 781 841 841 901 901 961 961 1021 1021

TGGGTAAATCAAACATATGTTAATATTAGCAACACTAACGTTGTTGCTGGAAAAGGCACA ||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||| TGGGTAAATCAAACATATGTTAATATTAGCAACACTAACGTTGTTGCTGGAAAGGATACA ACTTCAGTGATATTAGCCGGCAATTCATCTCTTTGTCCTATCCGTGGGTGGGCTATATAC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ACTTCAGTGATATTAGCCGGCAATTCATCTCTTTGTCCTATCCGTGGGTGGGCTATATAC AGCAAAGATAACGGCATAAGAATTGGTTCCAAAGGAGATGTTTTTGTCATAAGAGAGCCT ||||||||||| ||| |||||||||||||||||||||||||||||||||||||||| || AGCAAAGATAATGGCGTAAGAATTGGTTCCAAAGGAGATGTTTTTGTCATAAGAGAACCC TTTATTTCATGTTCTCACTTGGAATGCAGGACtttttttCTGACCCAAGGCGCCCTGTTG |||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| TTTATTTCATGTTCTCACTTGGAATGCAGGACCTTTTTTCTGACCCAAGGCGCCCTGTTG AATGACAAGCATTCAAATGGGACCGTTAAGGACAGAAGCCCTTATAGGGCCTTGATGAGC ||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| AATGACAAGCATTCAAATGGGACCGTTAAGGACAGAAGCCCTTATAGGGCCTTAATGAGC TGCCCTGTCGGTGAAGCTCCGTCCCCGTACAATTCAAGGTTTGAATCGGTTGCTTGGTCA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TGCCCTGTCGGTGAAGCTCCGTCCCCGTACAATTCAAGGTTTGAATCGGTTGCTTGGTCA GCAAGTGCATGTCATGATGGCATGGGCTGGCTAACAATCGGAATTTCTGGTCCAGATGAT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GCAAGTGCATGTCATGATGGCATGGGCTGGCTAACAATCGGAATTTCTGGTCCAGATGAT GAAGCAGTGGCTGTGTTAAAATACAACGGCATAATAACTGAAACCATAAAAAGTTGGAGG | ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| GGAGCAGTGGCTGTGTTAAAATACAACGGTATAATAACTGAAACCATAAAAAGTTGGAGG AAGAAAATATTGAGAACACAAGAGTCTGAATGTGTCTGTGTAAATGGTTCATGTTTTACT ||| |||||||||||||||||||||||||||||| ||| ||||||||||||||||| ||| AAGGAAATATTGAGAACACAAGAGTCTGAATGTGCCTGCGTAAATGGTTCATGTTTCACT ATAATGACCGACGGCCCGAGTGATGGCCAGGCCTCGTACAAAATTTTCAAGATCGAGAAG |||||||||||||||||||||| ||| | ||||||||||||||||||||||||||||||| ATAATGACCGACGGCCCGAGTGGTGGGCCGGCCTCGTACAAAATTTTCAAGATCGAGAAG GGGAAGGTTACTAAATCAATAGAGTTGGATGCACCTAATTCTCACTACGAGGAATGTTCC ||||||||||||||||||||||| ||||||||||||||||||||||| |||||||||||| GGGAAGGTTACTAAATCAATAGAATTGGATGCACCTAATTCTCACTATGAGGAATGTTCC TGTTACCCTGATACCGGCAAGGTGATGTGTGTGTGCAGAGACAATTGGCACGGTTCGAAC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TGTTACCCTGATACCGGCAAGGTGATGTGTGTGTGCAGAGACAATTGGCACGGTTCGAAC CGACCATGGGTGTCTTTCGATCAAAATCTGGATTATCAAATAGGATACATCTGCAGTGGG ||||||||||||||||||||||||||||||||||||||||| || ||||||||||||||| CGACCATGGGTGTCTTTCGATCAAAATCTGGATTATCAAATGGGCTACATCTGCAGTGGG GTTTTCGGTGACAATCCGCGTTCCAAAGATGGAAAAGGCAGCTGTGGTCCGGTGTATGTT ||||||||||||||||||||| |||||||||||||||||| ||||||||| ||||||||| GTTTTCGGTGACAATCCGCGTCCCAAAGATGGAAAAGGCAACTGTGGTCCAGTGTATGTT GATGGAGCAAACGGAGTAAAGGGATTTTCATACAGGTATGGTAATGGTGTTTGGATAGGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GATGGAGCAAACGGAGTAAAGGGATTTTCATACAGGTATGGTAATGGTGTTTGGATAGGA

240 240 300 300 360 360 420 420 480 480 540 540 600 600 660 660 720 720 780 780 840 840 900 900 960 960 1020 1020 1080 1080

Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct Query Sbjct

1081 1081 1141 1141 1201 1201 1261 1261 1321 1321 1381 1381

AGGACTAAAAGTGACAGTTCCAGACAGGGGTTTGAGATGATTTGGGATCCTAATGGGTGG |||||||||||| ||||||||||||||||||||||||||||||||||||| ||||||||| AGGACTAAAAGTAACAGTTCCAGACAGGGGTTTGAGATGATTTGGGATCCCAATGGGTGG ACAGAGACTGATAGTAATTTCTTTGTGAAACAAGATATAGTGGCTATGACTGATTGGTCA |||||||||||||||||||||||||||||||||||| ||||||| |||||||||||||| ACAGAGACTGATAGTAATTTCTTTGTGAAACAAGATGTAGTGGCAGTGACTGATTGGTCA GGGTACAGCGGAAGTTTCGTTCAACATCCTGAGCTAACAGGGCTGGACTGTATGAGGCCT ||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||| GGGTACAGCGGAAGTTTCGTTCAACATCCTGAGTTAACAGGGCTGGACTGTATGAGGCCT TGCTTCTGGGTTGAATTAATCAGGGGACGACCTAAAGAAAAAACAATCTGGACTAGTGGG ||||||||||||||||||||||||||||| ||||||||||||||||||||||| |||||| TGCTTCTGGGTTGAATTAATCAGGGGACGGCCTAAAGAAAAAACAATCTGGACCAGTGGG AGCAGCATTTCTTTTTGTGGCGTGAATAGTGATACTGTAGACTGGTCTTGGCCAGACGGT ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| AGCAGCATTTCTTTTTGTGGCGTGAATAGTGATACTGTAGATTGGTCTTGGCCAGACGGT GCCGAATTGCCATTCACCATTGACAAGTAG ||||| |||||||||||||||||||||||| GCCGAGTTGCCATTCACCATTGACAAGTAG 1410 1410

1140 1140 1200 1200 1260 1260 1320 1320 1380 1380

DAFTAR PUSTAKA .

http://www.ncbi.nlm.nih.gov/Blast.cgi. [11 Januari 2014] http://ghr.nlm.nih.gov/handbook/basics/dna. [11 Januari 2014] Yusrotis Z, Alfi .2011. Analisis Sequence DNA virus H1N1Menggunakan Metode Super pairwise alignment. Thesis FMIPA ITS.