Anda di halaman 1dari 153

UNIVERSITAS ISLAM INDONESIA BADAN PENJAMINAN MUTU

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA DEKANAT & DIVISI FAKULTAS TAHUN 2010

BADAN PENJAMINAN MUTU UII Gedung Prabuningrat Lt.3, Jl. Kaliurang km. 14,5 Sleman Yogyakarta Phone (0274) 898444 Ext. 1313 Fax. (0274) 898459 E-mail : bpm@uii.ac.id, Website: www.bpm.uii.ac.id

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

EXECUTIVE SUMMARY
Audit Mutu Internal (AMI) merupakan kegiatan evaluasi kinerja unitunit di lingkungan UU yang dilaksanakan secara periodic setiap tahun. Kegiatan AMI periode20102011berlangsungsecaraserentakuntuk174unityangterbagidalam5 kelompok auditee, yaitu unit Rektorat, Unit Badan & Direktorat, unit Dekanat, UnitDivisiFakultasdanUnitProgramStudi. Indikator kinerja yang dievaluasi antar kelompok unit tidak semua sama dalam hal jumlah maupun jenis kegiatan/prosesnya, tergantung lingkup tugas dan wewenangnya. Khusus untuk unit program studi, Evaluasi kinerja program studi untuk periode Audit Mutu Internal 20102011 mengalami satu perubahan yang sangat signifikandariauditperiodesebelumnya,yaituparameteryangdigunakanadalah7 StandaryangadapadaBorangAkreditasiBANPTdenganbeberapatambahanparameter yang diukur sesuai dengan kekhasan UII (8 Sasaran Mutu Universitas) serta operasionalisasimasingmasingindicatorkinerja. Perubahan ini dilakukan sebagai tindak lanjut dari keputusan Rapat Tinjauan Manajemen tingkat Universitas yang diselenggarakan pada tanggal 23 Juli 2010 dan juga sebagai langkah nyata implementasi prinsip continual improvement SistemManajemenMutudiUII. Sistem penilaian yang digunakan untuk mengklasifikasikan hasil temuan audituntuksemuakelompokadalah4kategorisasitemuansesuaisistemISOatauPM UII 07, yaitu: (1) Tidak ada temuan atau dikategorikan SESUAI; (2) Temuan yang sifatnya OBSERVASI; (3) Temuan dengan klasifikasi MINOR dan (4) Temuan yang sifatnya MAYOR. Bobot untuk setiap kategori adalah: (1) Kategori SESUAI bobotnya 4; (2) Kategori, OBSERVASI diberi bobot 3 (3) Kategori MINOR diberi bobot 2 dan 1dan(4)KategoriMAYORdiberibobot0. Hasil evaluasi kinerja periode 20102011 seluruh unit di UII dibedakan menjadi 2 kelompok, yaitu kinerja unit dan kinerja program studi. Indeks kinerja unitperiode2010sebesar3.38(padaskala04)atausetaradengan84.51%.Secara umum, kinerja unit periode 2010 mengalami peningkatan sebesar 0.24 poin atau 6.01%dibandingkanperiodeauditsebelumnya(3.14) Indeks kinerja program studi sebesar 3.28 (pada skala 04) atau setara 82.01%. Khusus untuk kinerja program studi, hasil capaian audit kinerja 2010 tidak bisa dibandingkan dengan periode sebelumnya karena standar indikator kinerjaperiode2010mengalamiperubahan. Secara lengkap perbandingan hasil capaian kinerja secara keseluruhan bisa diihatpadatabel1.
Tabel1.HasilCapaianKinerjaPeriode2009dan2010

Pengukuran Kinerja Unit ProgramStudi

HasilCapaianKinerja Periode2009 Periode2010 IndeksKinerja %Ketercapaian IndeksKinerja %Ketercapaian 3.14 * 78.50% 3.38 3.28 84.51%. 82.01%.

*Tidakbisadibandingkankarenaadaperubahanparameterkinerjauntukauditperiode2010 Hasil evaluasi kinerja akan disajikan dalam 2 bentuk, yaitu indeks kinerja unit dan deskripsi indikator kinerja yang sudah baik ( 3) dan yang belum sesuai pencapaiannya berdasarkan standar yang telah ditetapkan sebelumnya atau sama denganindekskinerja<3.00.
BPM-UII-YOGYAKARTA/2011 Halaman 1 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

1. IndeksKinerjaUnit 1.1.UnitRektorat Evaluasi kinerja untuk Unit Rektorat diperoleh hasil berupa indeks kinerja sebesar 3. 69. Sama halnya dengan unit program studi, unit Rektorat mengalami perubahan pola audit untuk kegiatan audit periode 2010 sehingga hasilnya tidak bisa dibandingkan dengan periode sebelumnya. Hasil evaluasi kinerja unit Rektorat,bisadilihatpadatabel2berikutini.
Tabel2.HasilCapaianKinerjaPeriode2010UnitRektorat

Unit Rektor WakilRektorI WakilRektorII WakilRektorIII Rektorat

IndeksKinerjaPeriode2010
3.38 3.89 3.68 3.73 3.69

1.2.UnitBadan&Direktorat Untuk unit Badan & Direktorat, hasil evaluasi kinerja periode 2010 secara umum sebesar 3.38 dan mengalami kenaikan 0.13 poin dibandingkan kinerja periode 2009. Unit yang dievaluasi kinerjanya juga bertambah dari 12 unit menjadi 14 unit, yang artinya semua unit untuk kelompok Badan & Direktorat mengikuti kegiatan audit mutu internal secara lengkap. Indeks Kinerja tertinggi untuk periode 2010 diraih oleh DPPM (3.97) dan nilai terendah dicapai oleh Direktorat Humas(0.69). Secara umum, hasil capaian kinerja Badan & Direktorat secara lengkap bisa dilihatpadatabel3.
Table3.HasilCapaianKinerjaPeriode2009dan2010UnitBadan&Direktorat Periode No Unit 2009 2010 Skor Peringkat Skor Peringkat 1 BPA 3.61 3 3.72 8 2 BPM 3.67 2 3.81 4 3 BSI 2.88 10 3.21 12 4 BP * * 1.70 13 5 DA 3.81 1 3.53 10 6 DBMKM 3.16 7 3.74 6 7 DKA 3.42 4 3.75 5 8 DOSDM 3.18 6 3.56 9 9 DPerpustakaan 3.12 8 3.95 2 10 DPKA 2.98 9 3.73 7 11 DPPAI 3.31 5 3.89 3 12 DPPM 3.67 2 3.97 1 13 DSP 2.16 11 3.43 11 14 D.Humas * * 0.69 14 IndeksKinerjaRatarata 3.25 3.38 *Tidakmengikutikegiatanaudit

1.3.UnitDekanat Untuk unit Dekanat, hasil evaluasi kinerja periode 2010 secara umum sebesar 3.38 dan mengalami kenaikan 0.28 poin dibandingkan kinerja periode 2009. Perubahan lain adalah terjadinya pergeseran peringkat. Kinerja tertinggi unit Dekanat periode 2010 diraih oleh FTSP (3.98) sementara FE yang pariode 2009 mendudukiperingkat1bergeserkeperingkat8(3.64)untukkinerjaperiode2010. Hasil capaian kinerja unit Dekanat di lingkungan UII secara lengkap bisa dilihatditabel4.
BPM-UII-YOGYAKARTA/2011 Halaman 2 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Table4.HasilCapaianKinerjaPeriode2009dan2010UnitDekanat Periode No Unit 2009 Peringkat 2010 Peringkat 1 FE 3.96 1 3.64 8 2 FH 3.77 2 3.77 4 3 FIAI 3.62 3 3.66 6 4 FK 2.94 8 3.84 3 5 FMIPA 3.01 7 3.69 5 6 FPISB 3.08 6 3.88 2 7 FTI 3.46 5 3.65 7 8 FTSP 3.61 4 3.98 1 CapaianKinerja 3.48 3.76

1.3.

UnitDivisiFakultas

Hasil evaluasi kinerja unit Divisi yang ada di Fakultas periode 2010 sebesar 3.67 dan secara umum mengalami kenaikan 0.45 poin dibandingkan kinerja periode2009.Tetapijikadilihathasilcapaiankinerjadivisiperfakultas,maka ada2unityangkinerjanyamengalamipenurunan,yaituDivisiFHdanFK,sementara 6 unit lainnya yaitu FE, FIAI, FMIPA, FPISB, FTI dan FTSP mengalami peningkatan indekskinerjayangcukupsignifikan. Indeks kinerja unit divisi fakultas tertinggi dicapai oleh FPISB (3.90) dan terendah dicapai oleh FK (3.01). Hasil capaian indeks kinerja beserta peringkat dan perbandingannya dengan kinerja periode sebelumnya dapat dilihat padatable5.
Tabel5.HasilCapaianKinerjaPeriode2009dan2010UnitDivisiFakultas Periode 2009 3.92 3.72 3.45 3.33 3.07 2.85 2.70 2.68 3.22 Peringkat 1 2 3 4 5 6 7 8 2010 3.86 3.88 3.49 3.85 3.01 3.65 3.73 3.90 3.67 Peringkat 3 2 7 4 8 6 5 1

No 1 2 3 4 5 6 7 8

Unit

DivisiFak.Hukum DivisiFak.TeknikSipildanPerencanaan DivisiFak.TeknologiIndustri DivisiFak.Ekonomi DivisiFak.Kedokteran DivisiFak.IlmuAgamaIslam DivisiFak.MatematikadanIlmuPengatahuanAlam DivisiFak.PsikologidanIlmuSosialBudaya

IndeksKinerja

1.4. UnitProgramStudi Evaluasi kinerja unit Program Studi periode 2010 menggunakan Parameter 7 StandarBorangAkreditasiBAN.Indekscapaiankinerjauntuk21unitprogramstudi bergerak antara 2.65 3.56 dan ratarata nilai capaian kinerja seluruh program studi sebesar 3.28 (skala 0 4). Persentase tingkat ketercapaian kinerja secara umum sebesar 82%. Nilai tertinggi diraih oleh Prodi Akuntansi (3.75) dan nilai terendahdicapaiolehProdiPsikologi(2.82). Hasil evaluasi untuk masingmasing standar menunjukkan bahwa kinerja untuk standar5(kurikulum,pembelajarandansuasanaakademik)mencapainilaitertinggi sebesar 3.56 dan nilai terendah sebesar 2.65 untuk standar 7 (pelayanan/ pengabdiankepadamasyarakatdankerjasama. Capaian indeks kinerja untuk program studi secara umum disajikan secara lengkap pada table 6 dan nilai capaian kinerja seluruh program studi untuk 7 standarakreditasiBANPTbisadilihatpadatable7.
BPM-UII-YOGYAKARTA/2011 Halaman 3 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel6.HasilCapaianKinerjaPeriode2010UnitProgramStudi Fakultas ProgramStudi IndeksCapaianKinerja Peringkat 1 Manajemen 3.60 3 FE 2 Akuntansi 3.75 1 3 IlmuEkonomi 3.39 11 4 IP* 1.75 FH 5 IlmuHukum 3.61 2 6 PAI 2.90 18 FIAI 7 HukumIslam 3.12 15 8 EkonomiIslam 3.40 10 FK 9 Pend.Dokter 3.55 5 10 Statistika 3.54 6 FMIPA 11 IlmuKimia 3.30 13 12 Farmasi 3.57 4 13 Psikologi 3.03 17 FPSB 14 I.Komunikasi 2.33 20 15 T.Mesin 3.03 17 16 T.Elektro 3.49 7 FTI 17 T.Kimia 2.82 19 18 T.Industri 3.13 14 19 T.Informatika 3.31 12 20 T.Arsitektur 3.45 9 FTSP 21 T.Sipil 3.10 16 22 T.Lingkungan 3.47 8 IndeksKinerjaProdi 3.28 *Tidakmenggunakan7StandarBorangAkreditasi Tabel7.HasilCapaianKinerjaPeriode2010SeluruhUnitStandarBorangAkreditasiBANPT. Kinerja ElemenPenilaian Indeks Peringkat Standar1 Visimisi,tujuandansasaransertastrategipencapan 3.48 4 Standar2 Tatapamong,kepemimpinan,systempengelolaandanpenjaminanmutu 3.56 1 Standar3 Mahasiswadanlulusan 3.05 6 Standar4 Sumberdayamanusia 3.16 5 Standar5 Kurikulum,pembelajarandansuasanaakademik 3.50 3 Standar6 Pembiayaan,saranadanprasaranasertasysteminformasi 3.55 2 Standar7 Pelayanan/pengabdiankepadamasyarakatdankerjasama 2.65 7 IndeksKinerjauntuk7Standar 3.28

1.5. UnitLaboratorium Evaluasi kinerja program studi periode 20102011 juga dilakukan untuk laboratorium yang ada di bawah koordinasi prodi atau fakultas. Unit yang dikategorikan dalam kelompok laboratorium adalah Pusat Studi, Pusat pendidikan, Departemen dan Laboratorium sendiri. Program studi yang tidak memiliki unit laboratoriumadalahProdiAkuntansi,IlmuEkonomidanManajemen. Hasil pengukuran hasil kinerja unit laboratorium secara lengkap bisa dilihatpadatabel8berikutini:
Tabel8.HasilCapaianKinerjaPeriode2010UnitLaboratoriumProgramStudi Periode ProgramStudi Unit 2009 2010
JumlahUnit IndeksKinerja JumlahUnit IndeksKinerja

Fakultas

1 2 3 4 5 6 7 8 9 10 11 12 13

FE FH FIAI FK FMIPA FPSB

Manajemen Akuntansi IlmuEkonomi IlmuHukum PAI HukumIslam EkonomiIslam Pend.Dokter Statistika IlmuKimia Farmasi Psikologi I.Komunikasi

TidakadaLaboratorium,PusatStudimaupunDepartemen 2 PusatStudi/ Pelatihan Departemen Laboratorium Laboratorium Laboratorium Laboratorium Laboratorium 2 11 1 3 5 1 1 3.93 2.33 3.34 2.56 3.15 3.25 3.27 3.12 2 2 22 2 3 6 1 1 3.55 2.62 2.98 3.69 3.45 3.54 3.89 *

BPM-UII-YOGYAKARTA/2011

Halaman 4 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Periode Fakultas 14 15 16 17 18 19 20 21 ProgramStudi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan Unit
JumlahUnit

2009
IndeksKinerja JumlahUnit

2010
IndeksKinerja

FTI

FTSP

Laboratorium Laboratorium Laboratorium Laboratorium Laboratorium Laboratorium Laboratorium Laboratorium

6 6 6 5 5 4 9 1

1.69 2.35 2.62 3.49 2.31 3.24 3.73 2.65

6 6 6 6 5 4 9 1

2.59 3.55 3.39 3.69 3.31


3.71 3.56 3.56

2.

DeskripsiIndikatorKinerjadenganindeks3.00dan<3.00.

Indikator kinerja 3.00 adalah kinerja yang sudah mencapai nilai baik sementara yang < 3.00 adalah itemitem yang nilainya didominasi oleh skor 0,1,2 ataukosong(belumadanilaiatautidakdinilai)atauyanghasilcapaiannyabelum sesuaistandar. Uraian untuk deskripsi indikator kinerja baiak yang sudah baik maupun yang masihbelumsesuaistandar,akandisajikanberdasarkankelompokunitnya. 2.1.UnitBadan&Direktorat Indikator kinerja yang mendapatkan skor di atas 3.00 sudah merata pada 8 indikator kinerja yang dievaluasi dan berlaku hampir pada semua unit kecuali untukunitBPdanDirektoratHumas. Indikator kinerja yang hasil capaian indeks kinerja < 3.00 hanya terjadi di unit Badan Perencana dan Direktorat Humas. Untuk Direktorat Humas, nilai semua indikator kinerja bergerak antara 0 1.87 dan belum ada satu indikatorpun yang mencapai standar kinerja yang ditetapkan. Sementara untuk Badan Perencana, ada 3 indikator yang mendapatkan nilai 0, yaitu Pencapaian program kerja rutin, Penerapan Prosedur Kerja (untuk Divisi), Tingkat pemahaman, Proses evaluasi KedisiplinanKerjadanProsespengendaliandanevaluasiKeluhanPelanggan. 2.3.UnitDivisiFakultas Secara umum, kinerja divisi mengalami peningkatan dengan hasil yang baik (indeks 3.00) kecuali untuk Divisi Perpustakaan Fakultas Kedokteran di mana 5 dari8indikatorkinerjamendapatkannilaidibawah2.75. Untuk unit divisi fakultas secara keseluruhan, indikator kinerja yang indeks capaian kinerja < 3.00 dan terjadi hampir merata untuk unit Divisi Fakultasadalah: a. b. c. 2.4.UnitProgramStudi Indikator kinerja yang mendapatkan skor tertinggi pada setiap standar untukunitprogramstudiadalah: (1) Visi,MisidanSasaranMutuProdi: a. b. c. ProsesPenyusunanVisi,MisidanTujuanProdi=3.90(1.1.1.2). Ketersediaansasaran(mutu)prodi=3.90(1.1.1.3) Upayadanstrategipencapaiansasaranmutuprodi=3.90(1.1.2.1)
BPM-UII-YOGYAKARTA/2011 Halaman 5 dari 152

Pencapaianprogrampengembanganunit Proses koordinasi internal unit dalam pelaksanaan program kerja rutindantindaklanjutRTM Prosesevaluasikedisiplinankerja

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

(2) Kurikulum a. b. c. Orientasi kurikulum dan kesesuaian dengan visi dan misi = 4.00 (5.1.2) Susunan kurikulum yang dinilai adalah urutan yang logis, proporsional,konsistendaristrukturkurikulum=3.95(5.1.3.1) Penyesuaian kurikulum dengan pengembangan Iptek dan kebutuhan pemangkukepentingan=3.95(5.3.2)

(3) SaranadanPrasarana a. Ketersediaan dan jenis prasarana, sarana dan dana yang memungkinkan terciptanya interaksi akademik antara sivitas akademika = 4.00 5.7.2). Prasarana lain yang menunjang (misalnya tempat olah raga, ruang bersama,ruanghimpunanmahasiswa,poliklinik)=3.95(6.3.3) Tersedianya akses bagi mahasiswa untuk mendapatkan pelayanan dalam membina dan mengembangkan penalaran, minat, bakat, seni, dan kesejahteraan=4.00(3.6.1).

b. c.

(4) KetersediaanStandar/PanduanuntukKegiatan/Aktivitas/Proses a. b. c. Menggunakan 5 pilar tata pamong sebagai strategi dalam melaksanakan tatapamong=3.89(2.1.1.2) Sistem rekruitmen calon mahasiswa baru, dokumentasi kebijakan dan konsistensipelaksanaannya=4.00(3.1). Pedoman tertulis tentang sistem seleksi, penempatan, pengembangan, retensi, dan pemberhentian dosen dan tenaga kependidikan = 4.00 (4.1) Ketersediaan panduan pembimbingan TA/Skripsi/ Penelitian/Karya ilmiah, Sosialisasi, dan konsistensi pelaksanaannya = 3.95 (5.6.1)

d.

(5) BahanPustaka Bahanpustakaberupabukuteks=3.95(6.4.1.a1) Jumlahjudulbukuteks=3.95(6.4.1.a2) Bahan pustaka berupa disertasi/tesis/ skripsi/ tugas akhir = 3.95 (6.4.1.b) (6) Kerjasama a. b. c. a. Kegiatan kerjasama dengan instansi di dalam negeri dalam tiga tahun terakhir=3.65(7.3.1)

Indikator kinerja yang indeks capaian kinerja masih belum sesuai standar (<3.00)danterjadihampirmeratadisemuaprogramstudiadalah: (1) SasaranMutu: a. b. c. d. e. (2) TingkatKetercapaianSasaran(Mutu)Prodi=1.88(1.1.2.2) Ketersediaan Program studi S1 terakreditasi internasional = 1.95 (2.6.2) Profil masa tunggu bagi lulusan untuk memperoleh pekerjaan yang pertama=2.65(3.7.1.4) Capaian kompetensi KeUIIan lulusan meliputi keislaman, kebangsaan, kewirausahaandanbahasaInggris=2.92(3.5.1.3.1) Prosentasejumlahdosenasing=2.31(4.3.3)

ProporsiMahasiswa a. b. c. Persentasemahasiswaasingbaruterhadaptotalmahasiswabaru=1.33 (3.2.1.6) PersentasemahasiswayangDOataumengundurkandiri=1.76(3.5.1.1)


Halaman 6 dari 152

BPM-UII-YOGYAKARTA/2011

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

d. e. f. g. Rasio calon mahasiswa yang ikut seleksi dengan daya tampung = 2.62 (3.2.1.1) Rasiomahasiswabaruterhadaptotalmahasiswa=2.79(3.2.1.4) Rasio mahasiswa baru reguler yang melakukan registrasi:calon mahasiswabarureguleryanglulusseleksi=2.56(3.2.1.2) Rasio mahasiswa terhadap dosen tetap yang bidang keahliannya sesuai denganbidangPS=2.84(4.3.2)

(3) Lulusan/Alumni a. Pendapat pengguna (employer) lulusan terhadap kualitas alumni = 2.82 (3.7.1.3)

(4) KondisiDosen Dosen yang memiliki jabatan Guru Besar yang bidang keahliannya sesuaidengankompetensiPS=1.26(4.3.1.4) b. Kegiatan dosen tidak tetap yang bidang keahliannya sesuai dengan PS dalam seminar ilmiah/ lokakarya/ penataran/ workshop/pagelaran/ pameran/peragaan yang tidak hanya melibatkan dosen PT sendiri = 2.33 (4.5.3) c. Persentase jumlah dosen tidak tetap terhadap jumlah seluruh dosen denganindekssebesar2.42(4.4.1) d. Dosen tetap yang berpendidikan S3 yang bidang keahliannya sesuai dengankompetensiPS=(4.3.1.2) e. Kegiatan tenaga ahli/pakar sebagai pembicara dalam seminar/ pelatihan, pembicara tamu, dsb, dari luar PT sendiri (tidak termasuk dosentidaktetap)=2.68(4.5.1) f. Dosen tetap yang memiliki jabatan lektor kepala dan guru besar yang bidangkeahliannyasesuaidengankompetensiPS=2.76(4.3.1.3) g. Dosen yang memiliki Sertifikat Pendidik Profesional = 2.79 (4.3.1.5) (5) Perpustakaan a. Pustakawandankualifikasinyadenganindeks2.67(4.6.1.1) Rataratawaktupenyelesaianpenulisantugasakhir=2.48(5.6.5) Ratarata banyaknya mahasiswa per dosen Pembimbing Akademik per semester=2.57(5.5.1) Jumlah ratarata pertemuan pembimbingan/mahasiswa/semester = 2.65 (5.5.3) Keterlibatan mahasiswa yang melakukan tugas akhir dalam penelitian dosen Prosentase ketersediaan SAP dan course outline mata kuliah = 2.52 (5.2.3.2) Persentase ratarata kehadiran mahasiswa kuliah/semester= 2.85 (5.4.5.1) Rata2 kehadiran dosen mengajar sesuai standar minimal 90% = 2.95 (5.4.4.2) Efektivitaskegiatanperwalian=2.86(5.5.4) a.

(6) TugasAkhir a. b. c. d.

(7) Perkuliahan a. b. c. d.

(8) KaryaIlmiahDosen a. Karya PS/institusi yang telah memperoleh perlindungan Hak atas KekayaanIntelektualdalamtigatahun=1.67(7.1.4)

BPM-UII-YOGYAKARTA/2011

Halaman 7 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

b. Jumlah penelitian yang sesuai dengan bidang keilmuan PS, yang dilakukan oleh dosen tetap yang bidang keahliannya sama dengan PS per tahun,selama3tahun(7.1.1) Jumlah artikel ilmiah yang dihasilkan oleh dosen tetap yang bidang keahliannyasamadenganPSpertahun,selama3tahun(7.1.3)

c.

(9) PengabdiandanKerjasama a. b.

Keterlibatan mahasiswa dalam kegiatan pelayanan/pengabdian kepada masyarakat=2.95(7.2.2) Kegiatan kerjasama dengan instansi di luar negeri dalam tiga tahun terakhir=2.76(7.3.2)

3.5.UnitLaboratorium Secara umum, kinerja laboratorium peningkatan dengan hasil yang baik (indeks 3.00) kecuali laboratorium prodi Teknik Mesin dan departemen (non praktikum)prodiPendidikanDokter. Indikator kinerja yang hasil capaian indeks kinerja < 3.00 dan terjadi hampirmeratauntukunitlaboratoriumadalah: a. b. c. Tingkatkinerjalab ProsesPencapaianProgrampengembanganUnit Prosesevaluasikedisiplinankerja

Sementara unit laboratorium di FIAI (PKBHI dan PPPI) dan unit laboratorium diprodiPendidikanDokter(departemen),selainpada3indikatorkinerjadiatas, indikator kinerja lainnya yang belum mencapai standar minimal yang telah ditetapkanyaitu: a. Prosespemahaman,realisasidanevaluasiDCM b. PenerapanProsedurKerja c. Prosespengendaliandanevaluasikeluhanpelanggan.


BPM-UII-YOGYAKARTA/2011 Halaman 8 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

PENDAHULUAN
Audit Mutu Internal (AMI) merupakan kegiatan evaluasi kinerja unitunit di lingkungan UU yang dilaksanakan secara periodik setiap tahun. Kegiatan AMI periode20102011berlangsungsecaraserentakuntuk174unityangterbagidalam5 kelompok auditee, yaitu unit Rektorat, Unit Badan & Direktorat, unit Dekanat, UnitDivisiFakultasdanUnitProgramStudi. Kelompok Dekanat dan Divisi Fakultas, terdiri dari 8 Fakultas, yaitu FakultasEkonomi,FakultasHukum,FakultasIlmuAgamaIslam,FakultasKedokteran, FakultasMatematikadanIlmuPengetahuanAlam,FakultasPsikologidanIlmuSosial Budaya,FakultasTeknologiIndustridanFakultasTeknikSipildanPerencanaan. Untuk kelompok Direktorat & Badan, unit yang mengikuti kegiatan audit ada 12 yaitu Badan Pengendali Mutu (BPM), Badan Perencana Akademik (BPA), Badan SistemInformasi(BSI).,DirektoratPengabdianPadaMasyarakat(DPPM),Direktorat Pendidikan dan Pengembangan Agama Islam (DPPAI), Direktorat Perpustakaan, Direktorat Akademik (DA), Direktorat Organisasi dan Sumber Daya Manusia (DOSDM), Direktorat Akuntansi dan Keuangan (DAK), Direktorat Pemasaran, Kerjasama dan Alumni (DPKA), Direktorat Pengembangan Bakat, Minat dan Keterampilan Mahasiswa (DPBMKM)danDirektoratSaranaPrasarana(DSP). Kelompok program studi (prodi) terdiri dari 22 unit, yaitu Manajemen, Akuntansi, Ilmu Ekonomi, Ilmu Hukum, PAI, Hukum Islam, Ekonomi Islam, Pend. Dokter, Statistika, Ilmu Kimia, Farmasi, Psikologi, I.Komunikasi, T.Mesin, T. Elektro, T. Kimia, T. Industri, T., Informatika, T. Arsitektur, T. Sipil, T. Lingkungan. Khusus untuk unit program studi yang memiliki subunit seperti laboratorium atau departemen atau pusat studi, maka subunit tersebut dievaluasi kinerjanyasecaramandiri. Indikator kinerja yang dievaluasi antar kelompok unit tidak semua sama dalam hal jumlah maupun jenis kegiatan/prosesnya, tergantung lingkup tugas dan wewenangnya. Untuk unit Rektorat, masingmasing indicator kinerja untuk Rektor, WakilRektorI,IIdanIII,indicatorkinerjayangdievaluasiadalah: Rektor,ada2indicatoryangdievaluasi,yaitu: (1) Mengukur Pencapaian Renstra dan pengembangan universitas berdasar arahanPengurusHarianBadanWakaf (2) Mengukur Kepemimpinan dan kemampuan proses koordinasi (RTM) dan tindak lanjut WakilRektorI,ada4indikatoryangdiveluasiyaitu: (1) MengukurpencapaianpenyusunanstrategiBidangAkademik (2) Mengukur pencapaian program kerja maupun RENSTRA dalam rangka pencapaianSMUniversitas (3) Mengukurkemampuanproseskoordinasidantindaklanjut (4) Mengukur pengusulan kebijakankebijakan bidang Pengembangan Akademik PBM, Penelitian, pengabdian Masyarakat, perpustakaan dan pemberdayaan umat WakilRektorII,ada5indikatorkinerjayangdievaluasi,yaitu: (1) PencapaianpenyusunanstrategiBidangKeuangan (2) Pencapaian program kerja dan Renstra dalam rangka mendukung SMU yang didukungolehdokumenterotorisasi (3) Pencapaianpenyusunananggarandansistemkeuangan,OrganisasidanSDM, SaranadanPrasarana (4) Pencapaian penyusunan bidang usaha dan investasi serta kesejahteraan danpemberdayaanumat(THT,BansoskesdanZIS)
BPM-UII-YOGYAKARTA/2011

Halaman 9 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

(5) Proseskoordinasi(RTM)dantindaklanjut WakilRektorIII,ada5indikatorkinerjayangdievaluasi,yaitu: (1) Pencapaian penyusunan strategi/kebijakan Bidang pembinaan bakat/minat dan kesejahteraan mahasiswa, admisi dan pemasaran, kerjasama dan alumni,pendidikandanpengembanganagamaIslam (2) Pencapaian program kerja dan Renstra dalam rangka mendukung SMU yang didukungolehdokumenterotorisasi (3) Penyusunanstrategi/kebijakanmenciptakanlingkungankampusyangislami dan dakwah islamiyah, pembinaan dan pengelolaan aktivitas masjid, asramamahasiswa,pesantrenGORdanfasilitaslainnya (4) Proseskoordinasi(RTM)dantindaklanjut (5) Pelaksanaan pengembangan Alumni Career Center, pondok pesantren dan Ma'had SementarauntukunitDekanatada13indikatoryangdiaudit,yaitu: (1) (2) (3) (4) (5) (6) (7) (8) (9) (10) (11) (12) (13) PencapaianSasaranMutuFakultas(SMF) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembanganunit Proses koord internal unit pelaksanaan program kerja rutin dan tindaklanjutRTM Implementasi kebijakan dan perencanaan program bid Pendidikan dan PengajaranFak ImplementasikebijakandanperencanaanprogrambidangKeuangan ImplementasikebijakandanperencanaanprogrambidangSDM Implementasi kebijakan dan perencanaan program bidang Sarana Prasarana Implementasikebijakandanperencanaanprogrambidangkemahasiswaan Implementasi kebijakan dan perencanaan program kerja sama dengan pihakluar Implementasikebijakandanperencanaanprogrampenerimaanhibah ProsesevaluasiKedisiplinanKerja ProsespengendaliandanevaluasiKeluhanPelanggan

Untuk unit Divisi Fakultas dan unit Badan & Direktorat, ada 8 Indikator, yaitu: PencapaianSasaranMutuUnit(SMU) Pencapaianprogram/rencanakerjarutin Pencapaianprogram/rencanakerjapengembanganunit Koordinasi internal unit pelaksanaan program kerja rutin & tindak lanjutRTM (5) PenerapanProsedurKerja(PK) (6) Pemahaman,realisasidanevaluasiDCM (7) ProsesEvaluasiKedisiplinanKerja (8) ProsesPengendaliandanevaluasiKeluhanPelanggan Khusus untuk unit program studi, Evaluasi kinerja program studi untuk periode Audit Mutu Internal 20102011 mengalami satu perubahan yang sangat signifikandariauditperiodesebelumnya,yaituparameteryangdigunakanadalah7 StandaryangadapadaBorangAkreditasiBANPTdenganbeberapatambahanparameter yang diukur sesuai dengan kekhasan UII (8 Sasaran Mutu Universitas) serta operasionalisasimasingmasingindicatorkinerja. Perubahan ini dilakukan sebagai tindak lanjut dari keputusan Rapat Tinjauan Manajemen tingkat Universitas yang diselenggarakan pada tanggal 23 Juli (1) (2) (3) (4)

BPM-UII-YOGYAKARTA/2011

Halaman 10 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

2010 dan juga sebagai langkah nyata implementasi prinsip continual improvement SistemManajemenMutudiUII. Adapun ke7 standar yang digunakan sebagai acuan evaluasi kinerja sesuai borangakreditasiBANPT,yaitu: (1) (2) (3) (4) (5) (6) (7) Standar 1 mengukur visi misi, tujuan dan sasaran serta strategi pencapan Standar 2 mengukur tata pamong, kepemimpinan, system pengelolaan dan penjaminanmutu Standar3mengukurmahasiswadanlulusan Standar4mengukursumberdayamanusia Standar5mengukurkurikulum,pembelajarandansuasanaakademik Standar 6 mengukur pembiayaan, sarana dan prasarana serta system informasi Standar 7 mengukur pelayanan/pengabdian kepada masyarakat dan kerjasama.

Sementara ke8 Sasaran Mutu Universitas yang ditambahkan dalam pengukuran hasilkinerjaprogramstudiadalah: (1) (2) (3) (4) Lulusanbekerjadalamenambulanpertamaminimal90%. Tepatwaktustudiminimal90%. Nilai Kinerja Dosen dalam performa pedagogik, sosial dan profesional dosendengannilaibaikminimal90%. Capaian kompetensi keUIIan lulusan yang meliputi keislaman, kebangsaan, kewirausahaan, bahasa inggris dengan nilai baik, minimal 90%. ProgramstudiS1terakreditasiinternasional Jumlahdosendenganpublikasikaryailmiahinternasionalminimal5% Jumlahstafedukatifasingminimal1%. Jumlahmahasiswabaruberasaldariluarnegeriminimal1%.

(5) (6) (7) (8)

Sistem penilaian yang digunakan untuk mengklasifikasikan hasil temuan audituntuksemuakelompokadalah4kategorisasitemuansesuaisistemISOatauPM UII07,yaitu: (1) Tidak ada temuan atau dikategorikan SESUAI, dengan kriteria auditee telah menerapkan SMM sesuai dengan kriteria audit yang ditetapkan dan atau telah memenuhi tingkat pencapaian sasaran dalam bentuk persentasesesuaistandartyangditentukan. Temuan yang sifatnya OBSERVASI dengan kriteria adanya tindakan atas penerapan sistem manajemen mutu yang terlupakan belum dilaksanakan oleh auditee misal belum dilakukannya otorisasi atas sebuah dokumen atauadanyasaranuntuktindakanperbaikankearahpositif Temuan dengan klasifikasi MINOR dengan kriteria penerapan SMM oleh auditee belum sesuai (menyimpang) dari kriteria audit yang ditetapkan dan atau persentase tingkat pencapaian sasaran yang ditentukan belum memenuhi standard, ketidaksesuaian yang ditemukan dapatsegeradiperbaiki. Temuan yang sifatnya MAYOR dengan kriteria auditee tidak melaksanakan/menerapkan Sistem Mutu sebagaimana ditentukan dalam dokumen Sistem Mutu sehingga dapat mempengaruhi keberlangsungan kegiatanunit.

(2)

(3)

(4)

Langkah berikutnya adalah pembobotan untuk setiap temuan. Setiap kategori memiliki indikatorindikator terkait dengan pencapaian sebuah proses atau kegiatan.Bobotuntuksetiapkategoriadalah:
BPM-UII-YOGYAKARTA/2011 Halaman 11 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

(1) (2) (3) (4) KategoriTidakAdaTemuanataukategoriSESUAIdiberibobot4 Kategori,OBSERVASIdiberibobot3 Kategori MINOR diberibobot 2 dan 1 (MINOR2bobotnya 2dan MINOR1 bobotnya1) KategoriMAYORdiberibobot0.

Data dari hasil pengukuran kinerja ada 2 jenis, yaitu data angka (kuantitatif)yang berupaindekskinerja dandatadeskriptiftemuan(kualitatif), yang berupa uraian temuan, hasil analisis penyebab dan rencana tindak lanjutnya, berupaperbaikanmaupunpencegahan.



BPM-UII-YOGYAKARTA/2011 Halaman 12 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

HASILPENGUKURANKINERJA UNITDEKANAT&DIVISIFAKULTAS
Hasil pengukuran kinerja 8 unit Dekanat dan 36 unit Divisi Fakultas disajikan dalam 2 bagian. Bagian pertama adalah hasil pengukuran untuk Unit DekanatdanbagiankeduaadalahhasilpengukuranunitDivisiFakultas. Urutan penyajian data hasil audit untuk Kinerja Unit Dekanat dan Divisi Fakultas adalah (1) Indeks Kinerja Unit Dekanat periode 20102011 per indikator kinerja, (2) Temuan Deskriptif dan analisis penyebab dan rencana tindak lanjut dari temuan perfakultas dengan urutan penyajian sesuai abjad, yaitu FE, FH, FIAI,FMIPA,FK,FPSB,FTIdanFTSPdan(3)Kesimpulan A.HASILEVALUASIUNITDEKANAT 1.IndeksKinerjaUnitDekanatPerIndikatorKinerja Indeks kinerja periode 2010 untuk unit Dekanat di lingkungan UII sebesar 3.76dansecaraumummengalamipeningkatansebesar0.38poindibandingkankinerja periode sebelumnya (3.48). Tetapi jika dilihat hasil capaian kinerja dekanat per fakultas, maka ada 2 unit yang kinerjanya mengalami penurunan, yaitu Dekanat FMIPA dan FK. Sementara 6 unit lainnya yaitu FE, FH, FIAI, FPISB, FTI dan FTSP mengalamipeningkatanindekskinerjayangcukupsignifikan. Indeks kinerja unit dekanat tertinggi dicapai oleh Dekanat FTSP (3.98) dan terendah dicapai oleh dekanat FE. Hasil capaian indeks kinerja secara lengkap untukmasingmasingunit dekanatsekaligusperbandingannya dengankinerjaperiode sebelumnya dapat dilihat dari tabel 3.1. Sementara hasil capaian kinerja setiap unitdekanatperindikatorkinerjabisadilihatpadatable3.2.
Table3.1.PerbandinganHasilCapaianKinerjaUnitDekanatPeriode20082009 Periode No Unit 2009 Peringkat 2010 Peringkat 1 FE 3.96 1 3.64 8 2 FH 3.77 2 3.77 4 3 FIAI 3.62 3 3.66 6 4 FK 2.94 8 3.84 3 5 FMIPA 3.01 7 3.69 5 6 FPISB 3.08 6 3.88 2 7 FTI 3.46 5 3.65 7 8 FTSP 3.61 4 3.98 1 IndeksKinerja 3.48 3.76 Tabel3.2.HasilCapaianAMIKinerjaUnitDekanatPeriode2010:PerIndikatorKinerja No 1 2 3 4 5 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) PencapaianprogramkerjaatauRENSTRA dalamrangkapencapaianSMU Pencapaianprogramkerjapengembangan Kebijakandanperencanaanprogrambidang PendidikandanPengajaranFakultas Kebijakandanperencanaanprogrambidang Keuangan FE 3.83 3.80 3.50 3.71 3.83 FIAI 4.00 3.80 3.50 3.63 3.67 FK 3.67 4.00 3.75 3.00 4.00 FMIPA 3.33 3.60 3.25 4.00 3.67 FTSP 3.80 4.00 3.80 4.00 4.00 FTI 2.83 3.80 3.50 4.00 3.17 FPSB 3.67 3.80 3.50 4.00 4.00 FH 2.50 3.60 3.50 3.86 4.00

BPM-UII-YOGYAKARTA/2011

Halaman 13 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No 6 7 8 9 10 11 12 13 IndikatorKinerja Kebijakandanperencanaanprogrambidang SDM Kebijakandanperencanaanprogrambidang SaranaPrasarana Kebijakandanperencanaanprogrambidang Kemahasiswaan Kebijakandanperencanaanprogramkerja samadenganpihakluar FE 3.83 3.33 3.63 3.50 FIAI 4.00 3.50 3.50 3.50 3.00 4.00 4.00 3.50 3.66 FK 3.67 3.83 4.00 4.00 4.00 4.00 4.00 4.00 3.84 FMIPA 3.5 3.67 3.50 3.50 3.63 3.75 3.75 4.00 3.69 FTSP 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.98 FTI 3.50 3.67 4.00 4.00 3.00 4.00 4.00 4.00 3.65 FPSB 4.00 3.83 3.88 4.00 3.75 4.00 4.00 4.00 3.88 FH 4.00 4.00 4.00 4.00 3.50 4.00 4.00 4.00 3.77

Kebijakandanperencanaanprogram penerimaanhibah 3.00 KemampuanKepemimpinanoperasionaldalam halproseskoordinasiinternalunitdan tindaklanjutRTM EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhan Pelanggan 3.67 3.67 4.00 3.64

INDEKSKINERJA

2.TemuanDeskriptif,AnalisisPenyebabdanRencanaTindakLanjut Padabagianiniakandisajikanhasilauditberupadeskripsitemuan, analisispenyebabdanrencanatindaklanjutberupatindakanperbaikandan pencegahan.Hasilauditakandisajikandalambentuktable.


Tabel3.3.DataDeskriptifHasilAMIKinerjaDekanatFEPeriode2010 TemuanDekanatFE AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 TidakAdaTemuan

Tabel3.4.DataDeskriptifHasilAMIKinerjaDekanatFHPeriode2010 TemuanDekanatFH AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1. 3,PengukuranparameterSMU. Dari 7 SMU fakultas yang sudah TindakanPerbaikan: Dari7sasaranyangbisa bias diukur 4, sehingga sasaran Terhadap3aspekyangbelumterukur diukurbaru4.Sehingga harussegeradilakukantindakan mutuyangterukur57% SasaranMutuygterukur57% pengukuranagar TindakanPencegahan: MonitoringdanevaluasiSMUagar tindakanyangsudahdilaksanakandan direncanakanbenarbenarterwujud 2. SosialisasiSMUyangefektif belumadanotulenrapatnya 3. Pencapaiansasarandidukung Dari 7 SMU fakultas yang sudah TindakanPerbaikan: olehdokumenyangsudah bias diukur 3.5 sehingga Terhadap3,5aspekyangbelum diotorisasi.SasaranMutuyan sasaranmutuyangterukur50% terukurharussegeradilakukan terukur3,5dari7sasaran tindakanpengukuranagar7parameter mutu3.5/7=50% SMUterlaksana TindakanPencegahan: MonitoringdanevaluasiSMUagar tindakanyangharusdilaksanakandan direncanakanbenarbenarterwujud 4. Belum dilakukan Evaluasi dan Belumtersediaevaluasidan TindakanPerbaikan: tindaklanjut SMU serta tindaklanjutmelaluirapat Perlusegeradilakukanrapat kendaladanpeluangyangada evaluasiSMUdenganbukti evaluasiSMUdenganbuktinotulasi notulenyangdiotorisasidan adapenjelasanakarmasalah TindakanPencegahan: sertaadarencanatindaklanjut Monitoringdanevaluasiagarbenar benarevaluasiSMUberjalandengan

BPM-UII-YOGYAKARTA/2011

Halaman 14 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. 5. TemuanDekanatFH Deskripsi PelaksanaanProgramKerja Rutinunityangdidukung olehdokumenterotorisasi Belum dilaksanakan 100% karena program kerja 2010 merupakan kelanjutan program dari pimpinan lama. Program kerja yg baru baru akan dilakukanakhirtahunini Pelaksanaanprogramkerja Pengembanganyangdidukung olehdokumenterotorisasi Belum dilaksanakan 100% karena program kerja 2010 merupakan kelanjutan program dari pimpinan lama. Program kerja yg baru baru akan dilakukanakhirtahunini AnalisisPenyebab Programkerjarutin dilaksanakanbelum100% dikarenakanprogramkerja2010 merupakankelanjutanprogram daripimpinanlamasehingga programbaru,baruakan dievaluasipadaakhir2011 RencanaTindakLanjut baik,disertaibuktinotulasi TindakanPerbaikan: Melaksanakanprogramkerja2011 sertamelaksanakanevaluasidiakhir tahun2011 TindakanPencegahan: Monitoringdanevaluasisecara konyinuterhadapprogramkerja supayaprogramkerjaterlaksana denganbaik TindakanPerbaikan: Melaksanakanprogramkerja pengembangan2011sertamelaksanakan evaluasidiakhirtahun2011 TindakanPencegahan: Monitoringdanevaluasisecara kontinuterhadapprogramkerja pengembangansupayaprogramkerja terlaksanadenganbaik

6.

Programkerjapengembangan belumdilaksanakan100% dikarenakanprogramkerja2010 merupakankelanjutanprogram daripimpinanlamasehingga programyangbaru,baruakandi evaluasipadaakhir2011

7.

8.

75% Pengembangan program studi dan atau pembentukan serta penutupan program program pendidikan di lingkungan fakultas terlaksana99% Tersediaevaluasidantindak lanjutmelaluirapatevaluasi programdalamupaya penerimaanhibahdenganbukti notulenyangbelum diotorisasidan 1.adarencanatindaklanjut

Tabel3.5.DataDeskriptifHasilAMIKinerjaDekanatFIAIPeriode2010 TemuanDekanatFIAI AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SecarasubstansiFIAIsudah TindakanPerbaikan: memilikisasaranmutuyang FIAIsecarakhususperlumerumuskan samapersisdengansasaran kembalisasaranmutuyang mutuuniversitas,tetapi diderivasidarisasaranmutu secaraformaltidak universitasdenganpenyesuaianyang didokumentasikansecara cocokdenganvisi,misi,dan khusus. lingkupwewenangdantugasFIAI 2 Evaluasisasaranmutu Dokumentasiatashasilrapat TindakanPerbaikan: dilakukandalamberbagai Pencatatandalamnotulenperlu mungkinbelumdipahamisebagai rapatdosendansenattetapi dilakukanuntuksetiaprapat halpenting,substansihasil hasilevaluasitersebuttidak rapatdantindaklanjutnya terdokumentasikan TindakanPencegahan: dianggapjauhlebihpenting Dalamsetiaprapat,pimpinanrapat perlumenunjuksalahsatupeserta rapatuntukjadinotulis 3 Sebaiknya setiap pelaksanaan TindakanPerbaikan: Rekapterhadappelaksanaanprogram program kerja segera dicatat, Sebaiknyasetiappelaksanaan kerjatidakdilakukan. agar lebih memudahkan untuk programkerjasegeradicatat,agar mengevaluasi program kerja mana lebihmemudahkanuntukmengevaluasi saja yang sudah terlaksana dan programkerjamanasajayangsudah yangbelumdilaksanakan terlaksanakandanyangbelum dilaksanakan 4 Belumditunjuk/dimaksimalkan TindakanPerbaikan: fungsistafyangbertugasmeng Sosialisasikepadadosen,karyawan, Sosialisasi terhadap hampir semua item uploaddokumenkedalam mahasiswadanpihakluarsebaiknya belum memanfaatkan web site yang memanfaatkanjugamediawebsite, tersediasecaramaksimal. karenalebihmurahdanjangkauannya sangatluas

BPM-UII-YOGYAKARTA/2011

Halaman 15 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.6.DataDeskriptifHasilAMIKinerjaDekanatFKPeriode2010 TemuanDekanatFK AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Belumadakebijakanuntuk TindakanPerbaikan: SasaranMutuFakultas dosenasingdanmahasiswaasing Sasaranmutuyangtingkat Kedokterantercapai72,7% pencapaiannyarendahakan yangmenyebabkanbelum seharusnya100% direncanakanuntukdiprogramkandan tercapainyasasaranmutuFK. ditingkatkan TindakanPencegahan: Akandilakukanevaluasisetiap semesterdandihitungtingkat pencapaiannya. 2 Pelaksanaanprogramkerja pengembangan75%seharusnya 100% 3 Pelaksanaanprogram Belumadatindaklanjutdari TindakanPerbaikan: Pengembanganprogramstudi Akanditanyakankerektorat rektoratuntukpendirianprodi danataupembentukanserta PendidikanKesehatanMasyarakat penutupanprogramprogram TindakanPencegahan: danKedokterangigi. Akandilakukanevaluasisetiap pendidikandilingkungan semesterdandihitungtingkat fakultassudahsampai pencapaiannya. rektorat,belumterlaksana, seharusnya100% 4 ProgramPenilaianprestasi Belumadakebijakankhususdan TindakanPerbaikan: akademik,kecakapandan Akandibuatkebijakankhususdan timkhususyangmenangani kepribadiansivitas timkhususyangmenangani akademika,belumtersedia semuakhususnyatahun2010 TindakanPencegahan: Akandilakukanevaluasisetiap untukkaryawandanmahasiswa semesteruntukmemantaupelaksana tidakberjalan 5 PelaksanaanprogramPenilaian Belumadakebijakandanprogram TindakanPerbaikan: prestasiakademik,kecakapan sertatimkhususyangmenangani Akandibuatkebijakankhususdan dankepribadiansivitas timkhususyangmenangani akademikatahun2010hanya dosenmelaluiNKMD,sementara TindakanPencegahan: Akandilakukanevaluasisetiap untukkaryawandanmahasiswa semesteruntukmemantaupelaksana belumdilakukan 6 Pengadaantenagaedukatif Pelaksanaanprogrampengadaan TindakanPerbaikan: belumterlaksana100%,tahun Akandiprogramkankembali tenagaedukatifsangat 2011barutersedia2dari9 tergantungdariUniversitas yangdirencakan(22%) TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukkenaikanjumlah tenagaedukatif 7 Kebijakanpenyediaandan pengelolaansaranaprasarana belum100%dilaksanakanbaru 75%sepertisaranalistrik (PLN) Tabel3.7.DataDeskriptifHasilAMIKinerjaDekanatFMIPAPeriode2010 TemuanDekanatFMIPA AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1. Belumsemuaitemdalam SMUno.2,lamadalampengerjaanTA TindakanPerbaikan: SasaranMututercapai(baru Untuksasaranmutuno.3,NKMDdosen SMUno.2,dilakukanperubahan tercapai2dari6item) >3,minimal90%belumtercapai kurikulum,pengambilanTAlebih karenasebagiandosenFarmasimasih awalyaitusemester6. NJA SMUno.3,paradosenakan SMUn0.4,rawmaterial(mhs)kurang dibantudalampengurusanCCP, mendalamiMKKU diberiinsentifuntukpenulisan karyailmiah,dandifasilitasi mengikutiseminarbaiknasional maupuninternasional,danstudi lanjut SMUno.4diperlukan mentoring/asistensimatakuliah MKKU

BPM-UII-YOGYAKARTA/2011

Halaman 16 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDekanatFMIPA No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Perludilakukanpembekalansoft skillbagicalonlulusan Perlupenyaringanmahasiswayg lebihbaikuntukmeningkatkan kualitascalonmhs TindakanPerbaikan: PerlumenyediakanSDMkhusus pengelolaanweb

2.

Sosialisasiprogramkerja barudalamrapatternotulen danedaran,belummenggunakan fasilitasweb

3.

Sosialisasiprogramkerja pengembangandalamrapat ternotulendanedaranbelum menggunakanfasilitasweb

4.

Sosialisasiprogramkeuangan fakultasbarudalamrapat ternotulen,belumdilakukan melaluiweb

5.

Sosialisasiprogramkerja bidangSDMbarudalamrapat ternotulendanedaran,belum dilakukanmelaluiweb

6.

Sosialisasikebijakandan perencanaanprogrambidang saranadanprasaranabaru sebatasdalamrapat ternotulendanedaran Sosialisasiprogram kemahasiswaanbarudalam rapatternotulendanedaran, belumdilakukanmelaluiweb

7.

8.

9.

10.

11.

12.

13.

SosialisasiSMUsudahmelalui rapatdanditempel,tetapi belummenggunakanweb Belumsemuaprogram pengembanganterlaksana( terdapat1programbelum terlaksana) KebijakanPengadaandan PengembanganTenagaedukatif danpendukungtenaga edukatifbelumtercapai100% (barutercapai75%) Kebijakanpenyediaandan pengelolaansaranaprasarana belumterlaksana100% Terdapatevaluasidantindak lanjutprogrambidang kemahasiswaanmelaluirapat ternotulen,tetapitidak tercantumakarmasalahnya Sosialisasiprogramkerjasama dginstitusiluartelah dilakukandengan cara:kunjungankeperusahaan danmelaluisurat,tetapi belummenggunakanweb

Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb Sosialisasiprogramkerjadianggap tdkperluuntukdisosialisasikandi websecaraterbuka,kecualiinternal Perangkatwebinternaldari universitasbelumtersedia BelumadaSDMyangmenanganiweb

TindakanPerbaikan: PerluSDMkhususuntukweb

TindakanPerbaikan: SDMkhususuntukweb

TindakanPerbaikan: SDMkhususweb

TindakanPerbaikan: PerluSDMkhususweb

TindakanPerbaikan: PerluSDMkhususweb

BPM-UII-YOGYAKARTA/2011

Halaman 17 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDekanatFMIPA AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 14. Sosialisasiprogramdalam upayapenerimaanhibahtelah dilakukanmelaluirapat ternotulendansuratedaran, tetapibelummenggunakanweb Tabel3.8.DataDeskriptifHasilAMIKinerjaDekanatFPSBPeriode2010 TemuanDekanFPSB AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ketercapaian sasaran mutu berkisar 5075%, belum sesuai dengan Sasaran Mutu Universitas yangtelahditetapkan 2 Ketercapaian pelaksanaan program kerja belum diukur serta belum didukung bukti yang diotirisasisesuaidenganPM.04 3 Hasil pengukuran ketercapaian pelaksanaan program kerja belum mampu digunakan sebagai dasar evaluasi karena tidak merinci keterserapan dana dan progress reportnya sesuaiPM12,PM13 4 Adanya ketidakjelasan distribusi pekerjaan antara prodi dengan devisi yang ada, sehingga tidaksesuaidenganPM13danPM.12 Tabel3.9.DataDeskriptifHasilAMIKinerjaDekanatFTIPeriode2010 TemuanDekanatFTI AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1. SMUFaksamadenganSMUUniversitas Berlakumulaitahun2011 TindakanPerbaikan: yanglama(6item).Sekarangsudah Segeradiotorisasi denganyangbaru(8Item).SMUyang barubelumdiotorisasi 2. Ketercapaiansasaranmutu62%<80%, AkanmenggunakanSMUyangbaru TindakanPerbaikan: masihperluditingkatkan berlakumulaitahun2011 Beberapaprogramkerjadalam Renstradanrenopmengacupada ketercapaianSMU 3. SosialisasiProgramKerjaPengembangan Belumdikoordinasikandengan TindakanPerbaikan: belumadadiweb pimpinandanbagian/adminweb Segeradiupload 4. Sosialisasiinternalprogrambidang Belumdikoordinasikan TindakanPerbaikan: KeuanganFakultasbelumadadiweb Segeradiuploadprogramyang layakdikonsumsiumum 5. Sosialisasiinternalprogrampenerimaan Belumdikoordinasikan TindakanPerbaikan: hibahbelummelaluiweb Segeradiupload 6. Sosialisasiinternalkebijakandan Belumdikoordinasikan TindakanPerbaikan: perencanaanprogrambidangSDM Segeradiupload Fakultasbelumadadiweb 7. Evaluasiprogram/rencanabidang Prosesnotulensitidakdicatat TindakanPerbaikan: Keuangan,kendaladanpeluangyangada dengansempurna Akandiperbaikinotulasiuntuk sertatindaklanjutprogrambelum evaluasiyangakandatang menyertakanpenjelasanakarmasalah 8. Kebijakanpengadaan,evaluasikinerja TindakanPerbaikan: danpengembangantenagaedukatifdan Akansegeradiperbaiki pendukungtenagaedukatiftersedia namunbelumdilengkapidenganmatrik kepangkatandantingkatpendidikan dosen 9. Evaluasiprogramkebijakandan Prosesnotulensibelum TindakanPerbaikan: perencanaanprogrambidangsarana Akandiperbaikinotulasiuntuk tercatatsecarasempurna prasaranabelummemuatkajianakar evaluasiyangakandatang masalah

BPM-UII-YOGYAKARTA/2011

Halaman 18 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.10.DataDeskriptifHasilAMIKinerjaDekanatFTSPPeriode2010 TemuanDekanatFTSP AnalisisPenyebab No. Deskripsi 1 Pengukuran parameter Sasaran Mutu Unit (SMU) baru tercapai 75 %sehingga95%(belum100%) RencanaTindakLanjut

B.HASILEVALUASIKINERJA:UNITDIVISIFAKULTAS
1.IndeksKinerjaUnitDivisiFakultasIndikatorKinerja Indeks kinerja periode 2010 untuk unit Divisi Fakultas di lingkungan UII sebesar3.67dansecaraumummengalamipeningkatansebesar0.45poindibandingkan kinerja periode sebelumnya (3.22). Tetapi jika dilihat hasil capaian kinerja divisi per fakultas, maka ada 2 unit yang kinerjanya mengalami penurunan, yaitu Divisi FH dan FK, sementara 6 unit lainnya yaitu FE, FIAI, FMIPA, FPISB, FTI dan FTSPmengalamipeningkatanindekskinerjayangcukupsignifikan. Indeks kinerja unit divisi fakultas tertinggi dicapai oleh Divisi FPISB (3.90) dan terendah dicapai oleh divisi FK (3.01). Hasil capaian indeks kinerja secara lengkap untuk masingmasing unit divisi sekaligus perbandingannya dengan kinerjaperiodesebelumnyadapatdilihatdaritabel3.11.Sementarahasilcapaian kinerjasetiapunitdivisiperindikatorkinerjabisadilihatpadatable3.12.
Tabel3.11.PerbandinganHasilEvaluasiKinerjaDivisiFakultas Periode20092010 Periode No Unit 2009 2010 1 FakultasHukum 3.92 3.86 2 FakultasTeknikSipildanPerencanaan 3.72 3.88 3 FakultasTeknologiIndustri 3.45 3.49 4 FakultasEkonomi 3.33 3.85 5 FakultasKedokteran 3.07 3.01 6 FakultasIlmuAgamaIslam 2.85 3.65 7 FakultasMatematikadanIlmuPengatahuanAlam 2.70 3.73 8 FakultasPsikologidanIlmuSosialBudaya 2.68 3.90 IndeksKinerja 3.22 3.67 Tabel3.12.RangkumanIndeksKinerjaPeriode2010perindikatorkinerja IndeksKinerjaDivisidi No IndikatorKinerja FE FIAI FKU FMIPA FTSP FTI 1 PencapaianSasaranMutuUnit(SMU) 3.90 3.39 2.72 3.50 3.93 3.19 2 Pencapaianprogramkerjarutin 3.77 3.53 3.27 3.73 3.92 3.20 3 Pencapaianprogramkerjapengembangan 3.71 3.33 2.50 3.67 3.60 2.93 KemampuanKepemimpinanoperasionaldalam 4 halproseskoordinasiinternalunitdan 3.86 4.00 2.67 3.33 4.00 3.67 tindaklanjutRTM 5 PenerapanProsedurKerja(PK) 3.76 3.78 3.67 3.78 3.93 3.43 6 Pemahaman,realisasidanevaluasiDCM 3.82 4.00 3.39 4.00 3.95 3.86 7 EvaluasiKedisiplinanKerja 4.00 3.17 3.00 3.83 3.70 3.79 PengendaliandanevaluasiKeluhan 8 4.00 4.00 2.83 4.00 4.00 3.86 Pelanggan IndeksKinerja 3.85 3.65 3.01 3.73 3.88 3.49

FPSB 3.83 3.80 3.58 4.00 4.00 4.00 4.00 4.00 3.90

FH 3.87 3.60 3.88 3.93 3.67 4.00 4.00 4.00 3.86

1.1.DivisiFakultasEkonomi Hasil kinerja unit divisi FE secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.13, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.153.21

BPM-UII-YOGYAKARTA/2011

Halaman 19 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.13.HasilCapaianKinerjaPeriode2010UnitDivisiFakultasEkonomi IndeksKinerjaDivisi No 1 2 3 IndikatorKinerja PencapaianSasaranMutuUnit Pencapaianprogramkerjarutin Pencapaianprogramkerja pengembangan KemampuanKepemimpinan operasionaldalamhalproses koordinasiinternalunitdan tindaklanjutRTM PenerapanProsedurKerja(PK) Pemahaman,realisasidan evaluasiDaftarCatatanMutu EvaluasiKedisiplinanKerja Pengendaliandanevaluasi KeluhanPelanggan Adm. Akademik 3.83 3.80 3.75 Adm. Keuangan 3.83 3.60 3.50 RT& Perbekalan 4.00 4.00 3.75 SIM 3.83 3.80 3.75 Perpus 4.00 3.80 3.75 Umum 4.00 3.80 3.75 Keagamaan& Kemahasiswaan 3.83 3.60 3.75

4.00

3.67

4.00

4.00

3.67

3.67

4.00

5 6 7 8

3.67 3.50 4.00 4.00 3.82

4.00 4.00 4.00 4.00 3.97

4.00 4.00 4.00 4.00 3.82

3.67 3.50 4.00 4.00 3.83

3.67 3.75 4.00 4.00 3.90

4.00 4.00 4.00 4.00 3.81

3.33 4.00 4.00 4.00 3.81

IndeksKinerja

Tabel.3.14.RangkumanPelaksanaanAuditDiDivisiFE

Divisi
AdministrasiAkademik Adm.Keuangan RT&Perbekalan SIM Perpus Umum Keagamaan&Kemahasiswaan

TanggalAudit Auditee
8April2011 8April2011 8April2011 8April2011 8April2011 8April2011 8April2011 SriUtoyo Siswantoro IdaListiani M.Wafa Alfiah Mujiyana,SE RudiPurnomo,SE

Auditor
H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec H.NurKholis,S.Ag,M.Sh.Ec

Tabel3.15.TemuanDeskriptifDivisiAdministrasiAkademikFakultasEkonomi TemuanAdministrasiAkademik No. Deskripsi 1 EvaluasidantindaklanjutSMUsertakendaladan peluangyangadabelumdisertaipenjelasanakar masalah 2 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogrambelum disertaipenjelasanakarmasalah. 3 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah 4 EvaluasiPKdantindaklanjutnyabaikdalambentuk usulanperubahandanataupenambahanPKbarubelum dilakukanmelaluirapatyangterdokumentasidalam bentuknotulenrapat 5 DaftarCatatanMutu(DCM)yangyangberlakusesuai denganPMyangberlakunamunbelumdiotorisasioleh BPM 6 EvaluasiDCMbelumdilakukanmelaluirapatyang terdokumentasidalambentuknotulenrapat AnalisisPenyebab RencanaTindakLanjut

Tabel3.16.TemuanDeskriptifDivisiAdm.KeuanganFakultasEkonomi TemuanDivisiAdm.Keuangan No. Deskripsi 1 EvaluasidantindaklanjutSMUsertakendaladan peluangyangadabelumdisertaipenjelasanakar masalah AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 20 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiAdm.Keuangan No. Deskripsi 2 Pelaksanaanprogramkerjarutindanpengembangan belumdidukungolehdokumenyangterotorisasi 3 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogrambelum disertaipenjelasanakarmasalah. 4 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah. 5 EvaluasipelaksanaandantindaklanjutRTMsudah sesuaidenganaturanyangditetapkantetapibelum adapenetapantindaklanjut. AnalisisPenyebab RencanaTindakLanjut

Tabel3.17.TemuanDeskriptifDivisiRT&PerbekalanFakultasEkonomi TemuanDivisiRT&Perbekalan No. Deskripsi 1 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah AnalisisPenyebab RencanaTindakLanjut

Tabel3.18.TemuanDeskriptifDivisiSIMFakultasEkonomi TemuanDivisiSIM No. Deskripsi 1 EvaluasidantindaklanjutSMUsertakendaladan peluangyangadabelumdisertaipenjelasanakar masalah 2 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah. 3 EvaluasiPKdantindaklanjutnyabaikdalambentuk usulanperubahandanataupenambahanPKbarubelum dilakukanmelaluirapatyangterdokumentasidalam bentuknotulenrapat. 4 EvaluasiDCMbelumdilakukanmelaluirapatyang terdokumentasidalambentuknotulenrapat AnalisisPenyebab RencanaTindakLanjut

Tabel3.19.TemuanDeskriptifDivisiPerpustakaanFakultasEkonomi TemuanDivisiPerpustakaan No. Deskripsi 1 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogrambelum disertaipenjelasanakarmasalah. 2 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah 3 EvaluasipelaksanaandantindaklanjutRTMsudah sesuaidenganaturanyangditetapkantetapibelum adapenetapantindaklanjut. 4 EvaluasiPKdantindaklanjutnyabaikdalambentuk usulanperubahandanataupenambahanPKbarubelum dilakukanmelaluirapatyangterdokumentasidalam bentuknotulenrapat. 5 evaluasiDCMbelumdilakukanmelaluirapatyang terdokumentasidalambentuknotulenrapat AnalisisPenyebab RencanaTindakLanjut

Tabel3.20.TemuanDeskriptifDivisiUmumFakultasEkonomi TemuanDivisiUmum No. Deskripsi 1 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogrambelum disertaipenjelasanakarmasalah 2 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 21 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. 3 TemuanDivisiUmum Deskripsi belumdisertaipenjelasanakarmasalah EvaluasipelaksanaandantindaklanjutRTMsudah sesuaidenganaturanyangditetapkantetapibelum adapenetapantindaklanjut. AnalisisPenyebab RencanaTindakLanjut

Tabel3.21.TemuanDeskriptifDivisiKeagamaan&KemahasiswaanFakultasEkonomi TemuanDivisiKeagamaan&Kemahasiswaan No. Deskripsi 1 EvaluasidantindaklanjutSMUsertakendaladan peluangyangadabelumdisertaipenjelasanakar masalah 2 Programkerjarutinbelummencakupseluruhtugasdan wewenangyangberlaku,terutamadalampengelolaan databasekemahasiswaandanalumni 3 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogrambelum disertaipenjelasanakarmasalah 4 EvaluasiProgramKerjaPengembanganunit,kendala danpeluangyangadasertatindaklanjutprogram belumdisertaipenjelasanakarmasalah. 5 PKtentangpengelolaandatabasekemahasiswaandan alumnibelumada. 6 EvaluasiPKdantindaklanjutnyabaikdalambentuk usulanperubahandanataupenambahanPKbarubelum dilakukanmelaluirapatyangterdokumentasidalam bentuknotulenrapat AnalisisPenyebab RencanaTindakLanjut

1.2.DivisiFakultasHukum Hasil kinerja unit divisi FH secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.22, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.243.28
Tabel3.22.HasilCapaianKinerjaPeriode2010UnitDivisiFakultasHukum IndeksKinerjaDivisi No 1 2 3 IndikatorKinerja
Adm. Akademik Adm. Keuangan Umum &RT SIM Perpus

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasionaldalamhal 4 proseskoordinasiinternalunitdantindaklanjut RTM 5 PenerapanProsedurKerja(PK) 6 Pemahaman,realisasidanevaluasiDCM EvaluasiKedisiplinanKerja 7 PengendaliandanevaluasiKeluhanPelanggan 8 IndeksKinerja

3.67 2.60 3.67 2.67 4.00 4.00 4.00 3.51

4.00 3.8 4.00 4.00 4.00 4.00 4.00 4.00 3.98

4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00

3.67 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.96

4.00 3.60 3.50 4.00 3.67 4.00 4.00 4.00 3.85

Table3.23.RangkumanPelaksanaanAuditDiDivisiFH

Divisi
AdministrasiAkademik AdministrasiKeuangan UmumdanRT SIM Perpustakaan

TanggalAudit
6April2011 5April2011 05April2011 56April2011 6April2011

Auditee
YuliWasitoHadi Sunaryo,Amd Sukamto,SE Purwanto,A.Md BambangHermawan,A.Md

Auditor
Dra.PraptiA,M.Si.,Ak Dra.ReniYendrawati,M.Si.,Ak Dra.ReniYendrawati,M.Si Dra.PraptiA,M.Si.,Ak Dra.ReniYendrawati,M.Si

BPM-UII-YOGYAKARTA/2011

Halaman 22 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.24.TemuanDeskriptifDivisiAdministrasiAkademikFakultasHukum TemuanAdministrasiAkademik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 5.Pencapaiansasaranmutudidukungolehdokumen yangsudahdiotorisasi Totalygdiukur26,yangsesuai16.Pencapaian 16/26=62% 2 9.SosialisasiProgramKerjayangefektif Dilakukandengancarahanyadidistribusikanke anggotaunit,tidakdengancaramelaluirapat khususmaupunlewatweb 3 11.EvaluasiProgramKerjaRutinunit,kendala danpeluangyangadasertatindaklanjutprogram. Tidakdilakukanklasifikasikarena: Devisibelumbisamelakukanevaluasi,karena evaluasidilakukansecarabersamamelaluiprogram kerjatahunan 4 12s/d15tidakdilakukanklasifikasikarena devisitidakmenyusunprogramkerjapengembangan 5 16.KetersediaanrapatkoordinasiRTMunit(sifat koordinasirutinatautidak,adakelengkapanrapat antaradengannotulasidandaftarhadir) Tidakadakelengkapanrapat 6 21.EvaluasiPKmelaluirapatdantindaklanjut evaluasiPKunitdan(bilaperlu)usulanperubahan danataupenambahanPKbaru. Belumdilakukanevaluasi Tabel3.25.TemuanDeskriptifDivisiAdministrasiKeuanganFakultasHukum TemuanDivisiAdministrasiKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Sosialisasiprogramkerjamelaluirapatdanlewat web.Tidakditempel,karenakalauditempelterlalu banyak,sedangkanruangankeuangansempit Tabel3.26.TemuanDeskriptifDivisiUmumdanRTFakultasHukum TemuanDivisiUmumdanRT AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Tidakadatemuan Tabel3.27.TemuanDeskriptifDivisiSIMFakultasHukum TemuanDivisiSIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Borang5 Pencapaiansasarandidukungdokumenyangsudah diotorisasi70% Tabel3.28.TemuanDeskriptifDivisiPerpustakaanFakultasHukum TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 ProgramKerjapengembanganbarutercapai50% Misal:Peminjamanbuku2eksmenjadi5eks AlatpengamananperpustakaanberupasisiTVatau lainnyasupayabiasopenacces PengadaanalmariuntukmenyimpanCDTA Pengadaanmesinfotocopy

1.3.DivisiFakultasIlmuAgamaIslam Hasil kinerja unit divisi FIAI secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.29, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.313.33

BPM-UII-YOGYAKARTA/2011

Halaman 23 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.29.HasilCapaianAMIKinerjaUnitPeriode2010UnitDivisiFakultasIlmuAgamaIslam IndeksKinerjaDivisi No 1 2 3 4 5 6 7 8 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasionaldalamhalproses koordinasiinternalunitdantindaklanjutRTM PenerapanProsedurKerja(PK) Pemahaman,realisasidanevaluasiDaftarCatatanMutu (DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan IndeksKinerja Akademik &SIM 3.50 3.60 2.75 4.00 4.00 4.00 3.00 4.00 3.61 Umum& Keuangan 3.33 3.40 3.50 4.00 3.67 4.00 4.00 4.00 3.74 Perpustakaan 3.33 3.60 3.75 4.00 3.67 4.00 2.50 4.00 3.61

Tabel3.30.RangkumanPelaksanaanAuditDiDivisiFIAI

Divisi
Akademik&SIM UmumdanKeuangan Perpustakaan

TanggalAudit Auditee
11April2011 11April2011 M.Djiwanggo TitikSetiati Darudi

Auditor
Dra.SitiNursyamsiah,MM Dra.SitiNursyamsiah,MM Dra.SitiNursyamsiah,MM

Tabel3.31.TemuanDeskriptifDivisiAkademik&SIMFakultasIlmuAgamaIslam TemuanDivisiAkademik&SIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 BelumadametodepengukuranSasaranMutuUnit 2 Pelaksanaanprogramkerjapengembanganbarutercapai 25%danbelumadaevaluasisertarencanatindak lanjut. Tabel3.32.TemuanDeskriptifDivisiUmumdanKeuanganFakultasIlmuAgamaIslam TemuanDivisiUmumdanKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Belumadametodepengukuransasaranmutuunit 2 SosialisasiSasaranMutuUnitdanProgramkerja belummelaluimediaWeb Tabel3.33.TemuanDeskriptifDivisiPerpustakaanFakultasIlmuAgamaIslam TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 3 Belumadametodepengukuransasaranmutuunit 4 Sosialisaiprogramkerjadansasaranmutuunitbelum melaluimediaweb 5 Belumadatindaklanjuthasilevaluasistaff perpustakaan.

1.4.DivisiFakultasKedokteran

Hasil kinerja unit divisi FK secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.34, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.363.38
Tabel3.34.HasilCapaianKinerjaUnitPeriode2010UnitDivisiFakultasKedokteran IndeksKinerjaDivisi No 1 2 3 4 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasionaldalamhal proseskoordinasiinternalunitdantindaklanjut RTM Akademik &SIM 3.17 3.40 0.75 2.00 Umum& Keuangan 3.50 3.40 3.00 4.00 Perpustakaan 1.50 3.00 3.75 2.00

BPM-UII-YOGYAKARTA/2011

Halaman 24 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

IndeksKinerjaDivisi No 5 IndikatorKinerja Akademik &SIM 4.00 3.50 3.50 3.50 2.98 Umum& Keuangan 4.00 4.00 4.00 2.50 3.55 Perpustakaan 3.00 2.67 1.50 2.50 2.49

PenerapanProsedurKerja(PK) Pemahaman,realisasidanevaluasiDaftarCatatan 6 Mutu(DCM) EvaluasiKedisiplinanKerja 7 8 PengendaliandanevaluasiKeluhanPelanggan IndeksKinerja

Divisi

Tabel3.35.RangkumanPelaksanaanAuditDiDivisiFK

TanggalAudit

Auditee

Auditor

AdministrasiAkademikdanSIM 07April2011 AdiebAHNasution MiraAlizaR.,S.Psi.,M.Psi AdministrasiUmumdanKeuangan 08April2011 Saryudi MiraAlizaR.,S.Psi.,M.Psi Perpustakaan 07April2011 Mawardi MiraAlizaR.,S.Psi.,M.Psi Tabel3.36.TemuanDeskriptifDivisiAdministrasiAkademikdanSIMFakultasKedokteran TemuanAdministrasiAkademikdanSIM No. Deskripsi 1 SasaranMutuno5yaituyudisiumblok<=2minggu setelahujianminimal90%tidaktercapai 2 SosialisasiSMUtidakmelaluirapatdanwebhanya ditempel 3 Sasaranmutuhanyatercapaikuranglebih95% 4 5 6 7 Sosialisasiprogramkerjarutintidakmelaluirapat danwebhanyaditempel Belumtersediaprogramkerjapengembanganhanya ditawarkankestaftidaksecaratertulis Sosialisasiprogramkerjapengembanganhanyamelalui rapat Tersediaevaluasidantindaklanjutprogram pengembanganmelaluirapatevaluasiProgramKerja pengembangandenganbuktinotulen Rapatkoordinasiinternaltidakrutindantidak disertaidengankelengkapanrapat Belumpernahdilakukanevaluasisertatindaklanjut hasilRTM DCMtidaksesuaidenganPMyangberlaku Evaluasikedisiplinankerjahanyaberdasarevaluasi presensidariDOSDMdandaftartugasharianstaf diotorisasi Dokumenpengendaliankeluhanpelanggantidaksesuai PMnamunditerapkanmengikutiaturan Evaluasidantindaklanjutterhadapkeluhanada tindakanevaluasi,adapenetapantindaklanjut terhadapkeluhannamuntidaksesuaidenganPM AnalisisPenyebab RencanaTindakLanjut

8 9 10 11

12 13

Tabel3.37.TemuanDeskriptifDivisiUmumdanKeuanganFakultasKedokteran TemuanDivisiUmumdanKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUhanyadibagikandanditempeldimeja kerjastaff,tidakadahasilnotulensisosialisasi SMU 2 Sosialisasiprogramkerjarutinhanyadibagikandan ditempeldimejakerjastaffdantidakada notulensinya 3 Sosialisasiprogramkerjapengembanganhanya dibagikandanditempeldimejakerjastaffdantidak adanotulensinya 4 Rekapanregistrasiketidaksesuainnamunbelum dituangkandalamformpengendaliankeluhan. 5 Sudahadaevaluasidantindaklanjutsertapenetapan tindaklanjutterhadapkeluhannamunbelumdituangkan dalamformpengendalikeluhan

BPM-UII-YOGYAKARTA/2011

Halaman 25 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.38.TemuanDeskriptifDivisiPerpustakaanFakultasKedokteran TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 TersediaSMUyangberlakusudahdiotorisasinamun tidakdisertaidenganmetodepengukurannya 2 BelumdilakukanpengukuranterhadapSMU 3 SosialisasiSMUhanyaditempeldanmelaluirapat disertaidenganbuktinotulensiyangdiotorisasi besertadaftarhadirnya TidakadabuktipendukungmengenaiSMUkarenabelum dilakukanpengukuran TidakadaevaluasiSMU Sosialisasiprogramkerjarutinhanyaditempeldan melaluirapatdisertaidenganhasilnotulensiyang sudahdiotorisasidandaftarhadirnya Programkerjarutinbaruterlaksana95% Adabuktinotulenevaluasiprogramkerjarutinnamun belumadarencanatindaklanjutdanpenjelasanakar masalah Sosialisasiprogramkerjapengembanganhanyaditempel danmelaluirapatdisertaidenganhasilnotulensi yangsudahdiotorisasidandaftarhadirnya Koordinasiinternalmelaluirapattidakrutindan tersedianotulenyangsudahdiotorisasisertadaftar hadirnya BelumpernahdilakukanRTMunitsehinggabelumada evaluasipelaksanaandantindaklanjutnya TersediadokumenPKyangberlakunamunbelumada otorisasinya,tidakadatanggalrevisi,tanggal berlakudankodedokumennyaBelumsemuaDCMditempel ditempatpenyimpanandokumen. BelumsemuadokumenPKtersedia,yangtidakadayaitu dokumenPKmengenaipengusulankenaikanpangkatdan jabatanpustawakan BelumsemuaDCMditempelditempatpenyimpanan dokumen PengelolaandokumenyangsesuaidenganDCMhanya55% Tersediaevaluasikedisiplinankerjaberdasar evaluasipresensiDOSDMdandaftartugasharianstaf namunbelumtersediadaftarevaluasikinerjastaf Belumadatindaklanjuthasilevaluasikinerjastaff Adaformcatatansarannamuntidaksesuaidenganfom pengendaliankeluhan Evaluasidantindaklanjutterhadapkeluhansudahada namunformtidaksesuaidenganfompengendalian keluhan.

4 5 6

7 8

10

11 12

13

14 15 16

17 18 19

1.4.DivisiFakultasMatematikadanIlmuPengetahuanAlam Hasil kinerja unit divisi FMIPA secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.39, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.413.43
Tabel3.39.HasilCapaianKinerjaPeriode2010UnitDivisiFakultasMatematikadanIlmuPengetahuan Alam IndeksKinerjaDivisi No IndikatorKinerja Akademik&SIM Umum&Keuangan Perpustakaan PencapaianSasaranMutuUnit(SMU) 1 3.67 3.00 3.83 2 Pencapaianprogramkerjarutin 3.60 3.60 4.00 Pencapaianprogramkerjapengembangan 3 3.50 3.50 4.00 KemampuanKepemimpinanoperasionaldalamhalproses 4 2.67 3.33 4.00 koordinasiinternalunitdantindaklanjutRTM

BPM-UII-YOGYAKARTA/2011

Halaman 26 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No 5 6 IndikatorKinerja PenerapanProsedurKerja(PK) Pemahaman,realisasidanevaluasiDaftarCatatanMutu (DCM) EvaluasiKedisiplinanKerja 7 PengendaliandanevaluasiKeluhanPelanggan 8 IndeksKinerja IndeksKinerjaDivisi Akademik&SIM Umum&Keuangan Perpustakaan 3.67 3.67 4.00 4.00 3.50 4.00 3.58 4.00 4.00 4.00 3.64 4.00 4.00 4.00 3.98

Divisi
AkademikdanSIM UmumdanKeuangan Perpustakaan

Tabel3.40.RangkumanPelaksanaanAuditDiDivisiFMIPA

TanggalAudit Auditee
13April2011 12April2011 13April2011 AnangSusilo,A.Md. SlametHaryanto Ngatini,A.Md.

Auditor
Drs.NanangNuryanta,M.Pd Drs.NanangNuryanta,M.Pd Drs.NanangNuryanta,M.Pd

Tabel3.41.TemuanDeskriptifUnitDivisiAkademikdanSIMFakultasMIPA TemuanAkademikdanSIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SMUyangbelumtercapaiataubelumsesuai(68,73%) 2 Metodesosialisasimelaluiwebbelumdilaksanakan 3 4 Tabel3.42.TemuanDeskriptifUnitDivisiUmumdanKeuanganFakultasMIPA TemuanDivisiUmumdanKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 MetodesosialisasiSMUbelummenggunakanwebsite 2 EvaluasidantindaklanjutkendalaSMUbidang keuanganbelumsemuanyadilakukan 3 SosialisasiProgramkerjabelumdilakukanmelalui website 4 Sosialisasiprogrampengembanganbelumdilakukan melaluiwebsite 5 EvaluasidantindaklanjutRTMbelumsesuai Tabel3.41.TemuanDeskriptifUnitDivisiPerpustakaanFakultasMIPA TemuanDivisiPerpustakaan AnalisisPenyebab No. Deskripsi 1 Pencapaiansasarandidukungdokumenyang terotorisasibelumlengkap SosialisasiProgramKerjabelummenggunakanwebsite KoordinasidanevaluasiRTMunitbelumdilakusanakan secaraperiodik

RencanaTindakLanjut

1.6.DivisiFakultasPsikologidanIlmuSosialBudaya Hasil kinerja unit divisi FE secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.42, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.443.46
Tabel3.42.HasilCapaianKinerjaPeriode2010:UnitDivisiFPISB IndeksKinerjaDivisi IndikatorKinerja Akademik&SIM Umum&Keuangan PencapaianSasaranMutuUnit(SMU) 3.83 3.83 Pencapaianprogramkerjarutin 3.80 3.80 Pencapaianprogramkerjapengembangan 3.50 3.75 KemampuanKepemimpinanoperasionaldalamhal proseskoordinasiinternalunitdantindaklanjut 4.00 4.00 RTM PenerapanProsedurKerja(PK) 4.00 4.00

No 1 2 3 4 5

Perpus 3.83 3.80 3.50 4.00 4.00

BPM-UII-YOGYAKARTA/2011

Halaman 27 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Pemahaman,realisasidanevaluasiDaftarCatatan Mutu(DCM) EvaluasiKedisiplinanKerja 7 PengendaliandanevaluasiKeluhanPelanggan 8 IndeksKinerja 6 Tabel3.43.RangkumanPelaksanaanAuditDiDivisiFPISB 4.00 4.00 4.00 3.89 4.00 4.00 4.00 3.92 4.00 4.00 4.00 3.89

Divisi

TanggalAudit

Auditee

Auditor

AdministrasiAkademikdanSIM 12April2011 ArisWidada Dra.Kartini,M.Si AdministrasiUmumdanKeuangan 12April2011 SitiKasimah Dra.ReniYendrawati,M.Si Perpustakaan 12April2011 Sungadi,S.Sos Dra.Kartini,M.Si Tabel3.44.TemuanDeskriptifDivisiAdministrasiAkademikdanSIMFPISB TemuanAdministrasiAkademikdanSIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Pencapaiansasaranmutuunit(SMU)barumencapai 75%ketercapaiansasaran99,9% Tabel3.45.TemuanDeskriptifDivisiAdm.UmumdanKeuanganFPISB TemuanDivisiAdm.UmumdanKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Pencapaiansasaranmutuunit(SMU)barumencapai 75%ketercapaian99,9% 2 PelaksanaanProgramKerjaRutinyangdidukung olehdokumenterotorisasibarumencapai75% pelaksanaanprogramkerjarutin99% 3 PelaksanaanProgramKerjaPengembanganyang didukungolehdokumenterotorisasibarumencapai 75%pelaksanaanprogramkerjapengembangan99% Tabel3.46.TemuanDeskriptifDivisiPerpustakaanFPISB TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Pencapaiansasaranmutuunit(SMU)baru mencapai75%ketercapaian99,9%= 77,39% 2 PelaksanaanProgramKerjaRutinyang didukungolehdokumenterotorisasibaru mencapai75%pelaksanaanprogram kerjarutin99%=90% PelaksanaanProgramKerjaPengembangan yangdidukungolehdokumenterotorisasi barumencapai50%pelaksanaanprogram kerjapengembangan74%=64%(7dari 11programkerjapengembangan).Empat programkerjapengembanganyangbelum terlaksanaantaralain: a. PengembanganStrukturOrganisasi Perpustakaan,yaituterbentuknya urusanbaru:urusansiskulasi,dan urusanpengolahan,dengandilengkapi pejabat(KaurSirkulasidanKaur Pengolahan). b. PengadaanMesinFotokopi. c. Mengirimkanpegawaiperpustakaan untukmengikutipelatihanpelatihan. d. PengadaanElectronicScuritySystem.

DekanFPSBsudah mengirimkansuratkepada RektorUIItentang usulanperlunya pengembanganstruktur oragnisasiperpustakaan, akantetapisampaisaat inibelumadatanggapan daripihakRektorat. Tidaktersedianya ruanganuntuktempat layananfotokopi. Pegawaiperpustakaan FPSBUIIsaatini sebagianbesarmerupakan tenagaparuhwaktu, sehinggadirasakurang efektifuntuk mengirimkanmerekauntuk mengikutipelatihan. Pengadaansecurity system,belumterlaksana terkaitmasalahtidak adanyadanayangcukup.

TindakanPerbaikan: Mengusulkankepadapihakpihak terkaitmelaluiPimpinan FakultaspadasaatRapim Fakultas,agardapat terselenggaranyaprogram tersebut. TindakanPencegahan a. Mengirimkansuratsusulan kepadaRektorUII b. Mencariruanganuntuk tempatfotokopi c. Menambahpegawaidengan kualifikasipustakawan d. Mengalokasianggarankhusus untukpengadaanalat tersebut

BPM-UII-YOGYAKARTA/2011

Halaman 28 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

1.7.DivisiFakultasTeknologiIndustri Hasil kinerja unit divisi FTI secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.47, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.493.55
Tabel3.47.HasilCapaianKinerjaPeriode2010UnitDivisiFakultasTeknologiIndustri IndeksKinerjaDivisi No 1 2 3 4 5 6 7 8 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasionaldalamhal proseskoordinasiinternalunitdantindak lanjutRTM PenerapanProsedurKerja(PK) Pemahaman,realisasidanevaluasiDaftar CatatanMutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan
Adm. Akademik Adm. Keuangan R.T& Perbekalan SIM Perpus Adm. Umum Kuliah &Ujian

3.00 2.80 1.75 2.67 4.00 4.00 4.00 4.00 3.28

1.67 3.00 2.25 3.67 2.67 4.00 2.50 4.00 2.97

3.50 3.40 3.75 3.67 3.67 4.00 4.00 4.00 3.75

3.67 3.40 3.50 4.00 3.67 4.00 4.00 4.00 3.78

3.50 3.20 3.50 3.67 3.67 4.00 4.00 4.00 3.69

3.83 3.60 3.50 4.00 3.00 4.00 4.00 4.00 3.74

3.17 3.00 2.25 4.00 3.33 3.00 4.00 3.00 3.22

IndeksKinerja

Divisi
AdministrasiAkademik AdministrasiKeuangan RT&Perbekalan SIM Perpustakaan AdministrasiUmum KuliahdanUjian

Tabel3.48.RangkumanPelaksanaanAuditDiDivisiFTI

TanggalAudit Auditee
07April2011 07April2011 07April2011 07April2011 An.PLT.Mujiono ErawatiLestari,A.Md Kasiyono,S.Kom NoorHilalFathoni,S.Ag Ismanto Suwati,S.Sos Mujiono

Auditor
Dra.SriHaningsih,M.A Dra.SriHaningsih,M.Ag Dra.SriHaningsih,M.Ag Dra.SriHaningsih,M.Ag Dra.SriHaningsih,M.Ag Dra.SriHaningsih,M.Ag Dra.SriHaningsih,M.Ag

Tabel3.49.TemuanDeskriptifDivisiAdministrasiAkademikFakultasTeknologiIndustri TemuanAdministrasiAkademik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ditemukansasaranmutuyang Belumdilakukanpengukuran TindakanPerbaikan: tidakdisertaimetodepengukuran Akandilakukanpengukuran 2 DitemukankesesuaianSMUdengan Belummaksimalmelakukan TindakanPerbaikan: lingkupkerjapadakriteria programkerjasesuaidenganSMU Akanmeningkatkankinerjalebih penerimaan75%kesesuaianSMU baikdanoptimalyangsesuai denganlingkupkerja99% denganSMU 3 Ditemukandokumenpengukuran Pengukuranketercapaian TindakanPerbaikan: parameterSMU75%arameteryang parameterSMU75%parameter Akanmweningkatkankinerjalebih diukur99% yangdiukur99% baikdaniptimal 4 DitemukandokumenSMUdengan Tidakdilakukansosialisasi TindakanPerbaikan: buktinotulenrapatyang Akandilakukansosialisasilewat lewatweb diotorisasitetapitidak web ditempel/lewatweb 5 DitemukanPencapaiansasaran Belummelakukanprogramkerja TindakanPerbaikan: didukungolehdokumenyangsudah yangbersesuaiandenganSM Akandilakukanprogramkerja diotorisasisebesar75% yangsesuaidengansasaranmutu secaramaksimal ketercapaiansasaran99,9% secaramaksimal 6 Ditemukandokumenevaluasidan Bellumdilakukandiotorisasi TindakanPerbaikan: tindaklanjutmelaluirapat padanotulendanadarencana Akandilakukanotorisasipada evaluasiSMUdenganbukti tindaklanjut setiapnotulen notulenyangbelumdiotorisasi danadarencanatindaklanjut 7 ditemukanProgramkerjaRutin Belummelakukanprogramkerja TindakanPerbaikan: yangberlakudiotorisasi rutinyangberlakudan Akandilakukanprogramkerja .75%mendukungSMU99% diotorisasi75%mendukungSMU rutinyangberlakudiotorisasi 99% 75%mendukungSMU99% 8 DitemukandokumenWTyang BelumdilakukanmaksimalWT TindakanPerbaikan: berlaku yangberlakudandokumen Akandilakukansecaramaksimal

BPM-UII-YOGYAKARTA/2011

Halaman 29 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanAdministrasiAkademik No. Deskripsi dandokumenProgramkerjarutin 75%mencakuptugasdan wewenangyangberlaku99% 9 DitemukanSosialisasiProgram Kerjaditempel(tidaklewatweb) 10 DitemukanPelaksanaanProgram KerjaRutinunityangdidukung olehdokumenterotorisasi75% Pelaksanaanprogramkerjarutin 99% Ditemukanevaluasidantindak lanjutmelaluirapatevaluasi ProgramKerjaRutindenganbukti notulenyangdiotorisasidanada rencanatindaklanjut AnalisisPenyebab Programkerjarutin75% mencakuptugasdanwewenang yangberlaku99% Belumdilakukansosialisasi ProgramKerjalewatweb Belumdilakukanmaksimal terhadappelaksanaanProgram KerjaRutinunityangdidukung olehdokumenterotorisasi Belumdilakukanevaluasidan tindaklanjutmelaluirapat evaluasiProgramKerjaRutin denganbuktinotulenyang diotorisasidanadarencana tindaklanjuttetapitidak menmyebutkanakarmasalahnya Belumtersediaprogramkerja pengembanganyangberlakudan diotorisasi Tidakdilakukansosialisasi programkerjalewatweb Belumadapelaksanaanprogram kerjapengembanganyang didukungolehdokumen terotorisasi Belumdilakukanpenyusunan Evaluasiprogramkerja pengembangan,kendaladan peluangyangadasertatindak lanjutprogramRapatKoordinasi Internal(RTM) TindakanPerbaikan: Akandilakukansosialisasi ProgramKerjalewatweb TindakanPerbaikan: Akandilakukandenganmaksimal pelaksanaanProgramKerjaRutin unityangdidukungolehdokumen terotorisasi TindakanPerbaikan: Akandilakukanevaluasidan tindaklanjutmelaluirapat ProgramKerjaRutindenganbukti notulenyangdiotorisasidanada rencanatindaklanjuttetapi tidakmenyebutkanakar masalahanya TindakanPerbaikan: Akandilakukanpenyusunan ProgramKerjaPengembanganyang beerlakudandiotorisasi TindakanPerbaikan: AkandilakukanSosialisasi ProgramKerjalewatweb TindakanPerbaikan: Akandilaksanakanpelaksanaan programkerjapengembanganyang didukungolehdokumen terotorisasi TindakanPerbaikan: Akandilakukanpenyusunan Evaluasiprogramkerja pengembangan,kendaladan peluangyangadasertatindak lanjutprogramRapatKoordinasi Internal(RTM) RencanaTindakLanjut

11

12

DitemukanbelumtersediaProgram kerjaPengembanganyangberlaku diotorisasi DitemukanSosialisasiProgram Kerjaditempel DitemukanbelumadaPelaksanaan programkerjaPengembanganyang didukungolehdokumen terotorisas DitemukantidakadaEvaluasi programkerjapengembangan, kendaladanpeluangyangada sertatindaklanjutprogram RapatKoordinasiinternal(RTM)

13

14

15

Tabel3.50.TemuanDeskriptifDivisiAdministrasiKeuanganFakultasTeknologiIndustri TemuanDivisiAdministrasiKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Sasaranmutuyangtidakdisertaimetodepengukuran 2 KesesuaianSMUdenganlingkupkerjapadakriteria penerimaan75%kesesuaianSMUdenganlingkupkerja 99% DokumenparameterSMUyangtidakdiukur DokumenSMUdenganbuktinotulenrapatyang diotorisasitetapitidakditempel/lewatweb Ditemukanpencapaiansasaranmutuyangtidakdiukur

3 4 5 6

7 8

Dokumenevaluasidantindaklanjutmelaluirapat evaluasiSMUdenganbuktinotulenyangbelum diotorisasidanadarencanatindaklanjut SosialisasiProgramKerjaditempel(tidaklewatweb) EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogramtidak adadokumenprogramkerjarutintetapiadabukti notulenrapat ProgramkerjaPengembanganyangberlakudiotorisasi 75%mendukungSMU99% SosialisasiProgramKerjaditempel DitemukanPelaksanaanprogramkerjaPengembanganyang didukungolehdokumenterotorisassebesar50% pelaksanaanprogramkerjapengembangan74%

9 10 11

BPM-UII-YOGYAKARTA/2011

Halaman 30 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiAdministrasiKeuangan AnalisisPenyebab No. Deskripsi 12 DitemukanEvaluasiprogramkerjapengembangan, kendaladanpeluangyangadasertatindaklanjut programRapatKoordinasiinternal(RTMunit)melalui rapattidakrutin dantidakadakelengkapanrapat 13 DitemukandokumenEvaluasipelaksanaandantindak lanjutRTMPelaksanaandantindaklanjutRTMdengan kriteriapenerimaan,sesuaiaturanyangditetapkan tetapitidakadapenetapantindaklanjut 14 DitemukandokumenPKyangberlakudandiotorisasi denganJumlahPKyangtersedia75%sesuaidengan lingkup/proseskerja100% 15 DitemukanDokumenPKdenganketercapaian25% JumlahPKyangdievaluasi49,9% 16 DitemukanEvaluasidantindaklanjuthasilevaluasi (reward,punishment)yangtidakditindaklanjuti (semulaadareword)kemudiansetelahditiadakantidak adadokumenataunotulendanakarmasalahnya RencanaTindakLanjut

Tabel3.51.TemuanDeskriptifDivisiRT&PerbekalanFakultasTeknologiIndustri TemuanDivisiRT&Perbekalan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 DokumenpengukuranparameterSMU PengukuranparameterSMU75% TindakanPerbaikan: 75%parameteryangdiukur99% 75%parameteryangdiukur Akanmeningkatkankinerjalebih 99% baikdanoptimal 2 DitemukanSosialisasiSMUditempel Tidakdilakukansosialisasi TindakanPerbaikan: lewatweb Akandilakukansosialisasilewat web 3 DPencapaiansasarandidukungoleh Belummelakukanprogram TindakanPerbaikan: dokumenyangsudahdiotorisasi Akandailakukanprogramkerja kerjayangbersesuaian sebesar75%ketercapaiansasaran denganSasaranMutusecara yangbersesuaiandengansasaran 99,9% mutusecaramaksimal maksimal 4 SosialisasiProgramKerja Tidakdilakukansosialisasi TindakanPerbaikan: ditempel(tidaklewatweb) programkerjalewatweb Akandilakukansosialisasi programlewatweb 5 Belumadadokumenpenjelasanakar Tidakdilakukanevaluasi TindakanPerbaikan: masalahpadaevaluasiprogram programrutinunitdengan Akandilakukanevaluasiprogram rutinunit diikutipenjelasanakar rutinunitdengandiikuti masalah penjelasanakarmasalah 6 SosialisasiProgramKerjabaru Tidakdilakukansosialisasi TindakanPerbaikan: ditempel programkerjalewatweb Akandilakukansosialisasi programkerjalewatweb 7 Penugasandanpembagiankerja Tidakmengarsipkandokumen TindakanPerbaikan: kepadastaftidakadadokumennya penugasandanpembagian Akandilakukanpengarsipan kerjastaf dokumenpenugasandanpembagian kerjastaf 8 DokumenPKyangberlakudan Tidakdilakukanpenyusunan TindakanPerbaikan: diotorisasidanJumlahPKyang AkandilakukanpenyusunanPKyang PKyangberlakudan tersedia75%sesuaidengan berlakudandiotorisasidan diotorisasidanjumlahPK lingkup/proseskerja100% tersedia75sesuaidengan jumlahPKyangtersedia75% lingkup/proseskerja100% sesuaidenganlingkup/proses kerja100% Tabel3.52.TemuanDeskriptifDivisiSIMFakultasTeknologiIndustri TemuanDivisiSIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUbelummelaluiwebsite, Merasabelumperlumalalui TindakanPerbaikan: auditeeberanggapanbelumperlu,karena Akandiusahakanmemintaakses websitedankarenahanya hanyalingkupdivisiSIMterkait. kewebsitemelaluiadminnya lingkupDivisi TindakanPerbaikannyaakandiusahakan memintaakseskewebsitemelalui adminnya 2 AdasalahsatuSMUyangbelumtercapai. Karenamasihbelumberusaha TindakanPerbaikan: TingkatketercapaiannyaSMUnomordua( Akandiusahakansecara secaramaksimal sistemcomputeradministrasidan maksimal anjunganmahasiswa,baiksoftwaremaupun

BPM-UII-YOGYAKARTA/2011

Halaman 31 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanDivisiSIM Deskripsi hardwaresebesar79,17%).Untuk mencapai90%sesuaiSMUakan ditindaklanjutipadaperiodeaudit berikutnya.Auditeemengakuibelum berusahamaksimal SosialisasiProgramKerjaRutinditempel belummelaluiweb.Auditeeberanggapan belumperlu,karenahanyalingkupdivisi SIMterkait.TindakanPerbaikannyaakan diusahakanmemintaakseskewebsite melaluiadminnya. PelaksanaanProgramKerjaRutinUnit yangdidukungolehdokumenterotorisasi tingkatketercapaiannya<90%.Auditee mengakuibelumberusahamaksimalakan diusahakansecaramaksimal. SosialisasiProgramKerjaPengembangan ditempelbelummelaluiweb.Auditee beranggapanbelumperlu,karenahanya lingkupdivisiSIMterkait.Tindakan Perbaikannyaakandiusahakanmeminta akseskewebsitemelaluiadminnya. PelaksanaanProgramKerjaPengembangan Unityangdidukungolehdokumen terotorisasitingkatketercapaiannya< 90%.Auditeemengakuibelumberusaha maksimalakandiusahakansecara maksimal. AdanyaPKyangjustrutidakdilakukan olehDivisiSIMyaitupengelolaandata EBSBED.KaenadianggapsamadenganPK DivisiSIMdiFakultaslain,Tindakan PerbaikanauditeememintapenghapusanWT terkaithaltersebutkarenamemangtidak dilakukandidivisiSIMFTI,sehingga tingkatketercapainnya<90% AnalisisPenyebab RencanaTindakLanjut

Merasabelumperlumalalui websitedankarenahanya lingkupDivisi

TindakanPerbaikan: Akandiusahakanmemintaakses kewebsitemelaluiadminnya TindakanPerbaikan: Akandiusahakansecara maksimal TindakanPerbaikan: Akandiusahakanmemintaakses kewebsitemelaluiadminnya TindakanPerbaikan: Akandiusahakansecara maksimal TindakanPerbaikan: MemintapenghapusanWThal tersebutkarenamemangtidak dilakukandiSIMFTI

Karenamasihbelumberusaha secaramaksimal

Merasabelumperlumalalui websitedankarenahanya lingkupDivisi

Karenamasihbelumberusaha secaramaksimal

DianggapsamadenganPK DivisiSIMdiFakultaslain

Tabel3.53.TemuanDeskriptifDivisiPerpustakaanFakultasTeknologiIndustri TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ditemukantidakadadokumenmetode Belumdilakukanmetode TindakanPerbaikan: pengukuranSMU pengukuransesuaiSMM Akandilakukanmetodepengukurn sesuaiSMM 2 DitemukanSosialisasiSMUditempel Tidakdilakukansosialisasi TindakanPerbaikan: lewatweb Akandilakukansosialisasilewat web 3 DitemukanBelummenunjukkanakar Tidakdilakukandengan TindakanPerbaikan: masalahdanrencanatindaklanjut menyebutkanakarmasalah AkandilakukanevaluasiSMU dokumenevaluasiSMU evaluasiketercapaian denganmenyebutkanakar sasaranmutuunit masalahnya 4 DitemukanSosialisasiProgram Tidakdilakukansosialisasi TindakanPerbaikan: Kerjaditempel(tidaklewatweb) programkerjalewatweb Akandilakukansosialisasi programkerjalewatweb 5 DitemukanBelumadadokumen Tidakdilakukanevaluasi TindakanPerbaikan: penjelasanakarmasalahpada programrutinunitdengan Akandilakukanevaluasiprogram evaluasiprogramrutinunit rutinunitdengandiikuti diikutipenjelasanakar masalah penjelasanakarmasalah 6 DitemukanSosialisasiProgram TidakdilakukanSosialisasi TindakanPerbaikan: Kerjaditempel ProgramKerjalewatweb AkandilakukanSosialisasi ProgramKerjalewatweb 7 DitemukanBelummenunjukkan TidakdilakukanEvaluasi TindakanPerbaikan: dokumenEvaluasiprogramkerja programkerjapengembangan, AkandilakukanEvaluasiprogram pengembangan,kendaladanpeluang kendaladanpeluangyangada kerjapengembangan,kendaladan yangadaakarmasalahdanrencana disertaiakarmasalahdan peluangyangadadisertaiakar tindaklanjut. masalahdanrencanatindaklanjut rencanatindaklanjut 8 DitemukanDokumenPKyangberlaku Tidakdilakukanpenyusunan TindakanPerbaikan:

BPM-UII-YOGYAKARTA/2011

Halaman 32 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiPerpustakaan No. Deskripsi dandiotorisasi danJumlahPKyangtersedia75% sesuaidenganlingkup/proseskerja 100% Tabel3.54.TemuanDeskriptifDivisiAdministrasiUmumFakultasTeknologiIndustri TemuanDivisiAdministrasiUmum AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUbelummelalui Merasabelumperlumalalui TindakanPerbaikan: Website websitedankarenahanya Akandiusahakanmemintaakseske lingkupDivisi websitemelaluiadminnya TindakanPerbaikan: 2 SosialisasiProgramKerjarutin Sebab,pertama,auditee ditempelbelumlewatweb.Sebab, beranggapanbelum Akandilakukansosialisasilewat pertama,auditeeberanggapanbelum perlu,karenahanyalingkup websetelahdilakukanrapat perlu,karenahanyalingkupdivisi divisiUmumterkait.kedua, kordinasidenganunitterkaitdan Umumterkait.kedua,dianggapdi wadek dianggapdiluarkapasitas luarkapasitasyangdilakukan yangdilakukanmenurut auditeetidaksesuaiWT menurutauditeetidaksesuaiWT divisiumum divisiumum, 3 Belumdilakukanmaksimal TindakanPerbaikan: Tingkatketercapaianpelaksanaan Akandiusahakansemaksimal programkerjapengembangansebesar mungkinuntukmencapaitarget 75%mendukungSMU99%didukung 100% olehdokumenyangberlakudan diotorisasi 4 SosialisasiProgramKerja Karenaauditeeberanggapan TindakanPerbaikan: pengembanganditempelbelumlewat belumperlu,karenahanya Akandilakukansosialisasi web.auditeeberanggapanbelum lingkupdivisiumumterkait ProgramKerjapengembangan perlu,karenahanyalingkupdivisi ditempelbelumlewatweb umumterkait. 5 JumlahPKyangtersedia75% Karenabelumdilakukansemua TindakanPerbaikan: sesuaidenganlingkup/proseskerja PKsesuaiWTunitterkait AkandilakukanPKsesuaiWTunit 100%denganbuktidokumenPKyang divisiumum berlakudandiotorisasi 6 Implementasi/pelaksanaanPKdi Karenabelummaksimalsemua TindakanPerbaikan: lapangan75%JumlahPKyang Akandilakukukansemaksimal dilakukan tersediadiimplementasikandi mungkin lapangan99,9% 7 EvaluasiPKmelaluirapatdan tindaklanjutevaluasiPKunit sebesar75%JumlahPKyang dievaluasi99% Tabel3.55.TemuanDeskriptifDivisiKuliahdanUjianFakultasTeknologiIndustri TemuanDivisiKuliahdanUjian AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 DitemukankesesuaianSMUdenganlingkup kerjapadakriteriapenerimaan75% kesesuaianSMUdenganlingkupkerja99% 2 DitemukandokumenpengukuranparameterSMU 75%arameteryangdiukur99% 3 DitemukandokumenSMUdenganbuktinotulen rapatyangdiotorisasitetapitidak ditempel/lewatweb 4 Ditemukandokumenevaluasidantindak lanjutmelaluirapatevaluasiSMUdengan buktinotulenyangbelumdiotorisasidan adarencanatindaklanjut 5 DitemukanSosialisasiProgramKerja ditempel(tidaklewatweb) 6 Ditemukanevaluasidantindaklanjut melaluirapatevaluasiProgramKerjaRutin denganbuktinotulenyangdiotorisasidan adarencanatindaklanjut AnalisisPenyebab PKyangberlakudan diotorisasi danJumlahPKyangtersedia 75%sesuaidengan lingkup/proseskerja100% RencanaTindakLanjut AkandilakukanpenyusunanPKyang berlakudandiotorisasi danJumlahPKyangtersedia75% sesuaidenganlingkup/proses kerja100%

BPM-UII-YOGYAKARTA/2011

Halaman 33 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiKuliahdanUjian No. Deskripsi 7 DitemukanProgramkerjaPengembanganyang berlakudiotorisasi 50%%mendukungSMU74% 8 DitemukanSosialisasiProgramKerja ditempel 9 DitemukanPelaksanaanprogramkerja Pengembanganyangdidukungolehdokumen terotorisassebesar50%pelaksanaan programkerjapengembangan74% 10 DitemukanEvaluasiprogramkerja pengembangan,kendaladanpeluangyangada denganbuktinotulendiotorisasiberisi penjelasanakarmasalahtetapibelumada tindaklanjutnya 11 DitemukanImplementasi/pelaksanaanPKdi divisiperkuliahandanujian75%Jumlah PKyangtersediadiimplementasikandi lapangan99,9% 12 DitemukanEvaluasiPKmelaluirapatdan tindaklanjutevaluasiPKunit75%Jumlah PKyangdievaluasi99% 13 DitemukanMetodesosialisasiDCMdisimpan dalamordner 14 DitemukanMetodepengelolaandokumen(cara pengarsipandanpenyimpanan)sesuaidengan DCM75%PengelolaandokumensesuaiDCM 99,9% 15 DitemukanKetersediaanevaluasiDCMunit 75%jenisdokumenyangtersedia99% danterdaftardalamDCM 16 Ditemukandokumenpengendaliankeluhan pelangganditerapkansebagian 17 DitemukanEvaluasidantindaklanjut terhadapkeluhanpelanggantidaksesuaiPM AnalisisPenyebab RencanaTindakLanjut

1.8.DivisiFakultasTeknikSipildanPerencanaan Hasil kinerja unit divisi FTSP secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 3.56, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable3.583.62
Tabel3.56.HasilCapaianKinerjaPeriode2010UnitDivisiFakultasTeknikSipildanPerencanaan IndeksKinerjaDivisi No 1 2 3 IndikatorKinerja Adm.Data Akademik&SIM 4.00 4.00 2.75 4.00 4.00 4.00 2.50 4.00 3.66 Adm. Keuangan 4.00 3.80 3.50 4.00 4.00 4.00 4.00 4.00 3.91 Umum &RT 4.00 4.00 4.00 4.00 3.67 3.75 4.00 4.00 3.93 SIM 3.83 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.98 Perpus 3.83 3.80 3.75 4.00 4.00 4.00 4.00 4.00 3.92

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasionaldalamhalproses 4 koordinasiinternalunitdantindaklanjutRTM PenerapanProsedurKerja(PK) 5 Pemahaman,realisasidanevaluasiDaftarCatatan 6 Mutu(DCM) 7 EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan 8 IndeksKinerja

BPM-UII-YOGYAKARTA/2011

Halaman 34 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel3.57.RangkumanPelaksanaanAuditDiDivisiFTSP

Divisi
AdministrasiDataAkademikdanSIM AdministrasiKeuangan UmumdanRT AdministrasiAkademik Perpustakaan

TanggalAudit Auditee
07April2011 11April2011 08April2011 07April2011 12April2011 Heriyanta YaisyulHavid Suradi Sumino Suharti

Auditor
SonnyAndrianto,S.Psi.,M.Psi SonnyAndrianto,S.Psi.,M.Psi SonnyAndrianto,S.Psi.,M.Psi SonnyAndrianto,S.Psi.,M.Psi SonnyAndrianto,S.Psi.,M.Psi

Tabel3.58.TemuanDeskriptifDivisiAdministrasiDataAkademik&SIMFakultasTeknikSipildan Perencanaan TemuanAdministrasiSIM AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PengukuranSasaranMutuUnitbelum menggunakanFormulirHasil PemeriksaanSasaranMutu(FMUIIAM FSM02.04/R0) 2 BelummemilikiDaftarIndukDokumen Mutu(FMUIIAMFSM03.06/R0) 3 Belummemilikidaftartugasharian AnalisisPenyebab: TindakanPerbaikan: stafdandaftarevaluasikinerjastaf Auditeebelummemahami Dibuatkandaftar (BorangNo.26) maksuddaributir pekerjaanharianuntuk pertanyaanborangno. masingmasingstaf 26 berdasarprogramkerja Waktupenyampaian rutinyangsudahada borangdenganwaktu Dibuatkanlembarevaluasi auditterlalusingkat kinerjastaffberdasar Karenamerupakan daftarperkerjaanharian pekerjaanrutin,maka yangakandibuat. dipandangtidakperlu Evaluasiakandilakukan dibuatkandaftar setiapbulanolehKadiv pekerjaanharian& dievaluasi TindakanPencegahan: Akandilakukanrapat koordinasibersamadengan DivisiAdministrasiAkademik untukmembahassegalatemuan danpermasalahterkait pelayananakademik

Tabel3.59.TemuanDeskriptifDivisiAdministrasiKeuanganFakultasTeknikSipildanPerencanaan TemuanDivisiAdministrasiKeuangan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PengukuranSasaranMutuUnitbelum menggunakanFormulirHasil PemeriksaanSasaranMutu(FMUIIAM FSM02.04/R0) 2 Programkerja2011belumdiotorisasi 3 Tidakditemukansosialisasiprogram kerjarutindalambentukditempel (Borang9) Tidakditemukansosialisasiprogram kerjapengembangandalambentuk ditempel(Borang13) Padaprogramkerja,tidakditemukan keteranganwaktupelaksanaan

Sudahtercantumdalam schedule,namunbelum tertulispadaprogramkerja

Tidakditemukanbuktitelahdilakukan evaluasiterhadapprogram pengembanganyangtidakterlaksana (pengadaanmesinfotocopy)Borang 15

Rapatevaluasisudah dilakukan,namun notulenrapattidak ditemukan Karenalistrikdi

TindakanPerbaikan: Rencanawaktupelaksanaanyang sudahadadischedule,akan dituangkandalamProgramKerja TindakanPencegahan: Melaluirapatkoordinasiunit TindakanPerbaikan: Akandibuatnotulenrapat terkaitevaluasiterhadap programkerjayangbelum terlaksana

BPM-UII-YOGYAKARTA/2011

Halaman 35 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiAdministrasiKeuangan No. Deskripsi AnalisisPenyebab kantorseringmati, makanotulenrapat dibuatdirumah 7 8 Programkerjapengembangan, terlaksana75%(BorangNo.14) Tidakditemukannamaformulirdan kodedokumenpadaFormulirSurat PerintahMengeluarkanUang(SPMU) BelummemilikiDaftarIndukDokumen Mutu(FMUIIAMFSM03.06/R0) Tabel3.60.TemuanDeskriptifDivisiUmumdanRTFakultasTeknikSipildanPerencanaan TemuanDivisiUmumdanRT AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Redaksionalmetodepengukuransasaran mutuunitke1(Prosesingsurat menyurat,100%suratdiproses maksimal2hari)masihmembingungkan, sehinggaharusdirevisi 2 Padaagendasuratmasuk,belum tercantumtanggalkapansurat tersebutdidistribusikanpada orang/unityangdituju 3 Ditemukanadanyakesalahandalam mengidentifikasiantaraprogramrutin danpengembanganpadaprogramkerja unittahun2010 4 Belummemilikiprogramkerjarutin Diasumsikanprogramkerja TindakanPerbaikan: danpengembanganuntuktahun2011 masihantarabulanJuni Segeradisusunprogramkerja Juli,sehinggaprograkkerja unituntuktahun2011 tahun2011daribulan JanuariDesember2011belum TindakanPencegahan: Rapatkoordinasidiunitakan disusun selalumengacupadaprogram kerja 5 BelummemilikiProsedurKerja PalayananPermintaanBarangHabis PakaidanAsset(BorangNo.19) 6 BelummemilikiDaftarIndukDokumen Mutu(FMUIIAMFSM03.06/R0) 7 SatudokumenbelumadadalamDaftar CatatanMutu(FormBansoskes)(Borang No.24) Tabel3.61.TemuanDeskriptifDivisiAkademikFakultasTeknikSipildanPerencanaan TemuanDivisiAdministrasiAkademik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PengukuranSasaranMutuUnitbelum menggunakanFormulirHasil PemeriksaanSasaranMutu(FMUIIAM FSM02.04/R0) 2 Programkerjapengembangan, terlaksana80%(BorangNo.14) 3 Belumdilakukanevaluasiterhadap TindakanPerbaikan: Semuladirencanakanpada programkerjapengembanganyangbelum bulanNovember2010,namun Akandisampaikanpada terlaksana(Program:Pelatihan tidakterlaksanakarena rapatPimpinanFakultas PelayananPrima)(BorangNo.15) bencanaerupsiMerapi. untukditindaklanjuti& dilakukanpenelitian Evaluasibelumdilakukan Diupayakanuntukdapat karenakesibukanKadiv terlaksananpadatahun AdministrasiAkademik 2011 TindakanPencegahan: Setiapkalidilakukan rapatkoordinasi,akan mengacupadaprogram kerjaunit RencanaTindakLanjut TindakanPencegahan: Setiapmelakukanrapat koordinasiunit,segeradibuat notulenrapat&diarsipkan

BPM-UII-YOGYAKARTA/2011

Halaman 36 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDivisiAdministrasiAkademik No. Deskripsi AnalisisPenyebab RencanaTindakLanjut Formulirprogramkerja, mencantumkankolomuntuk identifikasi perencanaandan realisasi,sehingga mudahdalammelakukan kontrol.

4 5

BelummemilikiDaftarIndukDokumen Mutu(FMUIIAMFSM03.06/R0) Belummemilikidaftartugasharian stafdandaftarevaluasikinerjastaf (BorangNo.26)

Semuladirencanakanpada bulanNovember2010,namun tidakterlaksanakarena bencanaerupsiMerapi. Evaluasibelumdilakukan karenakesibukanKadiv AdministrasiAkademik

TindakanPerbaikan: Akandisampaikanpada rapatPimpinanFakultas untukditindaklanjuti& dilakukanpenelitian Diupayakanuntukdapat terlaksananpadatahun 2011 TindakanPencegahan: Setiapkalidilakukan rapatkoordinasi,akan mengacupadaprogram kerjaunit Formulirprogramkerja, mencantumkankolomuntuk identifikasi perencanaandan realisasi,sehingga mudahdalammelakukan kontrol.

Tabel3.62.TemuanDeskriptifDivisiPerpustakaanFakultasTeknikSipildanPerencanaan TemuanDivisiPerpustakaan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PengukuranSasaranMutuUnitbelum menggunakanFormulirHasil PemeriksaanSasaranMutu(FMUIIAM FSM02.04/R0) 2 KetercapaianSasaranMutuUnitmasih 75%.Sasaranyangbelumtercapai adalah:Ketepatanwaktumengembalikan pinjamanminimal75%daritotal peminjampertahun.Barutercapai: 67%(Borang5) 3 BelummemilikiProsedurKerja PenagihanBukuuntukPemustaka (Mahasiswa,Dosen,Karyawan) borang19 4 BelumpernahdilakukanevaluasiWT TindakanPerbaikan: Seringnyapergantian AkandilakukanevaluasiWTdan Kadiv,sehinggalebih segeradiusulkankeBPM memprioritaskan setelahmendapatpersetujuan pekerjaanyangmendesak dariDekan Tidaktercantumdalam borangAMI2011, TindakanPencegahan: sehinggatidakmenjadi MengusulkanpadaBPMagar fokusperhatianuntuk evaluasiWTmasukdalamborang dievaluasi AMIberikutnya 5 Pelaksanaanstockopnametidak ditemukandalamprogramkerjarutin& belumpernahdilaksanakan.(Borang8) 6 Programkerjapengembanganterlaksana 75%.Programyangbelumterlaksana: pengadaanrakCD,rakkoran,& komputer(Borang14)

BPM-UII-YOGYAKARTA/2011

Halaman 37 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

HASILPENGUKURANKINERJA UNITPROGRAMSTUDIDANLABORATORIUM

Hasil pengukuran kinerja unit program studi disajikan dalam 2 bagian yaitu bagian kinerja program studi dengan parameter Borang Akreditasi BAN (menggunakan 7 standar borang akreditasi BAN) dan kinerja subunit yang ada di bawah koordinasiprogramstudi(laboratorium,departemendanpusatstudi). A. KINERJAPROGRAMSTUDI

Evaluasi kinerja program studi untuk periode Audit Mutu Internal 20102011 mengalami satu perubahan yang sangat signifikan dari audit periode sebelumnya, yaitu parameter untuk indicator kinerja program studi. Parameter yang digunakan adalah 7 Standar yang ada pada Borang Akreditasi BAN PT dengan beberapa tambahan parameter yang diukur sesuai dengan kekhasan UII (12 Sasaran Mutu Universitas) sertaoperasionalisasimasingmasingindicatorkinerja. Perubahan ini dilakukan sebagai tindak lanjut dari keputusan Rapat Tinjauan Manajemen tingkat Universitas yang diselenggarakan pada tanggal 23 Juli 2010 dan juga sebagai langkah nyata implementasi prinsip continual improvement SistemManajemenMutudiUII. Hasil pengukuran kinerja program studi terdiri dari 2 jenis data, yaitu data angka berupa indeks kinerja program studi (skala 0 4) dan data deskriptif temuanauditbesertaanalisispenyebabdanrencanatindaklanjutnya. Urutan penyajian data hasil audit untuk Kinerja Unit Program Studi adalah (1) Hasil pengukuran kinerja Program Studi secara umum, (2) Indeks Kinerja Program Studi periode 20102011 per standar kinerja, (3) Temuan Deskriptif Hasil Pengukuran Kinerja Program Sudi 20102011, (4) Hasil analisis penyebab dan rencana tindak lanjut dari temuan untuk masingmasing program studi perfakultas dengan urutan penyajian sesuai abjad, yaitu FE, FH, FIAI, FMIPA, FK, FPSB, FTI danFTSP,(5)Kesimpulan I. HasilPengukuranKinerjaProgramStudiSecaraUmum

UII memiliki 21 program studi dan penyajian hasil hasil evaluasi kinerjanya akan disajikan dalam table 1 untuk 20 program studi yaitu Manajemen, Akuntansi, Ilmu Ekonomi, Ilmu Hukum, PAI, Hukum Islam, Ekonomi Islam, Pend. Dokter, Statistika, Ilmu Kimia, Farmasi, Psikologi, I.Komunikasi, T.Mesin, T. Elektro, T. Kimia, T. Industri, T. Informatika, T. Arsitektur, T. Sipil, T. Lingkungan dan table 2 khusus untuk program studi Pendidikan Dokter. Pemisahan dalam penyajian data prodi pendidikan dokter harus dilakukan mengingat adanya perbedaanjumlahitemdanjugacontentpadabeberapaitempengukuran. Indeks capaian kinerja untuk 21 unit program studi bergerak antara 2.65 3.56 dan ratarata nilai capaian kinerja seluruh program studi sebesar 3.28 (skala 0 4). Persentase tingkat ketercapaian kinerja secara umum sebesar 82%. Nilai tertinggi diraih oleh Prodi Akuntansi (3.75) dan nilai terendah dicapai olehProdiPsikologi(2.82). Hasil evaluasi kinerja untuk masingmasing standar menunjukkan bahwa kinerja untuk standar 5 (kurikulum, pembelajaran dan suasana akademik) mencapai nilai tertinggi sebesar 3.56 sementara nilai terendah terjadi untuk standar 7 (pelayanan/pengabdiankepadamasyarakatdankerjasamasebesar2.65.Hasilcapaian
BPM-UII-YOGYAKARTA/2011

Halaman 38 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

masingmasing standar untuk setiap program studi dapat dilihat secara lengkap padatable.4.1.
Tabel4.1.ResumeHasilPengukuranKinerja20Prodi20102011SemuaStandar
Fakultas FE FH FIAI FK FMIPA FPSB 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi Manajemen Akuntansi IlmuEkonomi IlmuHukum PAI HukumIslam EkonomiIslam Pend.Dokter Statistika IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 1 3.83 3.83 3.00 3.50 3.33 3.50 3.83 3.49 3.67 3.33 4.00 2.83 3.00 3.17 3.33 3.50 3.67 3.67 3.67 3.50 3.50 3.48 2 3.62 4.00 3.50 4.00 2.69 3.54 3.85 3.92 3.77 3.54 3.86 3.31 2.85 3.15 3.77 3.62 3.46 3.15 3.77 3.62 3.77 3.56 IndeksCapaianKinerja 3 4 5 6 3.18 3.53 3.70 3.94 3.55 3.77 3.77 3.94 3.23 3.63 3.53 3.94 3.33 3.63 3.76 3.94 3.23 3.43 3.37 2.72 2.90 2.80 3.35 3.28 3.41 3.63 3.67 3.39 3.70 3.19 3.93 4.00 2.95 3.47 3.72 3.81 2.86 3.27 3.37 3.38 3.65 2.73 3.60 3.63 2.68 3.23 3.12 3.94 1.81 1.31 2.76 2.89 2.88 2.68 3.36 3.22 3.47 3.32 3.79 3.61 2.64 2.37 3.40 2.94 2.88 2.96 3.14 3.53 3.37 3.04 3.47 3.59 3.09 3.57 3.77 3.89 2.19 3.30 3.26 3.18 3.14 3.41 3.67 3.83 3.05 3.16 3.50 3.55 7 3.38 3.38 2.88 3.13 1.50 2.50 2.00 2.65 3.38 3.38 3.50 2.13 1.67 2.75 3.13 1.25 2.25 2.88 2.38 2.67 3.00 2.65 All 3.60 3.75 3.39 3.61 2.90 3.12 3.40 3.55 3.54 3.30 3.57 3.03 2.33 3.03 3.49 2.82 3.13 3.31 3.45 3.10 3.47 3.28 Peringkat 3 1 11 2 18 15 10 5 6 13 4 17 20 17 7 19 14 12 9 16 8

FTI

FTSP

IndeksKinerja/Standar

Keterangan: Standar1=mengukurvisimisi,tujuandansasaransertastrategipencapan Standar2=mengukurtatapamong,kepemimpinan,systempengelolaandanpenjaminanmutu Standar3=mengukurmahasiswadanlulusan Standar4=mengukursumberdayamanusia Standar5=mengukurkurikulum,pembelajarandansuasanaakademik Standar6=mengukurpembiayaan,saranadanprasaranasertasysteminformasi Standar7=mengukurpelayanan/pengabdiankepadamasyarakatdankerjasama

II.IndeksKinerjaProgramStudiPeriode20102011:PerStandarKinerja
1.KinerjaStandar1:Visi,Misi,Tujuan,SasarandanStrategiPencapain Indeks capaian kinerja unit program studi di UII dalam pencapaian Visi, Misi dan Sasaran serta Strategi Pencapaiannya bergerak antara 2.83 4.00 dan rataratanilaicapaiankinerjauntukstandar1sebesar3.49(skala04).Nilai tertinggi diraih oleh Prodi Farmasi (4.00) dan nilai terendah dicapai oleh Prodi Psikologi(2.83). Indikator kinerja standar 1 yang mendapatkan nilai tertinggi dengan indeks sebesar3.90ada3,yaitu: (1) (2) (3) ProsesPenyusunanVisi,MisidanTujuanProdi(item1.1.1.2). Ketersediaansasaran(mutu)prodi(1.1.1.3) Upayadanstrategipencapaiansasaranmutuprodi(item1.1.2.1)

Nilai kinerja terendah adalah Tingkat Ketercapaian Sasaran (Mutu) Prodi (item 1.1.2.2) dengan indeks capaian kinerja sebesar 1.88. Adapun Hasil capaian setiap indicator kinerja dalam pencapaian visi, misi, sasaran mutu dan pencapaiannya untuk semua program studi bisa dilihat secara lengkap pada table.4.2.

BPM-UII-YOGYAKARTA/2011

Halaman 39 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.2.HasilCapaianKinerjaProdiPeriode20102011Standar1 1.1 1.2 1.1.1 1.1.2 1.2.1 Fakultas ProgramStudi 1.1.1.1 1.1.1.2 1.1.1.3 1.1.2.1 1.1.2.2 1 Manajemen 4.00 4.00 4.00 4.00 3.00 4.00 FE 2 Akuntansi 4.00 4.00 4.00 4.00 3.00 4.00 3 IlmuEkonomi 4.00 3.00 3.00 2.00 3.00 3.00 FH 4 IlmuHukum 4.00 4.00 4.00 4.00 1.00 4.00 5 PAI 4.00 4.00 4.00 4.00 2.00 2.00 FIAI 6 HukumIslam 4.00 4.00 4.00 4.00 2.00 3.00 7 EkonomiIslam 4.00 4.00 4.00 4.00 3.00 4.00 FK 8 Pend.Dokter 4.00 4.00 4.00 4.00 2.00 4.00 9 Statistika 4.00 4.00 4.00 4.00 2.00 4.00 FMIPA 10 IlmuKimia 4.00 4.00 3.00 4.00 1.00 4.00 11 Farmasi 4.00 4.00 4.00 4.00 4.00 4.00 12 Psikologi 1.00 4.00 4.00 4.00 3.00 1.00 FPSB 13 I.Komunikasi 3.00 3.00 4.00 4.00 0.00 4.00 14 T.Mesin 4.00 4.00 4.00 4.00 0.00 3.00 15 T.Elektro 4.00 4.00 4.00 4.00 0.00 4.00 FTI 16 T.Kimia 4.00 4.00 4.00 4.00 1.00 4.00 17 T.Industri 4.00 4.00 4.00 4.00 3.00 3.00 18 T.Informatika 4.00 4.00 4.00 4.00 2.00 4.00 19 T.Arsitektur 4.00 4.00 4.00 4.00 2.00 4.00 FTSP 20 T.Sipil 4.00 4.00 4.00 4.00 1.00 4.00 21 T.Lingkungan 4.00 4.00 4.00 4.00 1.00 4.00 IndeksKinerja/Elemen 3.81 3.90 3.90 3.90 1.88 3.57 Keterangan:IndicatorKinerjaStandar1 1.1.1.1 Ketersediaanvisi,misidantujuanprodi 1.1.1 1.1.1.2 Prosespenyusunanvisi,misidantujuanprodi 1.1 1.1.2 1.1.1.3 Ketersediaansasaran(mutu)prodi 1.1.2.1 Upayadanstrategipencapaiansasaranmutuprodi All 3.83 3.83 3.00 3.50 3.33 3.50 3.83 3.49 3.67 3.33 4.00 2.83 3.00 3.17 3.33 3.50 3.67 3.67 3.67 3.50 3.50 3.49

1.1.2.2 Tingkatketercapaiansasaran(mutu)prodi Sosialisasiyangefektifvisi,misi,tujuan,dansasaranProgramStudioleh 1.2 1.2.1 seluruhpemangkukepentinganinternal(internalstakeholders)

1.

KinerjaStandar2:TataPamong,Kepemimpinan,SistemPengelolaandan PenjaminanMutu

Indeks capaian kinerja unit program studi di UII dalam Tersedianya Tata Pamong,Kepemimpinan,SistemPengelolaandanPenjaminanMutubergerakantara2.69 4.00denganrataratanilaicapaiankinerjauntukstandar2sebesar3.55(skala 0 4). Nilai tertinggi diraih oleh Prodi Akuntansi dan Ilmu Hukum (4.00) dan nilaiterendahdicapaiolehProdiPAI(2.69). Indikator kinerja standar 2 yang mendapatkan nilai tertinggi adalah Menggunakan 5 pilar tata pamong sebagai strategi dalam melaksanakan tata pamong (item 2.1.1.2) sebesar 3.89 dan nilai terendah adalah Tersedianya Program studi S1 terakreditasi internasional (item 2.6.2) dengan indeks capaian kinerja sebesar 1.95. Adapun hasil capaian setiap indicator kinerja dalam pencapaian visi, misi, sasaran (mutu) dan pencapaiannya dapat dilihat secara lengkap pada table.4.3.
Fakultas FE FH FIAI 1 2 3 4 5 6 Tabel4.3.HasilCapaianKinerjaProdiPeriode20102011Standar2 2.1 2.2 2.3 ProgramStudi 2.1.1.1 2.1.1.2 2.2.1.1 2.2.1.2 2.2.1.3 2.3.1.1. 2.3.1.2 Manajemen 4.00 4.00 4.00 4.00 4.00 4.00 4.00 Akuntansi 4.00 4.00 4.00 4.00 4.00 4.00 4.00 IlmuEkonomi 3.00 4.00 4.00 4.00 4.00 3.00 3.00 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 4.00 PAI 4.00 3.00 3.00 3.00 3.00 3.00 3.00 HukumIslam 3.00 4.00 4.00 4.00 3.00 4.00 4.00

BPM-UII-YOGYAKARTA/2011

Halaman 40 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FK ProgramStudi 7 Ek.Islam 8 Pend.Dokter 9 Statistika FMIPA 10 IlmuKimia 11 Farmasi 12 Psikologi FPSB 13 I.Komunikasi 14 T.Mesin 15 T.Elektro FTI 16 T.Kimia 17 T.Industri 18 T.Informati 19 T.Arsitek FTSP 20 T.Sipil 21 T.Lingk IndeksKinerja/Elemen Tabel4.3.HasilCapaianKinerjaProdiPeriode20102011Standar2(lanjutan) 2.4 2.5 2.6 2.4.1 2.5.1 2.6.1 2.6.2 Fakultas ProgramStudi 2.4.1.1 2.4.1.2 2.5.1.1 2.5.1.2 1 Manajemen 4.00 3.00 4.00 3.00 4.00 1.00 FE 2 Akuntansi 4.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 3.00 3.00 4.00 3.00 4.00 FH 4 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 5 PAI 2.00 2.00 2.00 3.00 4.00 0.00 FIAI 6 HukumIslam 2.00 2.00 4.00 4.00 4.00 4.00 7 EkonomiIslam 4.00 4.00 4.00 4.00 4.00 2.00 FK 8 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 3.00 9 Statistika 4.00 4.00 4.00 4.00 4.00 2.00 FMIPA 10 IlmuKimia 4.00 3.00 3.00 4.00 4.00 0.00 11 Farmasi 4.00 4.00 4.00 4.00 4.00 2.00 12 Psikologi 4.00 4.00 2.00 4.00 3.00 1.00 FPSB 13 I.Komunikasi 3.00 3.00 3.00 3.00 3.00 1.00 14 T.Mesin 3.00 4.00 4.00 4.00 4.00 1.00 15 T.Elektro 4.00 4.00 4.00 4.00 4.00 1.00 FTI 16 T.Kimia 3.00 4.00 4.00 4.00 4.00 2.00 17 T.Industri 3.00 3.00 3.00 3.00 3.00 2.00 18 T.Informatika 3.00 3.00 4.00 4.00 4.00 1.00 19 T.Arsitektur 4.00 4.00 3.00 4.00 4.00 3.00 FTSP 20 T.Sipil 4.00 4.00 4.00 1.00 4.00 2.00 21 T.Lingkungan 4.00 4.00 4.00 3.00 4.00 2.00 IndeksKinerja/Elemen 1.90 3.52 3.52 3.62 3.57 3.86 Keterangan:IndicatorKinerjaStandar2 2.1.1.1 2.1 2.1.1. Memilikiperangkattatapamongyangjelas Menggunakan5pilartatapamongsebagaistrategidalammelaksanakantata pamong 2.2.1.1 Memilikikarakteristikkepemimpinanoperasional 2.2.1.2 Memilikikarakteristikkepemimpinanorganisasi 2.2.1.3 Memilikikarakteristikkepemimpinanpublik Ketersediaanpedoman/mekanisme/SOP/Prosedurkerjapengelolaanfungsional 2.3.1.1. danoperasional Kesesuaianpelaksanaandenganpedoman/mekanisme/SOP/Prosedurkerja 2.3.1.2 pengelolaanfungsionaldanoperasional 2.4.1.1 Ketersediaanunitdanperangkatsystempenjamninanmutu 2.4.1.2 Tingkatimplementasisystempenjaminanmutu Pelaksanaandanhasilevaluasiumpanbalikkepadadosen,mahasiswa,alumni 2.5.1.1 danpengguna(users) 2.5.1.2 Intensitasdanpelaksanaanevaluasiumpanbalik Upayaupayayangtelahdilakukanpenyelenggaraprogramstudiuntuk menjaminkeberlanjutan(sustainability)programstudi ProgramstudiS1terakreditasiinternasional 2.1.1.2 2.1 2.2 2.3 2.1.1.1 2.1.1.2 2.2.1.1 2.2.1.2 2.2.1.3 2.3.1.1. 2.3.1.2 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 3.00 4.00 0.00 3.00 4.00 4.00 3.00 3.00 3.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 3.00 4.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.81 3.90 3.81 3.62 3.80 3.86 3.38

3.62 4.00 3.50 4.00 2.69 3.54 3.85 3.92 3.77 3.54 3.85 3.31 2.85 3.15 3.77 3.62 3.46 3.15 3.77 3.62 3.77 3.55

2.2

2.2.1

2.3

2.3.1

2.4 2.5

2.4.1 2.5.1 2.6.1 2.6.2

2.6

BPM-UII-YOGYAKARTA/2011

Halaman 41 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

3.KinerjaStandar3:MahasiswadanLulusan Indeks capaian kinerja semua unit program studi di UII untuk keunggulan mutu mahasiswa dan lulusan bergerak antara 1.81 3.70 dan ratarata nilai capaian kinerja untuk standar 1 sebesar 3.06 (skala 0 4). Nilai tertinggi diraih oleh Prodi Pendidikan Dokter (3.70) dan nilai terendah dicapai oleh Prodi IlmuKomunikasi(1.81). Indikator kinerja standar 3 yang mendapatkan nilai tertinggi dengan indeks sebesar4.00adalah: (1) (2) Sistem rekruitmen calon mahasiswa baru, dokumentasi kebijakan dan konsistensipelaksanaannya(item3.1). Tersedianya akses bagi mahasiswa untuk mendapatkan pelayanan dalam membina dan mengembangkan penalaran, minat, bakat, seni, dan kesejahteraan(item3.6.1).

Sementara itu, indicator kinerja yang hasil capaiannya < 3 (diurutkan darinilaiyangpalingrendahketinggi)adalah: (1) (2) (3) (4) (5) (6) (7) (8) Persentase mahasiswa asing baru terhadap total mahasiswa baru (item 3.2.1.6)denganindekssebesar1.33. Persentase mahasiswa yang DO atau mengundurkan diri (item 3.5.1.1) denganindeks1.76. Rasio calon mahasiswa yang ikut seleksi dengan daya tampung (item 3.2.1.1)denganindeks2.62. Rasio mahasiswa baru reguler yang melakukan registrasi:calon mahasiswa barureguleryanglulusseleksi(item3.2.1.2)denganindeks2.56. Profilmasatunggubagilulusanuntukmemperolehpekerjaanyangpertama (item3.7.1.4)denganindeks2.65 Pendapat pengguna (employer) lulusan terhadap kualitas alumni (item 3.7.1.3)denganindeks2.82. Rasio mahasiswa baru terhadap total mahasiswa (item 3.2.1.4) dengan indeks2.79. Capaian kompetensi KeUIIan lulusan meliputi keislaman, kebangsaan, kewirausahaan dan bahasa Inggris (KLr) (item 3.5.1.3.1) dengan indeks 2.92

Hasilcapaiansetiapindicatorkinerjadalampencapaiankeunggulanmahasiswa danlulusandapatdilihatsecaralengkappadatable.4.4.
Tabel4.4.HasilCapaianKinerjaProdiPeriode20102011Standar3 3.1 3.2 ProgramStudi 3.2.1.1 3.2.1.2 3.2.1.3 3.2.1.4 3.2.1.5 3.2.1.6 1 Manajemen 4.00 4.00 2.00 4.00 2.00 4.00 1.00 2 Akuntansi 4.00 4.00 4.00 4.00 3.00 4.00 1.00 3 IlmuEkonomi 4.00 2.00 2.00 4.00 4.00 4.00 4.00 4 IlmuHukum 4.00 4.00 2.00 3.00 0.00 4.00 3.00 5 PAI 4.00 2.00 2.00 4.00 4.00 4.00 1.00 6 HukumIslam 4.00 2.00 4.00 2.00 4.00 1.00 7 EkonomiIslam 4.00 1.00 2.00 4.00 3.00 4.00 1.00 8 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 4.00 1.00 9 Statistika 4.00 2.00 2.00 4.00 2.00 4.00 1.00 10 IlmuKimia 4.00 1.00 2.00 0.00 4.00 4.00 1.00 11 Farmasi 4.00 4.00 4.00 4.00 1.00 12 Psikologi 4.00 4.00 2.00 4.00 4.00 4.00 1.00 13 I.Komunikasi 4.00 4.00 0.00 0.00 1.00 14 T.Mesin 4.00 1.00 1.00 4.00 3.00 3.00 15 T.Elektro 4.00 3.00 2.00 4.00 4.00 4.00 16 T.Kimia 4.00 2.00 2.00 4.00 1.00 4.00 1.00 17 T.Industri 4.00 3.00 2.00 2.00 4.00 1.00 18 T.Informatika 4.00 3.00 3.00 4.00 2.00 4.00

Fakultas FE FH FIAI FK FMIPA FPSB

FTI

BPM-UII-YOGYAKARTA/2011

Halaman 42 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FTSP 19 20 21 ProgramStudi T.Arsitektur T.Sipil T.Lingkungan 3.1 3.2 3.2.1.1 3.2.1.2 3.2.1.3 3.2.1.4 3.2.1.5 3.2.1.6 4.00 3.00 3.00 4.00 3.00 2.00 1.00 4.00 1.00 4.00 4.00 2.00 0.00 4.00 4.00 1.00 3.00 4.00 4.00 3.00 1.00 4.00 2.62 2.56 3.48 2.79 3.40 1.33

IndeksKinerja/Elemen

Fakultas

FE FH FIAI FK FMIPA FPSB

FTI

FTSP

Tabel4.4.HasilCapaianKinerjaProdiPeriode20102011Standar3(lanjutan) 3.3 3.4 3.5 3.6 ProgramStudi 3.3.1 3.4.1 3.5.1.1 3.5.1.2 3.5.1.3 3.6.1 3.6.2 3.5.1.3.1 3.5.1.3.2 1 Manajemen 3.00 3.00 3.00 4.00 3.00 3.00 4.00 3.00 2 Akuntansi 3.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 2.00 3.00 3.00 3.00 4.00 3.00 4 IlmuHukum 2.00 4.00 4.00 4 5 PAI 4.00 4.00 2.00 4.00 3.00 3.00 4.00 3.00 6 HukumIslam 4.00 4.00 2.00 3.00 2.00 4.00 3.00 7 EkonomiIslam 4.00 4.00 3.00 4.00 3.00 3.00 4.00 4.00 8 Pend.Dokter 4.00 4.00 3.00 4.00 4.00 4.00 9 Statistika 4.00 4.00 0.00 3.00 4.00 3.00 10 IlmuKimia 4.00 4.00 1.00 4.00 3.00 3.00 4.00 4.00 11 Farmasi 4.00 4.00 2.00 3.00 4.00 4.00 4.00 4.00 12 Psikologi 4.00 3.00 3.00 4.00 3.00 3.00 4.00 0.00 13 I.Komunikasi 2.00 1.00 0.00 0.00 0.00 4.00 14 T.Mesin 4.00 3.00 0.00 3.00 4.00 3.00 15 T.Elektro 4.00 4.00 0.00 3.00 4.00 4.00 16 T.Kimia 4.00 0.00 0.00 3.00 3.00 3.00 4.00 4.00 17 T.Industri 3.00 4.00 1.00 3.00 4.00 3.00 18 T.Informatika 4.00 3.00 2.00 2.00 4.00 4.00 19 T.Arsitektur 4.00 3.00 2.00 3.00 2.00 4.00 4.00 4.00 20 T.Sipil 0.00 0.00 0.00 3.00 4.00 21 T.Lingkungan 4.00 4.00 4.00 2.00 4.00 3.00 4.00 4.00 3.48 3.24 1.76 3.11 2.92 3.17 4.00 3.39

IndeksKinerja/Elemen

Fakultas

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

FE FH FIAI FK FMIPA FPSB

FTI

FTSP

Tabel4.4.HasilCapaianKinerjaProdiPeriode20102011Standar3(lanjutan) 3.7 3.8 3.7.1.1 3.7.1.2 3.7.1.3 3.7.1.4 3.7.1.5 3.8.1.1 3.8.1.2 ProgramStudi Manajemen 4.00 4.00 0.00 3.00 4.00 4.00 4.00 Akuntansi 4.00 3.00 4.00 3.00 4.00 3.00 3.00 IlmuEkonomi 3.00 3.00 3.00 3.00 3.00 3.00 3.00 IlmuHukum 4.00 4.00 4.00 4.00 PAI 4.00 4.00 4.00 4.00 HukumIslam 4.00 4.00 4.00 2.00 4.00 3.00 2.00 EkonomiIslam 4.00 4.00 2.00 1.00 3.00 3.00 3.00 Pend.Dokter 4.00 3.00 4.00 4.00 4.00 3.00 4,00 Statistika 4.00 3.00 3.00 3.00 4.00 3.00 3.00 IlmuKimia 3.00 3.00 1.00 2.00 4.00 3.00 4.00 Farmasi 3.00 4.00 4.00 4.00 4.00 4.00 4.00 Psikologi 3.00 3.00 0.00 0.00 3.00 2.00 2.00 I.Komunikasi 3.00 2.00 4.00 2.00 2.00 T.Mesin 4.00 3.00 3.00 3.00 3.00 T.Elektro 4.00 4.00 3.00 3.00 4.00 4.00 4.00 T.Kimia 4.00 3.00 2.00 2.00 3.00 3.00 2.00 T.Industri 3.00 3.00 3.00 3.00 T.Informatika 4.00 4.00 4.00 3.00 2.00 4.00 4.00 T.Arsitektur 3.00 4.00 2.00 3.00 3.00 3.00 4.00 T.Sipil 2.00 4.00 3.00 0.00 T.Lingkungan 3.00 4.00 4.00 2.00 3.00 2.00 2.00 3.52 3.48 2.82 2.65 3.50 3.10 3.05

All 3.18 3.55 3.23 3.33 3.33 3.23 2.90 3.70 3.00 2.86 3.65 2.68 1.81 2.88 3.47 2.64 2.88 3.37 3.09 2.19 3.14 3.06

IndeksKinerja/Elemen

BPM-UII-YOGYAKARTA/2011

Halaman 43 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Keterangan:IndicatorKinerjaStandar1 3.1 3.2.1.1 3.2.1.2 3.2 3.2.1.3 3.2.1.4 3.2.1.5 3.2.1.6 3.3 3.4 3.3.1 3.4.1 3.5.1.1 3.5.1.2 3.5 3.5.1.3 3.6.1 3.6 3.6.2 3.7.1.1 3.7.1.2 3.7 3.7.1.3 3.7.1.4 3.7.1.5 3.8.1.1 3.8 3.8.1.2 3.5.1.3.1 3.5.1.3.2 Sistemrekruitmencaolonmahasiswabaru,dokumentasikebijakandan konsistensipelaksanaannya Rasiocalonmahasiswayangikutseleksi:dayatampung Rasiomahasiswabarureguleryangmelakukanregistrasi:calon mahasiswabarureguleryanglulusseleksi Rasiomahasiswabarutransferterhadapmahasiswabarureguler Rasiomahasiswabaruterhadaptotalmahasiswa RatarataIndeksPrestasiKumulatif(IPK)selamalimatahunterakhir Persentasemahasiswaasingbaruterhadaptotalmahasiswabaru Penerimaanmahasiswanonregulertidakmenmabhbebanmengajardosen (12SKS) Penghargaanatasprestasimahasiswadibidangnalar,bakatdanminat Persentasekelulusantepatwaktu PersentasemahasiswayangDOataumengundurkandiri CapaiankompetensiKeUIIanlulusanmeliputikeislaman,kebangsaan, kewirausahaandanbahasaInggris CapaiankompetensiKeUIIanlulusanmeliputikeislaman,kebangsaan, kewirausahaandanbahasaInggrisdengannilaibaik Mahasiswamemilikiaksesuntukmendapatkanpelayananmahasiswayang dapatdimanfaatkanuntukmembinadanmengembangkanpenalaran,minat, bakat,seni,dankesejahteraan. Kualitaslayanankepadamahasiswa Upayapelacakandanperekamandatalulusan Penggunaanhasilpelacakanuntukperbaikanprosespembelajaran, penggalangandana,informasipekerjaandanmembangunjejaring. Pendapatpengguna(employer)lulusanterhadapkualitasalumni. Profilmasatunggukerjapertamamemperolehpekerjaanyangpertama Profilkesesuaianbidangkerjadenganbidangstudi Partisipasialumnidalammendukungpengembanganakademikprodi Partisipasilulusandanalumnidalammendukungpengembangannon akademikprogramstudi

4.KinerjaStandar4:KeunggulanMutuSumberDayaManusia Indeks capaian kinerja semua unit program studi di UII untuk Keunggulan Mutu Sumber Daya Manusia bergerak antara 1.31 3.77 dan ratarata nilai capaian kinerja untuk standar 1 sebesar 3.16 (skala 0 4). Nilai tertinggi diraih oleh Prodi Akuntansi (3.77) dan nilai terendah dicapai oleh Prodi Ilmu Komunikasi (1.31). Indikator Kinerja Standar 3 yang mendapatkan nilai tertinggi dengan indeks sebesar 3.90 adalah tersedianya Pedoman tertulis tentang sistem seleksi, penempatan, pengembangan, retensi, dan pemberhentian dosen dan tenaga kependidikan(item4.1) Sementara itu, indicator kinerja yang hasil capaiannya < 3 (diurutkan dari nilaiyangpalingrendahketinggi)adalah: (1) (2) (3) Dosen yang memiliki jabatan Guru Besar yang bidang keahliannya sesuaidengankompetensiPS(item4.3.1.4)denganindekssebesar1.26 Prosentasejumlahdosenasing(item4.3.3)denganindekssebesar2.31 Kegiatan dosen tidak tetap yang bidang keahliannya sesuai dengan PS dalam seminar ilmiah/ lokakarya/ penataran/ workshop/pagelaran/

BPM-UII-YOGYAKARTA/2011

Halaman 44 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

pameran/peragaan yang tidak hanya melibatkan dosen PT sendiri (item 4.5.3)denganindekssebesar2.33 Persentase juml dosen tidak tetap terhadap jumlah seluruh dosen (item 4.4.1)denganindekssebesar2.42 Pustakawandankualifikasinya(item4.6.1.1)denganindeks2.67 Dosen tetap yang berpendidikan S3 yang bidang keahliannya sesuai dengan kompetensi PS (item 4.3.1.2) dan Kegiatan tenaga ahli/pakar sebagai pembicara dalam seminar/ pelatihan, pembicara tamu, dan sebagainya dari luar PT sendiri (tidak termasuk dosen tidak tetap) (item4.5.1)denganindekssebesar2.68 Dosen tetap yang memiliki jabatan lektor kepala dan guru besar yang bidang keahliannya sesuai dengan kompetensi PS (item 4.3.1.3) dengan indekssebesar2.76 Dosen yang memiliki Sertifikat Pendidik Profesional (item 4.3.1.5) denganindekssebesar2.79 Rasio mahasiswa terhadap dosen tetap yang bidang keahliannya sesuai denganbidangPS(RMD)(item4.3.2)denganindekssebesar2.84

(4) (5) (6)

(7)

(8) (9)

Hasil capaian setiap indicator kinerja dalam pencapaian keunggulan mahasiswadanlulusandapatdilihatsecaralengkappadatable.4.5.


Tabel4.5.HasilCapaianKinerjaProdiPeriode20102011Standar4 4.1 4.2 4.3 ProgramStudi 4.2.1 4.2.2 4.3.1 4.3.1.1 4.3.1.2 4.3.1.3 4.3.1.4 4.3.1.5 Manajemen 4.00 4.00 4.00 4.00 3.00 3.00 1.00 4.00 Akuntansi 4.00 4.00 4.00 4.00 4.00 3.00 4.00 3.00 IlmuEkonomi 4.00 4.00 4.00 4.00 4.00 3.00 1.00 4.00 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 1.00 4.00 PAI 4.00 3.00 3.00 4.00 4.00 4.00 1.00 4.00 HukumIslam 3.00 1.00 4.00 4.00 4.00 4.00 3.00 4.00 EkonomiIslam 4.00 4.00 4.00 4.00 1.00 4.00 3.00 4.00 Pend.Dokter 4.00 4.00 4.00 4.00 2.00 0.00 1.00 4.00 Statistika 4.00 4.00 4.00 4.00 3.00 4.00 3.00 3.00 IlmuKimia 4.00 4.00 4.00 4.00 4.00 4.00 2.00 2.00 Farmasi 4.00 4.00 4.00 1.00 0.00 2.00 1.00 0.00 Psikologi 4.00 4.00 4.00 4.00 4.00 1.00 1.00 0.00 I.Komunikasi 4.00 4.00 3.00 0.00 0.00 0.00 0.00 0.00 T.Mesin 4.00 4.00 4.00 4.00 0.00 0.00 0.00 1.00 T.Elektro 4.00 4.00 4.00 4.00 2.00 3.00 0.00 1.00 T.Kimia 4.00 4.00 4.00 2.00 1.00 4.00 0.00 4.00 T.Industri 3.00 3.00 4.00 4.00 4.00 2.00 1.00 4.00 T.Informatika 4.00 4.00 3.00 2.00 1.00 2.00 0.00 1.00 T.Arsitektur 4.00 4.00 4.00 4.00 4.00 4.00 0.00 3.00 T.Sipil 4.00 4.00 4.00 4.00 3.00 4.00 1.00 4.00 T.Lingkungan 4.00 4.00 4.00 4.00 1.00 3.00 1.00 3.00 3.90 3.76 3.86 3.48 2.52 2.76 1.19 2.71

Fakultas

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

FE FH FIAI FK FMIPA FPSB

FTI

FTSP

IndeksKinerja/Elemen

Fakultas FE

FH FIAI

FK

Tabel4.5.HasilCapaianKinerjaProdiPeriode20102011Standar4(lanjutan) 4.3 4.3.1 4.3.2 4.3.3 4.3.4 4.3.5 ProgramStudi 4.3.1.6 4.3.3 4.3.1.6.a 4.3.1.6.b 4.3.3.1 4.3.3.2 1 Manajemen 4.00 4.00 4.00 2.00 3.00 3.00 4.00 3.00 2 Akuntansi 4.00 4.00 4.00 3.00 3.00 3.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 0.00 4.00 4.00 4.00 4.00 4.00 4 IlmuHukum 3.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 5 PAI 4.00 4.00 1.00 4.00 4.00 2.00 4.00 4.00 6 HukumIslam 4.00 4.00 4.00 1.00 1.00 2.00 4.00 4.00 7 EkonomiIslam 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 8 Pend.Dokter 3.00 3.00 4.00 0.00 4.00 4.00

BPM-UII-YOGYAKARTA/2011

Halaman 45 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FMIPA 9 10 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi Statistika IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 4.3 4.3.1 4.3.2 4.3.3 4.3.4 4.3.5 4.3.1.6 4.3.3 4.3.1.6.a 4.3.1.6.b 4.3.3.1 4.3.3.2 3.00 2.00 4.00 0.00 3.00 3.00 4.00 4.00 3.00 3.00 4.00 0.00 2.00 1.00 4.00 4.00 3.00 2.00 2.00 0.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 3.00 4.00 4.00 4.00 4.00 0.00 0.00 0.00 0.00 4.00 4.00 4.00 4.00 1.00 2.00 4.00 4.00 3.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 0.00 3.00 2.00 2.00 3.00 4.00 2.00 0.00 3.00 4.00 4.00 4.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 0.00 4.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.57 3.30 2.76 2.18 3.06 3.06 3.71 3.60

FPSB FTI

FTSP

IndeksKinerja/Elemen

Tabel4.5.HasilCapaianKinerjaProdiPeriode20102011Standar4(lanjutan) 4.4 4.5 Fakultas ProgramStudi 4.4.1 4.4.2 4.5.1 4.5.2 4.5.3 4.5.4 4.5.5 4.4.2.1 4.4.2.2 FE 1 Manajemen 4.00 4.00 4.00 3.00 4.00 3.00 4.00 4.00 2 Akuntansi 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 4.00 3.00 4.00 3.00 3.00 4.00 FH 4 IlmuHukum 3.00 4.00 3.00 4.00 4.00 1.00 4.00 4.00 FIAI 5 PAI 4.00 4.00 3.00 1.00 4.00 1.00 4.00 4.00 6 HukumIslam 0.00 4.00 4.00 2.00 4.00 1.00 2.00 0.00 7 EkonomiIslam 2.00 4.00 4.00 2.00 2.00 4.00 3.00 4.00 FK 8 Pend.Dokter 4.00 3.00 4.00 1.00 4.00 4.00 FMIPA 9 Statistika 0.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 10 IlmuKimia 4.00 4.00 4.00 4.00 3.00 2.00 4.00 4.00 11 Farmasi 1.00 4.00 4.00 4.00 4.00 0.00 4.00 4.00 FPSB 12 Psikologi 4.00 4.00 4.00 3.00 4.00 4.00 3.00 1.00 13 I.Komunikasi 0.00 0.00 0.00 4.00 4.00 4.00 2.00 FTI 14 T.Mesin 2.00 4.00 3.00 3.00 4.00 4.00 4.00 15 T.Elektro 0.00 4.00 3.00 4.00 3.00 4.00 4.00 16 T.Kimia 3.00 4.00 3.00 1.00 4.00 0.00 1.00 2.00 17 T.Industri 1.00 4.00 4.00 3.00 4.00 2.00 4.00 4.00 18 T.Informatika 3.00 4.00 3.00 1.00 4.00 2.00 4.00 FTSP 19 T.Arsitektur 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 20 T.Sipil 3.00 4.00 3.00 0.00 4.00 2.00 4.00 21 T.Lingkungan 1.00 4.00 3.00 1.00 3.00 4.00 4.00 4.00 IndeksKinerja/Elemen 2.30 3.81 3.38 2.75 3.76 2.35 3.40 3.48 Tabel4.5.HasilCapaianKinerjaProdiPeriode20102011Standar4(Lanjutan) 4.5 4.6 Fakultas ProgramStudi 4.5.6 4.5.7 4.6.1 4.6.2 4.6.1.1 4.6.1.2 4.6.1.3 FE 1 Manajemen 3.00 3.00 4.00 4.00 4.00 4.00 2 Akuntansi 4.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 4.00 4.00 4.00 4.00 FH 4 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 FIAI 5 PAI 4.00 4.00 4.00 4.00 4.00 4.00 6 HukumIslam 3.00 2.00 2.00 2.00 3.00 4.00 7 EkonomiIslam 4.00 4.00 4.00 4.00 4.00 4.00 FK 8 Pend.Dokter 4.00 4.00 2.00 4.00 4.00 4.00 FMIPA 9 Statistika 4.00 4.00 4.00 4.00 4.00 4.00 10 IlmuKimia 3.00 4.00 1.00 4.00 4.00 4.00 11 Farmasi 3.00 3.00 1.00 3.00 4.00 4.00 FPSB 12 Psikologi 3.00 3.00 1.00 3.00 4.00 4.00 13 I.Komunikasi 3.00 3.00 0.00 0.00 3.00 FTI 14 T.Mesin 3.00 0.00 0.00 4.00 1.00 4.00 15 T.Elektro 3.00 4.00 3.00 4.00 4.00 4.00

All 3.53 3.77 3.63 3.63 3.43 2.80 3.63 3.19 3.47 3.27 2.73 3.23 1.31 2.68 3.32

BPM-UII-YOGYAKARTA/2011

Halaman 46 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas ProgramStudi 4.5 4.5.6 4.5.7 3.00 3.00 3.00 3.00 3.00 3.00 4.00 3.00 4.00 4.00 4.00 4.00 3.48 3.33 4.6 4.6.1 4.6.2 4.6.1.1 4.6.1.2 4.6.1.3 0.00 3.00 0.00 1.00 4.00 3.00 1.00 1.00 4.00 4.00 4.00 4.00 2.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 2.67 3.60 3.29 3.67 All 2.37 2.96 3.04 3.57 3.30 3.41 3.16

FTSP

16 T.Kimia 17 T.Industri 18 T.Informatika 19 T.Arsitektur 20 T.Sipil 21 T.Lingkungan IndeksKinerja/Elemen

Keterangan:IndicatorKinerjaStandar4 Pedomantertulistentangsistemseleksi,penempatan,pengembangan, 4.1 retensi,danpemberhentiandosendantenagakependidikan Pedomantertulistentangsistemmonitoringdanevaluasi,serta 4.2.1 rekamjejakkinerjadosendantenagakependidikan 4.2 Pelaksanaanmonitoringdanevaluasikinerjadosendibidang 4.2.2 pendidikan,penelitian,pelayanan/pengabdiankepadamasyarakat Dosentetapberpendidikan(terakhir)S2danS3yangbidang 4.3.1.1 keahliannyasesuaidengankompetensiPS DosentetapyangberpendidikanS3yangbidangkeahliannyasesuai 4.3.1.2 dengankompetensiPS Dosentetapyangmemilikijabatanlektorkepaladangurubesar 4.3.1.3 yangbidangkeahliannyasesuaidengankompetensiPS DosenyangmemilikijabatanGuruBesaryangbidangkeahliannya 4.3.1 4.3.1.4 sesuaidengankompetensiPS 4.3.1.5 4.3.1.6.a 4.3 DosenyangmemilikiSertifikatPendidikProfesional NilaiKinerjaDosenratarata(NKDr)dalamaspekpedagogic,social danprofesional 4.3.1.6 Nilaikinerjadosen(NKDs)3.00dalamaspekpedagogic,social 4.3.1.6.b danprofesional Rasiomahasiswaterhadapdosentetapyangbidangkeahliannya sesuaidenganbidangPS 4.3.3 4.3.3 Prosentasejumlahdosenasing Rataratabebandosenpersemester,atauratarataFTE(Fulltime TeachingEquivalent) Rataratabebandosenperminggu Kesesuaiankeahlian(pendidikanterakhir)dosendenganmatakuliah yangdiajarkannya Tingkatkehadirandosentetapdalammengajar Persentasejumldosentidaktetapthdjumlahseluruhdosen(=PDTT) Kesesuaiankeahliandosentidaktetapdgnmatakuliahyangdiampu. Pelaksanaantugas/tingkatkehadirandosentidaktetapdalam mengajar Kegiatantenagaahli/pakarsebagaipembicaradalamseminar/ pelatihan,pembicaratamu,dsb,dariluarPTsendiri(tidak termasukdosentidaktetap). Peningkatankemampuandosentetapmelaluiprogramtugasbelajar dalambidangyangsesuaidenganbidangPS. Kegiatandosentidaktetapyangbidangkeahliannyasesuaidengan PSdalamseminarilmiah/lokakarya/penataran/workshop/pagelaran/ pameran/peragaanyangtidakhanyamelibatkandosenPTsendiri. KegiatandosentetapyangbidangkeahliannyasesuaidenganPS dalamseminarilmiah/lokakarya/penataran/workshop/pagelaran/ pameran/peragaanyangtidakhanyamelibatkandosenPTsendiri Jumlahdosendengandenganpublikasikaryailmiahinternasional (PDKminimal5%) Prestasidalammendapatkanpenghargaanhibah,pendanaanprogram dankegiatanakademikdaritingkatnasionaldaninternasional (sumberinstitusisendiridanluarinstitusi). Reputasidankeluasanjejaringdosendalambidangakademikdan profesi Pustakawandankualifikasinya

4.3.2

4.3.3.1 4.3.3.2

4.3.4 4.3.5 4.4.1 4.4 4.4.2

4.4.2.1 4.4.2.2

4.5.1 4.5.2 4.5.3 4.5

4.5.4 4.5.5 4.5.6 4.5.7

4.6

4.6.1

4.6.1.1

BPM-UII-YOGYAKARTA/2011

Halaman 47 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

4.6.1.2 4.6.1.3 4.6.2 Laboran,teknisi,operator,programer Tenagaadministrasi UpayayangtelahdilakukanPSdalammeningkatkankualifikasidan kompetensitenagakependidikan.

5.KinerjaStandar5:Kurikulum,PembelajarandanSuasanaAkademik Indeks capaian kinerja unit program studi di UII dalam Kurikulum, PembelajarandanSuasanaAkademikbergerakantara2.763.93danrataratanilai capaian kinerja untuk standar 5 sebesar 3.53 (skala 0 4). Nilai tertinggi diraiholehProdiPendidikanDokter(3.93)dannilaiterendahdicapaiolehProdi IlmuKomunikasi(2.76). Indikator kinerja standar 5 yang mendapatkan nilai tertinggi dengan indeks 4.00 adalah Orientasi dan kesesuaian dengan visi dan misi (item 5.1.2) dan Ketersediaan dan jenis prasarana, sarana dan dana yang memungkinkan terciptanya interaksi akademik antara sivitas akademika (item 5.7.2). Sementara indicator kinerjayangmencapainilai3.95adalah (1) (2) (3) Susunan kurikulum yang dinilai adalah urutan yang logis, proporsional, konsistendaristrukturkurikulum(item5.1.3.1) Penyesuaian kurikulum dengan pengembangan Iptek dan kebutuhan pemangku kepentingan(item5.3.2) Ketersediaan panduan pembimbingan TA/Skripsi/ Penelitian/Karya ilmiah, Sosialisasi,dankonsistensipelaksanaannya(item5.6.1)

Sementaraitu,indicatorkinerjastandar5yanghasilcapaiannya<3 (diurutkandarinilaiyangpalingrendahketinggi)adalah: (1) (2) (3) (4) (5) (6) (7) Ratarata waktu penyelesaian penulisan tugas akhir (item 5.6.5) dengan indeks2.48 Prosentase ketersediaan SAP dan course out line mata kuliah (item 5.2.3.2)sebesar2.52 Ratarata banyaknya mahasiswa per dosen Pembimbing Akademik (PA) per semester(item5.5.1)denganindeks2.57 Jumlah ratarata pertemuan pembimbingan per mahasiswa per semester (item5.5.3)denganindeks2.65 Persentaserataratakehadiranmahasiswakuliah/semester(item5.4.5.1) denganindeks2.85 Efektivitaskegiatanperwalian(item5.5.4)denganindeks2.86 Rata2 kehadiran dosen mengajar sesuai standar minimal 90% (item 5.4.4.2)denganindeks2.95

Hasil capaian setiap indicator kinerja dalam pencapaian visi, misi, sasatan danpencapaiannyadilihatsecaralengkappadatable.4.6.
Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5 5.1 5.2 5.1.1 5.1.2 5.1.3 5.2.1 5.2.2 ProgramStudi 5.1.1.1 5.1.1.2 5.1.1.3 5.1.3.1 5.2.1.1 5.2.1.2 Manajemen 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 Akuntansi 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 IlmuEkonomi 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 PAI 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 HukumIslam 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 EkonomiIslam 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 4.00 4.00 Statistika 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00

Fakultas FE

1 2 3 4 5 6 7 8 9

FH FIAI

FK FMIPA

BPM-UII-YOGYAKARTA/2011

Halaman 48 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas 10 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 5.1 5.2 5.1.1 5.1.2 5.1.3 5.2.1 5.2.2 5.1.1.1 5.1.1.2 5.1.1.3 5.1.3.1 5.2.1.1 5.2.1.2 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 1.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 0.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 3.00 1.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.90 3.76 3.90 4.00 3.95 3.90 3.52 3.75

FPSB FTI

FTSP

IndeksKinerja/Elemen

Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5(Lanjutan) 5.2 5.3 Fakultas ProgramStudi 5.2.3 5.2.4 5.3.1 5.3.2 5.2.3.1 5.2.3.2 5.2.3.3 5.2.3.4 5.3.1.1 5.3.1.2 1 Manajemen 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 FE 2 Akuntansi 3.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 2.00 3.00 4.00 3.00 4.00 3.00 4.00 3.00 FH 4 IlmuHukum 4.00 0.00 4.00 4.00 4.00 4.00 4.00 4.00 5 PAI 4.00 3.00 2.00 4.00 4.00 4.00 4.00 4.00 FIAI 6 HukumIslam 3.00 4.00 2.00 4.00 2.00 4.00 2.00 4.00 7 EkonomiIslam 4.00 4.00 3.00 4.00 4.00 4.00 2.00 4.00 FK 8 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 9 Statistika 4.00 0.00 4.00 4.00 4.00 4.00 4.00 4.00 FMIPA 10 IlmuKimia 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 11 Farmasi 4.00 1.00 4.00 4.00 2.00 4.00 4.00 4.00 12 Psikologi 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 FPSB 13 I.Komunikasi 3.00 0.00 3.00 2.00 0.00 4.00 4.00 4.00 14 T.Mesin 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 15 T.Elektro 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 FTI 16 T.Kimia 4.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 17 T.Industri 2.00 3.00 4.00 4.00 4.00 3.00 4.00 4.00 18 T.Informatika 3.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 19 T.Arsitektur 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 FTSP 20 T.Sipil 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 21 T.Lingkungan 3.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 3.48 2.52 3.71 3.81 3.62 3.90 3.81 3.95 Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5(Lanjutan) Fakultas FE 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 ProgramStudi Manajemen Akuntansi IlmuEkonomi IlmuHukum PAI HukumIslam EkonomiIslam Pend.Dokter Statistika IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia 5.4 5.4.1 5.4.2 5.4.3 5.4.4 5.4.5 5.4.1.1 5.4.1.2 5.4.4.1 5.4.4.2 5.4.5.1 5.4.5.2 4.00 4.00 4.00 4.00 3.00 3.00 3.00 3.00 4.00 4.00 4.00 4.00 3.00 3.00 3.00 4.00 4.00 4.00 3.00 4.00 3.00 3.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 2.00 4.00 2.00 4.00 4.00 3.00 4.00 4.00 4.00 3.00 2.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 2.00 2.00 3.00 3.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 3.00 0.00 0.00 0.00 0.00 0.00 4.00 4.00 3.00 4.00 3.00 3.00 3.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 3.00 1.00 3.00 3.00

FH FIAI

FK FMIPA

FPSB FTI

BPM-UII-YOGYAKARTA/2011

Halaman 49 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas 17 18 19 20 21 ProgramStudi T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 5.4 5.4.1 5.4.2 5.4.3 5.4.4 5.4.5 5.4.1.1 5.4.1.2 5.4.4.1 5.4.4.2 5.4.5.1 5.4.5.2 4.00 3.00 4.00 4.00 3.00 1.00 2.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 2.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 1.00 1.00 2.00 2.00 4.00 4.00 4.00 4.00 3.00 1.00 3.00 3.00 3.90 3.86 3.71 3.57 3.15 2.95 2.85 3.00

FTSP

IndeksKinerja/Elemen

Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5(Lanjutan) 5.4 5.5 Fakultas ProgramStudi 5.4.6 5.4.7 5.5.1 5.5.2 5.5.3 5.5.4 5.4.6.1 5.4.6.2 1 Manajemen 4.00 4.00 4.00 3.00 2.00 2.00 2.00 FE 2 Akuntansi 4.00 4.00 4.00 3.00 4.00 4.00 3.00 3 IlmuEkonomi 4.00 4.00 4.00 4.00 3.00 3.00 3.00 FH 4 IlmuHukum 4.00 4.00 4.00 1.00 4.00 4.00 4.00 5 PAI 1.00 2.00 4.00 4.00 1.00 1.00 2.00 FIAI 6 HukumIslam 1.00 2.00 4.00 4.00 2.00 4.00 3.00 7 EkonomiIslam 1.00 4.00 4.00 2.00 3.00 4.00 4.00 FK 8 Pend.Dokter 4.00 4.00 4.00 3.00 4.00 4.00 4.00 9 Statistika 4.00 2.00 4.00 3.00 3.00 4.00 3.00 FMIPA 10 IlmuKimia 4.00 2.00 4.00 4.00 3.00 2.00 2.00 11 Farmasi 4.00 4.00 4.00 0.00 4.00 4.00 4.00 12 Psikologi 4.00 4.00 0.00 1.00 2.00 2.00 2.00 FPSB 13 I.Komunikasi 3.00 4.00 0.00 4.00 3.00 4.00 14 T.Mesin 1.00 4.00 1.00 4.00 1.00 2.00 15 T.Elektro 4.00 2.00 4.00 3.00 3.00 4.00 4.00 FTI 16 T.Kimia 4.00 3.00 4.00 4.00 2.00 1.00 17 T.Industri 4.00 2.00 3.00 2.00 4.00 0.00 3.00 18 T.Informatika 4.00 3.00 3.00 0.00 4.00 3.00 3.00 19 T.Arsitektur 4.00 4.00 4.00 3.00 4.00 2.00 2.00 FTSP 20 T.Sipil 3.00 4.00 4.00 3.00 0.00 0.00 1.00 21 T.Lingkungan 4.00 3.00 4.00 2.00 4.00 3.00 4.00 IndeksKinerja/Elemen 3.33 3.25 3.52 2.57 3.05 2.65 2.86 Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5(lanjutan) 5.6 Fakultas ProgramStudi 5.6.1 5.6.2 5.6.3 5.6.4. 5.6.5 5.6.6 5.6.7 1 Manajemen 4.00 3.00 4.00 4.00 3.00 4.00 4.00 FE 2 Akuntansi 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 4.00 4.00 3.00 3.00 4.00 FH 4 IlmuHukum 4.00 3.00 4.00 4.00 3.00 4.00 4.00 5 PAI 4.00 4.00 4.00 4.00 3.00 3.00 4.00 FIAI 6 HukumIslam 4.00 4.00 4.00 4.00 3.00 3.00 4.00 7 EkonomiIslam 4.00 3.00 4.00 4.00 3.00 4.00 4.00 FK 8 Pend.Dokter 4.00 3.00 4.00 4.00 3.00 4.00 4.00 9 Statistika 4.00 4.00 4.00 4.00 4.00 4.00 4.00 FMIPA 10 IlmuKimia 4.00 4.00 4.00 4.00 2.00 4.00 3.00 11 Farmasi 3.00 4.00 2.00 4.00 2.00 4.00 4.00 12 Psikologi 4.00 1.00 3.00 4.00 0.00 3.00 2.00 FPSB 13 I.Komunikasi 4.00 2.00 4.00 2.00 3.00 3.00 4.00 14 T.Mesin 4.00 3.00 4.00 2.00 1.00 4.00 4.00 15 T.Elektro 4.00 2.00 4.00 4.00 1.00 4.00 4.00 FTI 16 T.Kimia 4.00 4.00 4.00 3.00 1.00 3.00 4.00 17 T.Industri 4.00 1.00 4.00 4.00 2.00 4.00 3.00 18 T.Informatika 4.00 1.00 3.00 4.00 3.00 4.00 3.00 19 T.Arsitektur 4.00 4.00 4.00 3.00 3.00 4.00 4.00 FTSP 20 T.Sipil 4.00 4.00 4.00 4.00 1.00 4.00 4.00 21 T.Lingkungan 4.00 3.00 4.00 4.00 4.00 4.00 4.00 IndeksKinerja/Elemen 3.95 3.05 3.81 3.71 2.48 3.71 3.76

Tabel4.6.HasilCapaianKinerjaProdiPeriode20102011Standar5(Lanjutan)

BPM-UII-YOGYAKARTA/2011

Halaman 50 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FE FH FIAI FK FMIPA FPSB 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi Manajemen Akuntansi IlmuEkonomi IlmuHukum PAI HukumIslam EkonomiIslam Pend.Dokter Statistika IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 5.7.1 4.00 4.00 4.00 4.00 4.00 1.00 4.00 4.00 4.00 1.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 3.52 5.7.2 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 5.7 5.7.3 4.00 4.00 4.00 4.00 2.00 2.00 4.00 4.00 4.00 2.00 2.00 3.00 4.00 1.00 4.00 1.00 3.00 4.00 4.00 4.00 4.00 3.24 5.7.4 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 3.81 5.7.5 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 3.00 1.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.62 Standar5 3.70 3.77 3.53 3.76 3.37 3.35 3.67 3.93 3.72 3.37 3.60 3.12 2.76 3.36 3.79 3.40 3.14 3.47 3.77 3.26 3.67 3.50

FTI

FTSP

IndeksKinerja/Elemen Keterangan:IndicatorKinerjaStandar5 5.1.1.1 5.1.1 5.1 5.1.2 5.1.3 5.2.1 5.2.2 5.2 5.2.3 5.1.1.2 5.1.1.3 5.1.3.1 5.2.1.1 5.2.1.2 5.2.3.1 5.2.3.2 5.2.3.3 5.2.3.4 5.2.4 5.3.1 5.3 5.3.2 5.3.1.1 5.3.1.2 5.4.1.1 5.4.1 5.4.1.2 5.4.2 5.4.3 5.4 5.4.4 5.4.4.1 5.4.4.2 5.4.5 5.4.6 5.4.5.1 5.4.5.2 5.4.6.1

Ketersediaannaskahkurikulum Kurikulummemilikistandarkometensilulusanyangterdiridaristandar kompetensiutama,pendukungdankompetensilainnya Prosespenyusunankurikulumdilakukansecarakomprehensif Orientasidankesesuaiandenganvisidanmisi Susunankurikulumyangdinilaiadalahurutanyanglogis,proporsional, konsistendaristrukturkurikulum Ketersediaandeskripsidansilabustiapmatakuliah Ketersediaankmptensitiapmatakuliah Persentasematakuliahyangdalampenentuannilaiakhirnyamemberikan bobotpadatugas(PRataumakalah)20% KetersedaandokumenSAPdanformatnya ProsesntaseketersediaanSAPdancourseoutlinematakuliah Prosentasematakuliahpraktikumyangtersediamodulnya Prosentasepelaksanaanmodulpraktikum Ketersedaiaanmatakuliahpilihandanfleksibilitasnya Evaluasitahunandanprosentasehasilevaluasi Pihakyangmelakukandandilibatkandalamevaluasikurikulum PenyesuaiankurikulumdenganpengembanganIptekdankebutuhanpemangku kepentingan Ketersediaanmekanismemonitoringdanevaluasiperkuliahan(kehadiran dosenmahasiswa,penyusuananmaterikuliahsertapenilaianhasilbelajar) Pelaksanaanmonitoringdanevaluasiperkuliahan(kehadirandosendan mahasiswa,penyusuananmaterikuliahsertapenilaianhasilbelajar) Strategi/pendekatanpembelajaranyangdilaksanakandankonsistensi implementasinya Strategipenilaianhasilpembelajaranyangdilaksanakandankonsistensi implementasisertasyaratkelulusannya Persentaserataratakehadirandosenmengajar/semester Rata2kehadirandosenmengajarsesuaistandarminimal90% Persentaserataratakehadiranmahasiswakuliah/semester Rataratakehadiranmahasiswasesuaistandarminimal75% Prosespenyusunanmaterikuliah

BPM-UII-YOGYAKARTA/2011

Halaman 51 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

5.4.6.2 5.4.7 5.5.1 5.5 5.5.2 5.5.3 5.5.4 5.6.1 5.6.2 5.6.3 5.6 Ketersediaanhandout/materiperkuliahan Mutusoalujian RataratabanyaknyamahasiswaperdosenPembimbingAkademik(PA)per semester Pelaksanaankegiatanpembimbinganakademik Jumlahrataratapertemuanpembimbinganpermahasiswapersemester(=PP) Efektivitaskegiatanperwalian KetersediaanpanduanpembimbinganTA/Skripsi/Penelitian/Karyailmiah, Sosialisasi,dankonsistensipelaksanaannya Rataratamahasiswaperdosenpembimbingtugasakhir Rataratajumlahpertemuan/pembimbinganpenyelesaianTA Kualifikasiakademikdosenpembimbingtugasakhir Rataratawaktupenyelesaianpenulisantugasakhir Upayaperbaikansystempembelajaranyangtelahdilakukanberkaitandengan materikuliah,metodepembelajaran,penggunaanteknologipembelajarandan caracaraevaluasi Upayaperbaikansistempembelajaranyangtelahdilakukanberkaitandengan pengenalanmahasiswaterhadapduniakerja Kebijakantentangsuasanaakademik(otonomikeilmuan,kebebasanakademik, kebebasanmimbarakademik). Ketersediaandanjenisprasarana,saranadandanayangmemungkinkan terciptanyainteraksiakademikantarasivitasakademika Programdankegiatanakademikuntukmenciptakansuasanaakademik(seminar, simposium,lokakarya,bedahbuku,penelitianbersamadll). Interaksiakademikantaradosenmahasiswa Pengembanganperilakukecendekiawanan/profesional

5.6.4. 5.6.5 5.6.6 5.6.7 5.7.1 5.7.2

5.7

5.7.3 5.7.4 5.7.5

6.KinerjaStandar6:Pembiayaan,SaranadanPrasaranasertaSistemInformasi Indeks capaian kinerja unit program studi di UII dalam Pembiayaan, Sarana dan Prasarana serta Sistem Informasi bergerak antara 2.72 4.00 dan ratarata nilaicapaiankinerjauntukstandar6sebesar3.56(skala04).Nilaitertinggi diraiholehProdiPendidikanDokter(4.00)dannilaiterendahdicapaiolehProdi PendidikanAgamaIslam(2.72). Indikator kinerja Standar 6 yang mendapatkan dengan nilai tertinggi sebesar3.95adalah: (1) Bahanpustakaberupabukuteks(item6.4.1.a1) (2) Jumlahjudulbukuteks(item6.4.1.a2) (3) Prasarana lain yang menunjang (misalnya tempat olah raga, ruang bersama,ruanghimpunanmahasiswa,poliklinik)(item6.3.3) (4) Bahan pustaka berupa disertasi/tesis/ skripsi/ tugas akhir (item 6.4.1.b) Nilai paling rendah adalah kinerja untuk ketersediaan bahan pustaka berupa prosiding seminar dalam tiga tahun terakhir (item 6.4.1.e) sebesar 2.90. Hasil capaian setiap indicator kinerja dalam pencapaian visi, misi, sasatan dan pencapaiannyadilihatsecaralengkappadatable.4.7.
Tabel4.7.HasilCapaianKinerjaProdiPeriode20102011Standar6

BPM-UII-YOGYAKARTA/2011

Halaman 52 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FE FH FIAI FK FMIPA FPSB 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi Manajemen Akuntansi IlmuEkonomi IlmuHukum PAI HukumIslam EkonomiIslam Pend.Dokter Statistika IlmuKimia Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 6.1 6.1.1 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.81 6.2.1 4.00 4.00 4.00 4.00 2.00 1.00 2.00 4.00 4.00 3.00 4.00 4.00 4.00 2.00 2.00 2.00 4.00 4.00 4.00 4.00 4.00 3.33 6.2 6.2.2 6.2.3 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 0.00 1.00 0.00 0.00 0.00 2.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 4.00 1.00 4.00 4.00 3.00 4.00 4.00 2.00 2.00 4.00 4.00 4.00 4.00 4.00 4.00 2.00 2.00 4.00 4.00 3.24 3.14 6.2.4 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 0.00 1.00 4.00 1.00 3.00 4.00 3.00 4.00 3.00 4.00 2.00 4.00 3.24 6.3 6.3.1 6.3.2 6.3.3 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 3.71 3.86 3.95

FTI

FTSP

IndeksKinerja/Elemen

Tabel4.7.HasilCapaianKinerjaProdiPeriode20102011Standar6(Lanjutan) 6.4 Fakultas ProgramStudi 6.4.1. 6.4.1.a1 6.4.1.a2 6.4.1.b 6.4.1.c 6.4.1.d 6.4.1.e 1 Manajemen 4.00 4.00 4.00 4.00 4.00 4.00 FE 2 Akuntansi 4.00 4.00 4.00 4.00 4.00 4.00 3 IlmuEkonomi 4.00 4.00 4.00 4.00 4.00 4.00 FH 4 IlmuHukum 4.00 4.00 4.00 4.00 4.00 4.00 5 PAI 4.00 4.00 4.00 2.00 3.00 0.00 FIAI 6 HukumIslam 4.00 4.00 4.00 4.00 4.00 2.00 7 EkonomiIslam 4.00 4.00 4.00 4.00 4.00 4.00 FK 8 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 4.00 9 Statistika 4.00 4.00 4.00 4.00 3.00 4.00 FMIPA 10 IlmuKimia 4.00 4.00 4.00 3.00 4.00 4.00 11 Farmasi 4.00 4.00 4.00 4.00 4.00 4.00 12 Psikologi 4.00 4.00 4.00 4.00 4.00 4.00 FPSB 13 I.Komunikasi 4.00 4.00 4.00 1.00 1.00 3.00 14 T.Mesin 3.00 4.00 4.00 2.00 0.00 2.00 15 T.Elektro 4.00 4.00 4.00 4.00 2.00 1.00 FTI 16 T.Kimia 4.00 4.00 4.00 2.00 2.00 2.00 17 T.Industri 4.00 4.00 4.00 3.00 4.00 3.00 18 T.Informatika 4.00 4.00 4.00 2.00 2.00 2.00 19 T.Arsitektur 4.00 4.00 4.00 4.00 4.00 4.00 FTSP 20 T.Sipil 4.00 4.00 3.00 3.00 1.00 21 T.Lingkungan 4.00 4.00 4.00 4.00 4.00 1.00 IndeksKinerja/Elemen 3.95 4.00 3.95 3.35 3.24 2.90 Tabel4.7.HasilCapaianKinerjaProdiPeriode20102011Standar6(Lanjutan) 6.4 6.5 Fakultas ProgramStudi Standar6 6.4.2 6.4.3 6.5.1 6.5.2 1 Manajemen 4.00 4.00 4.00 4.00 3.94 FE 2 Akuntansi 4.00 4.00 4.00 3.00 3.94 3 IlmuEkonomi 4.00 4.00 4.00 3.00 3.94 FH 4 IlmuHukum 4.00 4.00 4.00 4.00 3.94 5 PAI 2.00 4.00 2.00 1.00 2.72 FIAI 6 HukumIslam 4.00 4.00 4.00 4.00 3.28 7 EkonomiIslam 4.00 4.00 4.00 4.00 3.39 FK 8 Pend.Dokter 4.00 4.00 4.00 4.00 4.00 9 Statistika 4.00 3.00 3.00 3.82 FMIPA 10 IlmuKimia 4.00 2.00 4.00 3.41

BPM-UII-YOGYAKARTA/2011

Halaman 53 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas 11 12 13 14 15 16 17 18 19 20 21 ProgramStudi Farmasi Psikologi I.Komunikasi T.Mesin T.Elektro T.Kimia T.Industri T.Informatika T.Arsitektur T.Sipil T.Lingkungan 6.4 6.4.2 6.4.3 3.00 3.00 4.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 1.00 4.00 1.00 4.00 4.00 4.00 4.00 4.00 2.00 4.00 4.00 4.00 3.43 3.81 6.5 6.5.1 6.5.2 4.00 4.00 4.00 2.00 1.00 4.00 4.00 4.00 4.00 3.00 3.00 4.00 3.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.71 3.44 Standar6 3.65 3.94 2.89 3.22 3.61 3.00 3.56 3.61 3.89 3.18 3.83 3.56

FPSB

FTI

FTSP

IndeksKinerja/Elemen

Keterangan:IndicatorKinerjaStandar6 Keterlibatanprogramstudidalamperencanaantargetkinerja,kegiatan, 6.1 6.1.1 alokasidanpengelolaandana 6.2.1 6.2.2 6.2 6.2.3 6.2.4 6.3.1 6.3 6.3.2 6.3.3 6.4.1.a1 6.4.1.a2 6.4.1.b 6.4.1. 6.4 6.4.2 6.4.3 6.5.1 6.5 6.5.2 6.4.1.c 6.4.1.d 6.4.1.e Besarnyadanayangdikelolaprodidalamsetahun Danapenelitiandalamtigatahunterakhir Danayangdiperolehdalamrangkapelayanan/pengabdiankepadamasyarakat dalamtigatahunterakhir Kegiatandakwahislamiyahyangdikelolaprodi Luasruangkerjadosen PrasaranayangdipergunakanPSdalamprosespembelajaran(kecualiruang dosen) Prasaranalainyangmenunjang(misalnyatempatolahraga,ruangbersama, ruanghimpunanmahasiswa,poliklinik) Bahanpustakaberupabukuteks. Jumlahjudulbukuteks Bahanpustakaberupadisertasi/tesis/skripsi/tugasakhir BahanpustakaberupajurnalilmiahterakreditasiDikti Bahanpustakaberupajurnalilmiahinternasional Bahanpustakaberupaprosidingseminardalamtigatahunterakhir AkseskeperpustakaandiluarPTatausumberpustakalainnya Ketersediaan,aksesdanpendayagunaansaranautamadilab(tempat praktikum,bengkel,studio,ruangsimulasi,rumahsakit,puskesmas/balai kesehatan,greenhouse,lahanuntukpertanian,dansejenisnya) SisteminformasidanfasilitasyangdigunakanPSdalamprosespembelajaran (hardware,software,elearning,perpustakaan,dll.) Aksesibilitasdatadalamsisteminformasi

7.KinerjaStandar7:Pelayanan/pengabdianKepadaMasyarakatdanKerjasama. Indeks capaian kinerja unit program studi di UII dalam Pelayanan/pengabdian Kepada Masyarakat dan Kerjasama bergerak antara 1.25 3.50 dan ratarata nilai capaian kinerja untuk standar 7 sebesar 2.65 (skala 0 4). Nilai tertinggi diraih oleh Prodi Farmasi (3.50) dan nilai terendah dicapai oleh ProdiTeknikKimia(1.25). Indikator kinerja standar 7 yang mendapatkan nilai tertinggi sebesar 3.65 adalah Kegiatan kerjasama dengan instansi di dalam negeri dalam tiga tahun terakhir (item 7.3.1) dan nilai terendah sebesar 1.67 adalah Karyakarya PS/institusi yang telah memperoleh perlindungan Hak atas Kekayaan Intelektual (HaKI)dalamtigatahunterakhir(item7.1.4)denganindekscapaiankinerja. Hasil capaian setiap indicator kinerja dalam Pelayanan/pengabdian Kepada MasyarakatdanKerjasamadapatdilihatsecaralengkappadatable.4.8.
BPM-UII-YOGYAKARTA/2011 Halaman 54 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Fakultas FE FH FIAI FK FMIPA FPSB 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Tabel4.8.HasilCapaianKinerjaProdiPeriode20102011Standar7 7.1 7.2 7.3 ProgramStudi 7.1.1 7.1.2 7.1.3 7.1.4 7.2.1 7.2.2 7.3.1 7.3.2 Manajemen 3.00 4.00 4.00 2.00 3.00 3.00 4.00 4.00 Akuntansi 3.00 4.00 3.00 1.00 4.00 4.00 4.00 4.00 IlmuEkonomi 3.00 3.00 3.00 1.00 3.00 3.00 4.00 3.00 IlmuHukum 1.00 0.00 4.00 4.00 4.00 4.00 4.00 4.00 PAI 1.00 0.00 1.00 1.00 1.00 2.00 4.00 2.00 HukumIslam 1.00 0.00 4.00 1.00 4.00 4.00 4.00 2.00 EkonomiIslam 2.00 1.00 2.00 1.00 1.00 2.00 4.00 3.00 Pend.Dokter 2.00 1.00 2.00 1.00 3.00 4.00 4.00 2.00 Statistika 4.00 2.00 4.00 2.00 4.00 3.00 4.00 4.00 IlmuKimia 4.00 4.00 4.00 2.00 4.00 3.00 3.00 3.00 Farmasi 4.00 4.00 2.00 4.00 3.00 3.00 4.00 4.00 Psikologi 3.00 1.00 1.00 1.00 3.00 2.00 4.00 2.00 I.Komunikasi 0.00 0.00 1.00 4.00 4.00 1.00 T.Mesin 3.00 2.00 3.00 3.00 2.00 4.00 2.00 3.00 T.Elektro 4.00 1.00 4.00 2.00 4.00 4.00 4.00 2.00 T.Kimia 1.00 1.00 1.00 1.00 1.00 2.00 2.00 1.00 T.Industri 2.00 4.00 2.00 1.00 3.00 1.00 4.00 1.00 T.Informatika 2.00 1.00 4.00 1.00 4.00 3.00 4.00 4.00 T.Arsitektur 2.00 2.00 3.00 1.00 3.00 4.00 2.00 2.00 T.Sipil 2.00 3.00 4.00 0.00 4.00 3.00 T.Lingkungan 3.00 3.00 4.00 1.00 4.00 2.40 1.90 2.85 1.67 3.05 2.95 3.65 2.76 Standar7 3.38 3.38 2.88 3.13 1.50 2.50 2.00 2.65 3.38 3.38 3.50 2.13 1.67 2.75 3.13 1.25 2.25 2.88 2.38 2.67 3.00 2.65

FTI

FTSP

IndeksKinerja/Elemen

Keterangan:IndicatorKinerjaStandar7 JumlahpenelitianyangsesuaidenganbidangkeilmuanPS,yangdilakukanolehdosentetap 7.1.1 yangbidangkeahliannyasamadenganPSpertahun,selama3tahun 7.1.2 Keterlibatanmahasiswayangmelakukantugasakhirdalampenelitiandosen 7.1 Jumlahartikelilmiahyangdihasilkanolehdosentetapyangbidangkeahliannyasamadengan 7.1.3 PSpertahun,selama3tahun KaryakaryaPS/institusiyangtelahmemperolehperlindunganHakatasKekayaanIntelektual 7.1.4 (HaKI)dalamtigatahunterakhir Jumlahkegiatanpelayanan/pengabdiankepadamasyarakat(PkM)yangdilakukanolehdosentetap 7.2.1 yangbidangkeahliannyasamadenganPSselamatigatahun. 7.2 7.2.2 7.3 7.3.1 7.3.2 Keterlibatanmahasiswadalamkegiatanpelayanan/pengabdiankepadamasyarakat Kegiatankerjasamadenganinstansididalamnegeridalamtigatahunterakhir Kegiatankerjasamadenganinstansidiluarnegeridalamtigatahunterakhir.

Khusus untuk Program Studi International Program FE, maka penilaian kinerja prodi tidak menggunakan standar 7 Borang Akreditasi tetapi masih menggunakan standar kinerja unit. Hasilnya bisa dilihat pada table 4.9 di bawah ini:
Tabel4.9.HasilCapaianKinerja2010ProdiInternationalProgramFE No IndikatorKinerja IndeksKinerja 2.50 4.00 2.00 2.00 0.00 0.00 1.75

1 PencapaianSasaranMutuProdi 2 KegiatanProdi 3 Pencapaianprogram/rencanakerjarutin 4 Pencapaianprogram/rencanakerjapengembanganunit 5 EvaluasiDiri 6 Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) 7 PengendaliandanevaluasiKeluhanPelanggan SkorRatarata

III.TemuanDeskriptifdanAnalisisPenyebabdanRencanaTindakLanjut.
BPM-UII-YOGYAKARTA/2011 Halaman 55 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

1. FakultasEkonomi: 1.1. ProgramStudiManajemen


Tabel4.10.TemuanDeskriptifKinerjaPeriode20102011ProdiManajemen Temuan AnalisisPenyebab RencanaTindakLanjut No. Standar Deskripsi 1 SAPdenganformatstandardlama. Menungguprosesperubahan Segeradisesuaikan Standarformatbarumasihdalam kurikulum Akandilakukan bentuksoftfile(belumdiprint) perbaikansetelah perubahankurikulum

1.2. ProgramStudiAkuntansi
Tabel4.11.TemuanDeskriptifKinerjaPeriode20102011ProdiAkuntansi Temuan AnalisisPenyebab RencanaTindakLanjut No. Standar Deskripsi 1 SAPbelumsesuaidengan Padaperiodekepengurusan Akandiperbaikibersama standardbukuBPA inibelumada/menerimadari denganimplementasiKurikulum BPA barutahun2011/2012 2 Dari40matakuliahhanya Tidaksemuadosen MengaktifkangugusMKuntuk tersedia24SAPdan16 menyerahkanSAP menyusunSAPdanmembahas matakuliahyangtidak materi tersediaSAP

1.3. ProgramStudiIlmuEkonomi
Tabel4.12.TemuanDeskriptifKinerjaPeriode20102011ProdiIlmuEkonomi Temuan No. Standar Deskripsi 1 35MK,SAPnyabelummenggunakan standardSAPdariBPMdanbelum diotorisasi 2 VisiMisidanTujuanbelumdibuat tersendiri,masukdalamrenstra, belumdiotorisasi SasaranMutuProdibelumdibuat tersensiridanbelumdiotorisasi Tabel4.13.TemuanDeskriptifKinerjaPeriode20102011ProdiInternationalProgramFE Temuan No. Deskripsi Formatlegalitasbukupanduan 1 akademikbelumdilakukan AnalisisPenyebab Belummengetahuicara pemberianformatlegalitas padabukupanduanakademik RencanaTindakLanjut Akandiberilegalitaspadabuku panduanakademikuntuktahun akademikmendatang Setiappenerbitanatauperubahan bukupanduanakademikakanselalu diberikodelegalitas AkandipelajariformatSAPsesuai denganformulirFMUIIAMFSM07 .08. AkandisosialisasikanformatSAP padadosendosendilingkunganIPFE SecarabertahapformatSAP dilingkunganIPFEakandisesuaikan denganformulirFMUIIAMFSM07.08 Akandilakukankoordinasiyangbaik antarapengelolaIPdenganjurusan jurusandalampemeriksaanpresensi kehadirandosendanmahasiswa AnalisisPenyebab Secarainstitusionalmemang barudilakukanpenyesuaian standardSAPuntuk7mata kuliahintisaja RencanaTindakLanjut Dibuatsatgasuntuk standarisasiSAPyang dikoordinasioleh prodi Dilakukantinjauan secaraberskala(awal &akhir)semester Sudahdisusun/dibuat visi,misi&tujuan dalamdokumen tersendiridansudah diotorisasi Sudahdilakukan perbaikandokumentasi

Visi,Misi,danTujuanbaru sajadirevisi

BeusajarevisiSasaranMutu menyesuaikandenganSasaran MutuUniversitasyangbaru

SemuadokumenSatuanAcara Perkuliahan(SAP)belumsesuai denganformatformulirFMUII AMFSM07.08

BelummemahamiformatSAP sesuaidenganformulirFM UIIAMFSM07.08.

Sebagianbesarpresensi kehadirandosendanmahasiswa kuliahbelumdiperiksaoleh jurusan

Belumadakoordinasiyang baikantarastaf administrasiakademikdan jurusanjurusandalam

BPM-UII-YOGYAKARTA/2011

Halaman 56 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi AnalisisPenyebab pemeriksaanpresensi kehadirandosendan mahasiswakuliahsetelah selesaikuliah RencanaTindakLanjut kuliah,setelahselesaikegiatan perkuliahan. SecaraperiodikpengelolaIP, melaluistafadministrasiakademik akanmelakukanmonitoringdan pemeriksaanterhadappresensi kehadirandosendanmahasiswa kuliah. Akandilakukankoordinasiyang antarapengelolaIPdenganstaf administrasiakademikdalam melakukanpengukuranterhadap rekapitulasiprosentasekehadiran mahasiswakuliahmenjelangakhir semester. Setiapmenjelangakhirsemester pengelolaIPakanmelakukan pengecekanpengukuranterhadap rekapitulasiprosentasekehadiran mahasiswakuliah. Menginformasikanminimalkehadiran dosenmenjelangmidsemesterdan ujianakhirsemester Selalumengingatkanbaiklisan maupunsecaratertulishakdan kewajibanmengajardosen

Belumdilakukanpengukuran terhadaprekapitulasiprosentase kehadiranmahasiswakuliah

Belummengetahuiadanya informasikeharusandalam melakukanpengukuran terhadaprekapitulasi prosentasekehadiran mahasiswakuliah

Dari42kelasyangditawarkan, terdapat60%kelas/dosen,baik untuksemestergenap2009/2010 maupunsemesterganjil 2010/2011yangkehadiran mengajarnyakurangdaristandar yangditetapkan(90%dosen hadirmengajar). Sebagianbesarketersediaansoal ujian,baikuntuksemestergenap 2009/2010maupunsemester ganjil2010/2011tidaktepat waktu,sesuaidenganstandar unit(tersedia4hari) Prosentasemahasiswaper angkatanyangmemilikiIPS>3 untukprogramEPangkatan2007 belumtercapaisesuaistandar (IPS>3,minimal70%)

Beberapadosenmempunyai bebanmengajardanbeban pekerjaansehubungandengan jabatanstrukturalyang terlalubanyak

Terlaludekatnyaantara jadwalujianberlangsung denganberakhirnya perkuliahansertabanyaknya dosenfakultasekonomiyang mempunyaiaktivitasyang tinggidiluarmengajar InternasionalProgramhanya mempunyaimahasiswaprogram studiIlmuEkonomidibawah 10mahasiswayangmempunyai sebagianbesarmempunyai kualitasyangtidak memuaskan.

Belumdilakukanpengukuran terhadaptepatwaktudanlama skripsiuntukmahasiswa perangkatan.

Belumdilakukanrekapitulasi terhadapmahasiswapesertadan yanglulusujianpendadaranper periode/semester

10

NilaiKinerjaDosen(NKD)dari

Koordinasidenganbagianakademik denganterusmengirimkansurat permohonansoaldisertaijadwal ujiandosenyangbersangkutan Dipertemuanawalperkuliahanterus mengingatkanuntuktepatwaktudalam mengumpulkansoal Terusmemberikanmotivasidan pemantauanterhadapmahasiswa terutamamahasiswayangmempunyai prestasiakademikyangtidak memuaskan Menyediakankonsultasibaikakademik maupunnonakademikyangdpat menunjangprestasiakademik mahasiswa Belumdilakukankoordinasi Dilakukankoordinasiyangbaik yangbaikantarapengelola antarapengelolaIPdenganstaf IPdenganstafadministrasi administrasiakademikdalam akademikdalampendataandan pendataandanpengukuranterhadap tepatwaktuskripsiuntuksetiap pengukuranterhadaptepat mahasiswaperangkatandanlama waktuskripsiuntuk waktuskripsiuntukmahasiswaper mahasiswaperangkatandan angkatan. lamawaktuskripsiuntuk PengelolaIPdenganberkoordinasi mahasiswaperangkatan. denganstafadministrasiakademik akanmelakukanpengukuranterhadap tepatwaktuskripsiuntuksetiap mahasiswaperangkatandanlama waktuskripsiuntukmahasiswaper angkatanpadsetiapakhirsemester. Belumterkomunikasikannya Dilakukanrekapitulasimahasiswa akankebutuhanrekapitulasi yanglulusujianpendadaranper mahasiswayanglulusujian periode/semester pendadaranper Secaraperiodikdilakukanotorisasi periode/semester ataslaporanrekapitulasimahasiswa yanglulusujianpendadaranper periode/semestersehinggaterjadi pemantauanberkala Banyaknyafactoryang Memberikansurathimbauanpencapaian

BPM-UII-YOGYAKARTA/2011

Halaman 57 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi 30dosenyangsesuaidengan standarhanya20dosen(66.67%) untukSemesterGenap2009/2010. UntukSemesterGenap2010/2011, terdapat15dosen(62.5%)dari 24dosenyangNKDnyasesuai standar(NKD3minimal90%). Belumdilakukanpengukuran terhadaptepatwaktustudi untukmahasiswaperangkatan. AnalisisPenyebab RencanaTindakLanjut mempengaruhidalampenilaian kinerjadosen>3bersamaandengan kenerjadosendikelas pengirimanhasilpenilaiankinerja dosen Memberikanfasilitaspembelianbuku referensiyangdigunakanuntuk kepentinganpengajaranserta memberikaninsentifbantuan pembelianbukuuntukdosenranking1 Belumterkomunikasikannya Bagianakademikdiwajibkanuntuk akankeharusandilakukan melakukanpengukuranterhadaptepat pengukuranterhadaptepat waktustudiuntukmahasiswaper waktustudiuntukmahasiswa angkatan perangkatan. Melaksanakanpemantauanberkala denganmemberikanotorisasiterhadap laporanpengukuranterhadaptepat waktustudiuntukmahasiswaper angkatan. Belumterkomunikasikannya Dilakukanotorisasiatasbukti akanotorisasiterhadap dokumenSasaranMutuUnit buktidokumenSasaranMutu Dilakukanpengecekanberkala Unit otorisasiterhadapbuktidokumen SasaranMutuUnit Belumterkomunikasikannya Belumterkomunikasikannyapengukuran pengukuranterhadapSasaran terhadapSasaranMutuUnit MutuUnit Dilakukanpemantauanpengukuran terhadapSasaranMutuUnit Belummemahamicara AkandibuatProgramKerjaUnit pembuatanProgramKerjayang yangdilengkapidenganjadwal baiksecaradetailyang pelaksanaankegiatanprogramdan disertaidenganwaktu PICnya. pelaksanaandanPICpada AkandisosialisasikanProgram setiapkegiatanprogram Kerjayangditerapkan dilingkunganunit. Akandilakukanpengukurandan evalusiterhadapProgramKerja RutindanPengembangan ProgramProgramKerjaRutindan Pengembanganakanselalu dimonitordandilakukan pengukuran,evaluasidantindak lanjutsesuaidenganpenanggung jawabprogram(PIC)padasetiap saatsesuaidenganjadwal kegiatanprogram. SetiapakhirpriodeProgramKerja RutindanPengembanganakan dilakukanpengukuran,evaluasi dantindaklanjutsesuaidengan penanggungjawabprogram(PIC). Belummemahamipenataandan PengendaliandokumendilingkunganIP pengendaliandokumendengan akandibuatsesuaidenganformat baik,sesuaidenganformat formullirFMUIIAMFSM03.11 DCMpadaformulirFMUIIAM PengendaliandokumendilingkunganIP FSM03.11 akandibuatsesuaidenganformat formullirFMUIIAMFSM03.11 Belumterkomunikasikannya Akandibuatdokumenpengendalian keharusanakandokumentasi terhadapkeluhanpelanggandiunit terhadapkeluhanpelanggan, IPterhadappenanganannyasesuai sehinggasaranataukeluhan denganformulirFMUIIAMFSM keluhanpelangganyang 05.01/R.1 diterimabelumdidokumentasi Akandibuatdokumenpengendalian terhadapkeluhanpelanggandiunit denganbaik. IPterhadappenanganannyasesuai denganformulirFMUIIAMFSM 05.01/R.1 Belummemahamidokumen Akandipelajaridan notulenrapatsesuaidengan disosialisasikanformatnotulen

11

12

13

SasaranMutu(SM)Unitbelum seluruhnyasesuaidenganSasaran MutuUniversitas.Tidakada buktidokumenSasaranMutuUnit yangsudahdiotorisasi. Belumdilakukanpengukuran terhadapSasaranMutuUnit

14

SebagianlaporanProgramKerja Unittersedia,tapibukti dokumenProgramKerjaRutindan PengembanganUnitper periode/tahundanevaluasinya padatahunyangbersangkutan tidaktersedia.

15

Belumdilakukan penataan/pengendalianterhadap dokumenunit,DaftarCatatan Mutu(DCM)unittidaktersedia.

16

Belumtersediadokumen pengendalianterhadapkeluhan pelanggan

17

Dokumennotulenhasilrapatunit belumdibuatsesuaidengan

BPM-UII-YOGYAKARTA/2011

Halaman 58 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi formatformulirFMUIIAMFSM 01.05 AnalisisPenyebab formatformulirFMUIIAM FSM01.05 RencanaTindakLanjut rapatsesuaidenganformulir FMUIIAMFSM01.05diunitIP Akanditerapkanformatnotulen rapatsesuaidenganformulir FMUIIAMFSM01.05diunitIP Setiaphasilrapatdi lingkunganunitIP,format notulenrapatakandibuat sesuaidenganformulirFMUII AMFSM01.05. Akandipelajaristandarstandar pengukuranapasajayangpada RencanaMutuproses pembelajaran Akandilakukanpengukuran terhadaapRencanaMutuproses pembelajaran Secaraperioidikpengukuran RencanaMutuproses pembelajaranakandilakukan setiapakhirsemester

18 Meskisebagiandatasudah tersedia,tapipengukuran pengukuranyangberkaitandengan RencanaMutu(RM)Unitper semesterbelumdilakukan. Belummemahamistandar standarpengukuranapasaja yangharusdiilakukanpada RencanaMutuproses pembelajaran

2. FakultasHukum 2.1. ProgramStudiIlmuHukum


Tabel4.14.TemuanDeskriptifKinerjaPeriode20102011ProdiImuHukum Temuan No. Standar 1 1.1.2.2. Deskripsi Tingkatketercapaiansasaran (mutu)prodi. Kurangdari40% Rasiocalonmahasiswayangikut seleksi:dayatampungbelum dihitung AnalisisPenyebab Jumlahmahasiswaikut seleksidilaksanakanoleh Pusat/Universitas. PenerimaanMahasiswabaru semualangsungdi Universitas Calonmahasiswabaru reguleryanglulusseleksi tidakdptdiaksesoleh prodi. BPMperlu merekomendasikan penetapan penghitungancalon mhsygikutseleksi. Datadikirimkeprodi viaweb RencanaTindakLanjut

3.2.1.1

3.2.1.2

Rasiomahasiswabarureguleryang melakukanregistrasi:calon mahasiswabarureguleryanglulus seleksibelumdiukur Rasiomahasiswabaru:total mahasiswa Totalmhs2010:690 TotalMhs:2526 690/2526=0,27=27% RatarataIndeksPrestasi Kumulatif(IPK)selamatahunyang diauditsebesar2,76 Persentasemahasiswaasingbaru terhadaptotalmahasiswabaru=0 Penghargaanjuaralombailmiah, olahraga,maupunsenibelumAda yangtingkatinternasional Persentasekelulusantepatwaktu (KTW) 270/427=63,25% CapaianNilaikompetensikeUII anlulusanrataratayang meliputikeislaman,kebangsaan, kewirausahaandanbahasainggris

3.2.1.4.

BPMperlumenurunkan jangkawaktunya. Bukan5tahun

3.2.1.5

6 7

3.2.1.6. 3.4.1.

Tldakadamahasiswaasing

3.5.1.1.

3.5.1.3.1

Proditidakdapatmelakukan penilaian KewenanganDPPAIdan DirektoratAkademik

BPM-UII-YOGYAKARTA/2011

Halaman 59 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Temuan No. 10 Standar 3.5.1.3.2 Deskripsi belumbisadiukur CapaiankompetensikeUIIan lulusanyangmeliputikeislaman, kebangsaan,kewirausahaandan bahasainggrisdengannilaibaik belumbisadiukur Kualitaslayanankepadamahasiswa belumbisadiukur Pendapatpengguna(employer) lulusanterhadapkualitasalumni. Profilmasatunggukerjapertama belumdilakukanpengukuran Profilkesesuaianbidangkerja denganbidangstudibelumbisa diketahuisecarapasti AnalisisPenyebab RencanaTindakLanjut

11 12 13

3.6.2 3.7.1.3 3.7.1.4

Proditidakdapatmelakukan penilaian KewenanganDPPAIdan DirektoratAkademik Borang3Abelumdiketahui Borang3Abelumdiketahui

14

3.7.1.5

15

3.8.1.1.

16

4.3.1.4.

17

4.3.1.6.a.

18

4.3.1.6.b.

19

4.4.1

20

4.4.2.2.

21

4.5.3.

22

4.5.7

23 24

4.6.1.1. 5.2.3.2

25

5.4.4.1.

26 27 28

5.4.5.1. 5.4.5.2. 5.5.1

29

5.5.3.

Partisipasialumnidalam mendukungpengembanganakademik programstudibelumdiukur Dosentetapyangmemilikijabatan gurubesaryangbidang keahliannyasesuaidengan kompetensiPS 5/54=9% NilaiKinerjaDosendalamaspek paedogogik,sosialdan profesionaldosendengannilai minimalbaik(3.00)belum diukur NilaiKinerjaDosen3,00(NKDs) dalamaspekpaedagogik,sosial danprofessionalbelumdiukur Persentasejumlahdosentidak FHbanyakmenggunakandosen tetap,terhadapjumlahseluruh TTpraktisihukumkarena dosenmelebihistandar sbgkeunggulanprodi Pelaksanaantugas/tingkat kehadirandosentidaktetapdalam mengajar=86,4% Kegiatandosentidaktetapyang bidangkeahliannyadalamseminar ilmiahdlltidakadadata Reputasidankeluasanjejaring dosendalambidangakademikdan profesibidangilmutingkat internasionalataunasional. 19/54=35% Pustakawandankualifikasinya A=2x3/4=2x3/4=6/4=1,5 ProsentaseketersediaanSAPdan Prodibelummenyusuncourse courseoflinematakuliah= ofline belumada Prosentaserataratakehadiran dosenmengajar: Semganjil20102011=71,45%Sem Genap20092010=90,75% Prosentaserataratakehadiran mahasiswa/semester Rataratakehadiranmahasiswa TidakDiklasifikasikan sesuaistandar75% Rataratabanyaknyamahasiswaper dosenPembimbingAkademik=rata rata40mahasiswa Jumlahrataratapertemuan Pembimbinganakademiktidak pembimbinganAkademikper terukurkrnsistemdan

Belumadanyapersepsiyg samattglulusanmemperoleh pekerjaanygpertama Hasilrekamansecara komprehensifsdhdilakukan dgTracerStudi.Dokumen masihdiUniversitas.Hasil Tracerbelumdiketahui

BPM-UII-YOGYAKARTA/2011

Halaman 60 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Temuan No. Standar Deskripsi mahasiswapersemester=Tidak dinilai Rataratamahasiswaperdosen pembimbingTAdll=4orang Rataratawaktupenyelesaian penulisan:68bulan Keterlibatanprogramstudidalam perencanaantargetkinerja, perencanaankegiatan/kerjadan perencanaan/alokasidan pengelolaandana. Danayangdiperolehdalamrangka pelayanan/pengabdiankepada masyarakatdalamtigatahun terakhirtidakbisadinilai Aksesibilitasdatadalamsistem informasi=tidakdinilai Jumlahpenelitianyangsesuai denganbidangkeilmuanPS,yang dilakukanolehdosentetapyang bidangkeahliannyasamadenganPS pertahun,selama3tahun.=0,83 Keterlibatanmahasiswayang melakukantugasakhirdalam penelitiandosen=0 Jumlahartikelilmiahyang dihasilkanolehdosentetapyang bidangkeahliannya=tidak dinilai AnalisisPenyebab prosedurnyatidakmendukung untukhalitu Programstuditidakdiberi otonomi,tetapidilibatkan dalammelaksanakan perencanaan/alokasidan pengelolaandana. Proditidakmempunyai kewenanganmenentukan standardtarippengabdian masyarakat Belumdiketahuiborang3A RencanaTindakLanjut

30 31 32

5.6.2 5.6.5. 6.1.1

33

6.2.3.

34 35

6.5.2 7.1.1

36

7.1.2

37

7.1.3

Belumadakebijakanyang dilaksanakandiUII Tidakdapatdihitungkarena belumadarumusnya

3. FakultasIlmuAgamaIslam 3.1. ProgramStudiPendidikanAgamaIslam


Tabel4.15.TemuanDeskriptifKinerjaPeriode20102011ProdiPendidikanAgamaIslam Temuan No. Standar Deskripsi 1 VisiMisiProditidak tercetakdalamdokumen khusus,tetapitercetakdi dalambukupedoman AnalisisPenyebab VisiMisiProdiadalah hasildariprumusan pejabatterdahulu, sehinggadokumennya tidakditemukan. RencanaTindakLanjut TindakanPerbaikan: Perludisusunkembalivisidanmisi prodidalamdokumenbaruyang disahkanolehpejabatyang berwenang. TindakanPencegahan: Setiapdokumenpentingharus tersimpandantercatatdenganbaik. TindakanPerbaikan: Rekapterhadap4itemtersebut harussegeradilakukan. TindakanPencegahan: Setiapakhirsemesterprodiharus mengagendakanrekapitulasiterhadap aktivitasmonitoringdanevaluasi pengajaranyangmeliputi4item tersebut.

Monitoringdanevaluasi akademiktidakdirekap dalamformuliryangsudah disediakanBPM,tetapi hanyaberupahasilcetak dariSIMAK.Dokumen dokumenberikuttidak tersedia: 1. Rekapitulasi ketersediaansilabi danSAP 2. Rekapitulasi ketersediaanbahan kuliah 3. Rekapitulasikehadiran dosenmengajar 4. Rekapitulasinilai kinerjadosen Proditidakmengalokasikan

Belumdipahaminyabahwa rekapatas4item tersebutperlu dilakukan.

Ketersediaandanayang mungkintidakmemadai,

TindakanPencegahandanPerbaikan: Danaprodisebaiknyajugaadayang

BPM-UII-YOGYAKARTA/2011

Halaman 61 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi danapenelitiandalam anggaran. AnalisisPenyebab sehinggasemua penelitiandosen didoronguntukdiajukan keDPPM. RencanaTindakLanjut dialokasikanuntukpenelitian, palingtidakuntukmemberikan insentifbagidosenyang mendapatkandanapenelitiandari phakluar.

3.2. ProgramStudiHukumIslam
Tabel4.16.TemuanDeskriptifKinerjaPeriode20102011ProdiHukumIslam Temuan No. Standar Deskripsi 1 Rekapketercapaiansasaran mututidakdilakukan 2 Minatcalonmahasiswauntuk memasukiprodiHukumIslam rendah,ratiocalondan dayatampungkurangdari2. Monitoringdanevaluasi akademiktidakdirekap dalamformuliryangsudah disediakanBPM,tetapi hanyaberupahasilcetak dariSIMAK.Dokumendokumen berikuttidaktersedia: 1. Rekapitulasi ketersediaansilabi danSAP 2. Rekapitulasi ketersediaanbahan kuliah 3. Rekapitulasi kehadirandosen mengajar 4. Rekapitulasinilai kinerjadosen Proditidakmengalokasikan danapenelitiandalam anggaran. AnalisisPenyebab RencanaTindakLanjut Rekapketercapaiandarisetiap itemsasaranmutuharus dilakukan. Perludilakukanpromosiyang lebihgencardengancarayang efektifkepadaorangtua/calon mahasiswa TindakanPerbaikan: Rekapterhadap4itemtersebut harussegeradilakukan. TindakanPencegahan: Setiapakhirsemesterprodi harusmengagendakanrekapitulasi terhadapaktivitasmonitoring danevaluasipengajaranyang meliputi4itemtersebut.

Sosialisasidanpromosi kepadaorangtua/calon mahasiswabelumoptimal Belumdipahaminyabahwa rekapatas4itemtersebut perludilakukan.

Ketersediaandanayang mungkintidakmemadai, sehinggasemuapenelitian dosendidoronguntuk diajukankeDPPM.

TindakanPencegahandan Perbaikan: Danaprodisebaiknyajugaada yangdialokasikanuntuk penelitian,palingtidakuntuk memberikaninsentifbagidosen yangmendapatkandanapenelitian dariphakluar.

3.3. ProgramStudiEkonomiIslam
Tabel4.17.TemuanDeskriptifKinerjaPeriode20102011ProdiEkonomiIslam Temuan No. Standar Deskripsi 1 Minatcalonmahasiswauntuk memasukiprodiEkonomi Islamrendah,ratiocalon dandayatampungkurang dari2. 2 Jumlahcalonmahasiswayang melakukanregistrasikurang dari77.5%. 3 Belumadamahasiswaasing, disisilainsebenarnya ekonomiIslammemiliki keunikanyangmenarikbagi AnalisisPenyebab Sosialisasidanpromosi kepadaorangtua/calon mahasiswabelumoptimal. RencanaTindakLanjut TindakanPerbaikan: Perludilakukanpromosiyang lebihgencardengancarayang efektifkepadaorangtua/calon mahasiswa.

TindakanPerbaikan: Perlumenjalinkerjasama langsungdenganperguruantinggi asingdalamstudentexchange

BPM-UII-YOGYAKARTA/2011

Halaman 62 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi mahasiswaasing. AnalisisPenyebab RencanaTindakLanjut program.Sebenarnyaprodi ekonomiIslamsangatmenarik bagimahasiswaasing. TindakanPerbaikan: Danaprodisebaiknyajugaada yangdialokasikanuntuk penelitian,palingtidakuntuk memberikaninsentifbagidosen yangmendapatkandanapenelitian dariphakluar.

Proditidakmengalokasikan danapenelitiandalam anggaran.

Ketersediaandanayang mungkintidakmemadai, sehinggasemuapenelitian dosendidoronguntuk diajukankeDPPM.

4. FakultasKedokteran 4.1. ProgramStudiPendidikanDokter


Tabel4.18.TemuanDeskriptifKinerjaPeriode20102011PodiPendidikanDokter Temuan AnalisisPenyebab RencanaTindakLanjut No. Standar Deskripsi 1 SasaranMutuProdibelum Belumadakebijakandari TindakanPerbaikan: tercapai,SasaranMutuProdi Sasaranmutuyangtingkat Dekanatuntukdosenasing PendidikanKedokterantercapai danmahasiswaasingyang pencapaiannyarendahakan 72,7%dari100%yang ditingkatkan menyebabkanbelum ditargetkan tercapainyasasaranmutu TindakanPencegahan ProdiPendidikanDokter. Sasaranmutuyangtingkat pencapaiannyarendahakan ditingkatkan 2 Persentasemahasiswaasing Belumadakebijakandari TindakanPerbaikan: terhadapmahasiswabarumasih Akandibuatkebijakanuntuk Dekanatuntukdosenasing rendah0,3%seharusnyalebih merekrutmahasiswaasing danmahasiswaasingyang dari1% menyebabkanbelum TindakanPencegahan tercapainyasasaranmutu Sasaranmutuyangtingkat ProdiPendidikanDokter. pencapaiannyarendahakan ditingkatkan 3 Dosentetapyangberpendidikan Dasentetapmasihmudamuda TindakanPerbaikan: S3yangbidangkeahliannya Akandirencanakanstudi danbelumadaperencanaan sesuaidenganPS20,9% lanjutuntukS3 seharusnyalebihdari40% TindakanPencegahan: Akandilakukanevaluasi setiapsemesteruntukstudi lanjutS3 4 Dosentetapyangmemiliki Dasentetapmasihmudamuda TindakanPerbaikan: jabatanLKdanGByangbidang Akandiprogramkanfasilitas danbelumadaperencanaan keahliannyasesuaidenganPS danmendorongdosenuntuk 9,3%seharusnyalebihdari40% keLKdanGB TindakanPencegahan Akandilakukanevaluasi setiapsemesteruntuk kenaikandosenkeLKdanGB 5 Dosentetapyangmemiliki Dasentetapmasihmudamuda TindakanPerbaikan: jabatanGByangbidang Akandiprogramkanfasilitas danbelumadaperencanaan keahliannyasesuaidenganPS danmendorongdosenuntuk 6,97%seharusnyalebihdari20% keGB TindakanPencegahan Akandilakukanevaluasi setiapsemesteruntuk kenaikandosenkeGB 6 Persentasejumlahdosenasing Belumadaperencanaandan TindakanPerbaikan: 0%,seharusnyalebihdari1% usahauntukdosenasing Akandibuatperencanaandan usahauntukdosenasing

BPM-UII-YOGYAKARTA/2011

Halaman 63 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan Akandilakukanevaluasi setiapsemesteruntukdosen asing TindakanPerbaikan: Akandijadikanpeogram rutin. TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Akanmemintatambahan pustakawandari perpustakaanpusat TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Akandiprogramkanrutin TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Jumlahpenelitiandosen akanditingkatkan TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Akandiprogramkankhusus untukmenaikkanjumlah artikelilmiahdosen TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Akanditingkatkanjumlah penelitiandosen TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat pencapaiannya. TindakanPerbaikan: Akandiperogramkanuntuk menjalinkerjasamadengan instansiluarnegeri TindakanPencegahan Akandilakukanevaluasi setiapsemesterdan dihitungtingkat

Kegiatandosentetapyang bidangkeahliannyasesuai denganPSdalamseminardll. masihbelumtercapai0,523, seharusnyalebihdari2,25

Seminardanpenelitianbelum dijadikanprogramrutin, selamainidijadikanprogram pengembangansehingga perhatiannyakecil.

Kualifikasipustakawanbelum tercapai

Pustakawanyangdirekrut tidakmemenuhikualifikasi

Jumlahpenelitianyangsesuai denganPSselama3tahunbaru tercapaisebesar0,6% seharusnyalebihdari2%

Penelitianbelumdijadikan programrutin,selamaini dijadikanprogram pengembangansehingga perhatiannyakecil.

10

Keterlibatanmahasiswadalam menyelesaikanKTIdalam penelitiandosen4,6% seharunyalebihdari25%

Jumlah penelitian masihsangatrendah

dosen

11

Jumlahartikelilmiahyang Belumadaprogramkhusus dihasilkanolehdosentetap untukmenaikkanartikel yangkeahliannyasamadenganPS ilmiahdosen barutercapaisebesar2,2 seharusnyalebihdari6%

13

KaryakaryaPSyangtelah memperolehHKI3tahunterakhir belumadaseharusnyaduaatau lebih.

BelumadaprogramdariProdi PendidikanDokteruntuk memperolehHKI,penelitian dosenrendah.

14

Kegiatankerjasamadengan Belumadaprogramkhusus instansidiluarnegeridalam3 kerjasamadenganinstansi tahunterakhirbarusatu luarnegeri seharusnyalebihdari3

BPM-UII-YOGYAKARTA/2011

Halaman 64 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut pencapaiannya.

5. FakultasMatematikadanIlmuPengetahuanAlam 5.1. ProdiFarmasi


Tabel4.19TemuanDeskriptifKinerjaPeriode20102011PodiFarmasi Temuan No. Standar Deskripsi 1 Prodibelummemilikiupayauntuk melakukanakreditasiinternasional 2 Upayaprodimemperolehcalon mahasiswaasingmasihminim 3 Persentaselulusantepatwaktu belumtercapai 4 Dosentetapberpendidikanterakhir S2danS3yangkeahliannyasesuai kompetensiprodibelumterpenuhi 5 BelumadadosenS3yangsesuai dengankompetensiprodi 6 Dosentetapyangmemilikijabatan akademiklectorkepalabelum terpenuhi 7 Belumadadosentetapprodiyang memilikijabatangurubesar 8 Dosentetapyangmemiliki SertifikatPendidikProfesional sangatkurang 9 NKDprodiFarmasibelumsesuaiSMU 10 Rasiomahasiswadengandosentetap yangkeahliannyasesuaidenganPS belumterpenuhi ProdibelummemilikiDosenasing sebagaimanaterdapatdiSMU Fakultas Persentasedosentidaktetap terhadapkeseluruhandosenprodi terlalubesar Prodibelummempunyaidokumen kegiatandosentidaktetapyang sesuaidengankompetensiprodi SDMpustakawanyangberkualifikasi DiplomadanS1belumterpenuhi KetersediaanCourseOutlinemata kuliahdiprodifarmasibelum terpenuhip Ketersediaanmatakuliahpilihan yangditawarkanbelumsesuaidengan standardDIKTI Rataratamahasiswayangmenjadi bimbingandosenterlalubanyakdan tidaksesuaidenganstandardDIKTI Rataratapenyelesaianskripsi mahasiswabelumsesuai Prodibelummempunyaidaftar kegiatandakwahislamiyah Belum ada karya dosen prodi farmasi yangmemilikiHAKI AnalisisPenyebab RencanaTindakLanjut

11

13

14

15 16

17

18

19 20 21

5.2. ProdiIlmuKimia
BPM-UII-YOGYAKARTA/2011 Halaman 65 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.20TemuanDeskriptifKinerjaPeriode20102011ProdiStatistika Temuan No. Standar Deskripsi 1 TingkatketercapaianSMUProdiIlmuKimia baru38,5%. 2 Umpanbalikdaripengguna(user)belum dilakukan 3 Prodibelumberupayauntukmelakukan akreditasiinternasional 4 Rasiocalonmahasiswadengandayatampung sangatsedikit 5 Belumadaupayauntukmerekrutmahasiswa asing 6 Persentaselulusantepatwaktubelum tercapai 7 Belumadaaksesuntukmemperolehpendapat pengguna(user)lulusan 8 Dosenyangmemilikijabatangurubesar sesuaiprodimasihsangatkurang 9 DosenyangmemilikiSertifikatPendidik Profesionalmasihminim 10 Persentasejumlahdosenasingbelaumada 11 13 14 15 16 17 18 19 20 21 Rataratabebandosenperminggubelum sesuaidenganstandardDIKTI SDMpustakawanyangberkualifikasiDiploma danS1belumterpenuhi KetersediaanCourseOutlinebelumada AnalisisPenyebab RencanaTindakLanjut

Rataratakehadirandosenmengajar/semester belumterpenuhi Belumsemuamatakuliahmemilikihandout Kegiatanperwalian/bimbinganbelumefektif Prodibelummempunyaipedoman/panduan pengembaganperilakuprofessionaldosen Belumadakebijakantertulismengenai otonomikeilmuan Prodibelummempunyaidaftarkegiatan dakwahislamiyah DokumenPKbelumsesuaiSMUII

5.3. ProdiStatistika
Tabel4.21.TemuanDeskriptifKinerjaPeriode20102011PodiStatistika Temuan No. Standar Deskripsi 1 TingkatketercapaianSMUProdibaru 66,67% 2 3 BelumterdapatSOPdalampengambilan keputusandiProdidanaktifitasnya KurikulumProdisudahmengacupadaASA (asosiasistatistikaAmerika),tetapi belummengarahkanuntukakreditasi internasional Rasiocalonmahasiswayangmengikuti seleksidengandayatampungbaru1:23 Rasiomahasiswabarureguleryang registrasiterhadapmahasiswabaru reguleryangditerima60,6% Rasiomahasiswabaruterhadapjumlah totalmahasiswasebesar0,29 Belumadamahasiswaasingdiprodi statistika AnalisisPenyebab RencanaTindakLanjut

4 5

6 7

BPM-UII-YOGYAKARTA/2011

Halaman 66 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Temuan No. Standar Deskripsi 8 KelulusanTepatwaktubaru14% 9 10 11 ProsentasemahasiswaDO=15% Kualitaslayanankepadamahasiswabaik (skore3) Hasilpelacakanalumnisudahdigunakan untukperbaikanproses,informasi pekerjaan,membangunjejaringtetapi belumuntukpenggalangandana Pendapatpenggunalulusanterhadap kualitaslulusanmendapatskore22,3 RatarataMasatunggumendapatkan pekerjaanpertamaselama5,59 bulanTingkatketercapaianSMUProdi baru66,67% Belumadadukungandanadarialumni dalambidangpengembanganakademikdi prodi Belumadadukungandanadarialumni dalambidangpengembangannonakademik Persentasedosentetapdenganjenjang pendidikanS3baru33,3% Dosentetapdenganjabatanakademik GuruBesarbaru17% Dosentetapyangtelahtersertifikasi pendidikprofesionalbaru33,3% NilaiKinerjaDosendalamaspek pedagogik,sosial>3baru75% NilaiKinerjaDosendalamaspek pedagogik,sosialdanprofesional Belumadadosenasingyangmengajardi prodi Rataratabebandosenpersemester sebesar10,54SKS(standar1113SKS) Rataratabebandosenperminggu sebesar31,5jam(standar36jam) Persentasidosentidaktetapterhadap jumlahseluruhdosensebesar43,3% Baru15MKyangmemilikicourseoutline Rataratakehadiranmahasiswadalam satusemester>75%belummencapai90% Rataratakehadiranmahasiswasesuai standar>75% KetersediaanhandoutsesuaiSAPbaru 50% Rataratabanyaknyamahasiswabimbingan akademikperdosenpersemestersebesar 21mhs Pelaksanaankegiatanbimbinganakademik Efektifitaspembimbingan Pengembanganperilakukecendikiawanan danprofesional Bahanpustakaberupaprosidingseminar barutersedia Belumdimanfaatkanyafasilitase learningsecaraefektif Skoreaksesibilitasdatadarisistem informasisebesar3,65(skala4) Persentasiketerlibatanmahasiswatugas akhirdalampenelitiandosenbaru10,5 % Belumadakaryadosenyangmemperoleh HAKI Keterlibatanpenuhmahasiswadalam kegiatanpengabdianmasyarakat,tetapi AnalisisPenyebab RencanaTindakLanjut

12 13

14

15 16 17 18 19 20 21 22 23 24 25 26 27 28 29

30 31 32 33 34 35 36

37 38

BPM-UII-YOGYAKARTA/2011

Halaman 67 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi tanggungjawabmasihdidosen AnalisisPenyebab RencanaTindakLanjut

6. FakultasPsikologidanIlmuSosialBudaya 6.1. ProgramStudiPsikologi


Tabel4.22.TemuanDeskriptifKinerjaPeriode20102011ProdiPsikologi Temuan No. Standar Deskripsi 1 Nilaipraktikibadahdengan hasilbaikmasihbelum mencapaiminimal90% AnalisisPenyebab RencanaTindakLanjut

Realisasihasilpenelitian dankaryailmiahdosenyang dipublikasikandalamjurnal

Pelaksanaanrencanakerja Unitdanrencana pengembanganUnit

Evaluasirencanaprogram pengembanganunit

Pengelolaandokumenunit berdasarkanDCMdan ketersediaanevaluasiDCM

Input mahasiswa dalam hal TindakanPerbaikan keagamaanmasihsangatkurang Pendampinganpadamahasiswa telahdilakukantetapibelum dievaluasi Belumadalaporankepada DPPAItentangsituasiini TindakanPencegahan Sudahadarencana meningkatkaninputmahasiswa yangberhubungandengannilai tesagamapadasaatseleksi mahasiswabarutetapibelum biasdilaksanakankarenaanimo mahasiswamasihkurang Melakukan evaluasi pada pendampingan mahasiswa dengan lebihintensif Jurnalinternalbelumaktif TindakanPerbaikan: Dosenbelumaktifmelakukan Mengaktifkanjurnalinternal penelitian Memotivasidosenmelakukan Hasil penelitian yang ada penelitian tidak dipublikasikan dalam Mendorongagarhasil jurnal penelitiandipublikasikan Memfasilitasipengiriman naskahkaryailmiahdosen untukdimasukkandalamjurnal TindakanPencegahan: Sosialisasi lebih intensif pada dosen untuk melakukan penelitian dan pentingnya publikasikaryailmiah Tidak mempunyai SDM pendukung TindakanPerbaikan: sehingga masih ada beberapa BerusahamendapatkanSDMyang program yang belum ditempatkandiProdi dilaksanakan TindakanPencegahan Melakukanmonitoringlebih baikpadapelaksanaanrencana kerjamaupunpengembangan Tidak adanya SDM pendukung TindakanPerbaikan: sehingga pelaksanaan program Dengantenagayangada pengembangan mengalami melakukanevaluasisecara kendalateknis optimaldanmemasukkanrencana programyangbelumselesai padaperiodetahun berikutnya. TindakanPencegahan Frekuensipelaksanaan evaluasiditambahdengan3 bulansekali Tidak adanya SDM pendukung TindakanPerbaikan: sehingga tidak ada yang BerusahamendapatkanSDM mengeloladokumen pendukungpalingtidaksatu

BPM-UII-YOGYAKARTA/2011

Halaman 68 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut oranguntukpengelolaan dokumen TindakanPencegahan DenganSDMyangadamengelola dokumensecaralebihoptimal dandilakukansecaraperiodik

6.2. ProgramStudiIlmuKomunikasi
Tabel4.23.TemuanDeskriptifKinerjaPeriode20102011ProdiIlmuKomunikasi Temuan AnalisisPenyebab No. Standar Deskripsi Tidak ada rekaman data temuan Prosesaudittidaktuntas secaradeskriptif RencanaTindakLanjut

7. FakultasTeknologiIndustri 7.1. ProgramStudiTeknikMesin


Tabel4.24.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikMesin Temuan No. Standar Deskripsi 1 Tingkatketercapaian sasaranmutubelum memenuhi,baru20%(Mayor) AnalisisPenyebab Prestasiakademikmahasiswa masihbelummemenhistandar PelaksanaanKP/TAyangmasih terlalulama Tingkatpengulanganmata kuliahmasihcukuptinggi (15%) Tingkatkehadiranmengajar dosenmasihbelummemenuhi standar BelumdibuatnyaProsedur Kerja RencanaTindakLanjut TindakanPencegahan: MengaktifkanperananDosen PembimbingAkademik Memberikansanksiuntukdosen denganjumlahkehadirankurang daribatasminimal Melakukanevaluasipelaksanaan KP/TA

Belumadaprosedurkerja (Minor1)

UsahaAkreditasi Internasionalbarusampai identifikasidan networking(Minor1) Rasiocalonmahasiswayang ikutseleksi:daya tampungadalah1.59,belum memenuhiseharusnya(>5) (Minor1)

Masihbanyakkriteriauntuk akreditasiinternasional yangbelumterpenuhi

ProdiTeknikMesinmasih belumcukupdikenali masyarakatluas

Rasiocalonmahasiswabaru reguler:dayatampung belummemenuhi(Minor1)

ProdiTeknikMesinmasih belumcukupdikenali masyarakatluas

Prosentasekelulusantepat waktumasihbelummemenuhi

Tingkatpengulanganyang relatiftinggi(15%)

TindakanPerbaikan: PembuatanProsedurKerja kegiatanprodi TindakanPencegahan: ImplementasiProsedurKerjayang dibuat TindakanPencegahan Melakukanusahausahayang diperlukanuntukmemenuhi kriteriaakreditasi internasional TindakanPerbaikan: Pemetaanasalmahasiswadan latarbelakangorangtua mahasiswa TindakanPencegahan: Melakukanusahapromosiuntuk meningkatkananimocalon mahasiswa TindakanPerbaikan: Pemetaanasalmahasiswadan latarbelakangorangtua mahasiswa TindakanPencegahan: Melakukanusahapromosiuntuk meningkatkananimocalon mahasiswa TindakanPerbaikan: Mendatamahasiswayangmempunyai

BPM-UII-YOGYAKARTA/2011

Halaman 69 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi (13.28%)(Mayor) AnalisisPenyebab PelaksanaanKP/TAmasih relatiflama RencanaTindakLanjut prestasiakademikmasihkurang TindakanPencegahan: MengaktifkanDPA Menyelenggarakankegiatan peningkatanmotivasimahasiswa Saatini3orangdosen TindakanPencegahan: sedangmenempuhstudiS3 Membuatmatrikulasiperencanaan studilanjutuntuk3orangdosen lainnya Sebagianbesardosen TindakanPencegahan: Mendorongdosenuntukjuga mempunyaijabatanakademik untukSKKopertisyanglebih mengurusjabatanakademik Kopertissaatmengurusjabatan rendahdibandingkanSK akademikYayasan Yayasan Persyaratansertifikasi TindakanPencegahan adalahmempunyaijabatan Mendorongdosenuntukjuga akademiklektorberdasarkan menaikkanjabatanakademik SKKopertis KopertismenjadiLektor Jumlahdosentetapkurang TindakanPencegahan: Mengajukanusulanpenambahan dosentetap

Tidakadadosentetapyang berpendidikanS3(Mayor)

Tidakadadosentetapyang memilikijabatanlektor kepaladangurubesar (Mayor) Dosentetapyangmempunyai sertifikatbaru1(dari6) (Minor1) Rasiomahasiswaterhadap dosentetap(adalah42) belummemenuhiseharusnya antara17s/d23(Minor 1) Bebandosenpersemester terlalutinggi16sks seharusnya(11s/d13Sks) (Minor2) Persentasejumlahdosen tidaktetapterhadap jumlahseluruhdosenmasih terlalubesaryaitu (27,56%)seharusnya<10%. (Minor2) Kualifikasipustakawan belummemenuhi.(Mayor) Rataratakehadiran mahasiswa61.11% seharusnya75%(Minor 2)

10

11

Jumlahdosentetapkurang

TindakanPencegahan: Mengaktifkanperanandosen kontrak/tidaktetap

12

Kurangnyajumlahdosentetap TindakanPencegahan: Mengajukanusulanpenambahan dosentetap

13

14

15

16

Rataratabanyaknya mahasiswaperDosen PembimbingAkademikadalah 56seharusnya20(Minor 1) Jumlahrataratapertemuan pembimbingakademikper mahasiswapersemester tidaksesuai(Minor1)

17

WaktupenyelesaianTA 10,41seharusnya<6 bulan.(Minor1)

18

Setiapbulanseharusnya adakegiatanilmiah terjadwal(Minor1)

TindakanPencegahan: Mengajukanusulanstudilanjut untukpustakawanFTI TindakanPerbaikan: Dilakukanlagisosialisasi aturankehadiranminimal75% TindakanPencegahan: Mendorongdosenpengampumata kuliahuntukmelakukan monitoringkehadiranmahasiswa Masihkurangnyajumlahdosen TindakanPencegahan: Mengaktifkandosenyangtelah tetap Terdapat3orangdosentetap selesaistudilanjutsebagai DosenPembimbingAkademik yangsedangmelaksanakan studilanjut SaatpengisianRencana TindakanPerbaikan: Kartuujianyangselamaini AkademikSemester(RAS) diambildiDivisiPerkuliahan, mahasiswamelaksanakannya secaraonlinedantidakada mulaisemesterIItahun 2010/2011wajibdiambilpadaDPA kewajibanmenemuiDPA Mahasiswamasihbelum TindakanPencegahan: merasakanpentingnya MengaktifkanperananDPAdalam bimbinganakademik pembimbinganmahasiswa PelaksanaanpembimbinganTA TindakanPerbaikan: masihbelumefektif EvaluasipelaksanaanTA TindakanPencegahan: Membuatperbaikanaturan pelaksanaanTA Belumterdokumentasikannya TindakanPerbaikan: kegiatanseminarTAyang Membuatdokumentasikegiatan sebetulnyatelahrutin seminarTAyangtelahdilakukan

BelumadanyapustakawanFTI yangbergelar Diploma/Sarjana Masihbelum tersosialisasikannyaaturan kehadiranminimal75%

BPM-UII-YOGYAKARTA/2011

Halaman 70 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab dilakukan RencanaTindakLanjut TindakanPencegahan: Merencanakankegiatanilmiah TindakanPencegahan: Mengajukanproposalhibah Melakukanusahausahapromosi untukmeningkatkanminatcalon mahasiswa TindakanPerbaikan: Mengumpukaninformasitentang jurnalterakreditasibidang TeknikMesin TindakanPencegahan: Berlanggananjurnal terakreditasibidangTeknik Mesin TindakanPerbaikan: Mengumpukaninformasitentang jurnalinternasionalbidang TeknikMesin TindakanPencegahan: Berlanggananjurnal internasionalbidangTeknik Mesin TindakanPerbaikan: Menggandakanprosidingyang dimilikidosen TindakanPencegahan: Melakukanpembelianprosiding melaluidosenpenyaji/peserta seminar/konferensi TindakanPerbaikan: MelaksanakanpresentasitopikTA TindakanPencegahan: Meningkatkanketerlibatan mahasiswadalampenelitiandosen TindakanPerbaikan: Melakukanpencatatanalternatif aktivitasyangdapatdijadikan kegiatanpengabdianmasyarakat melibatkanmahasiswa TindakanPencegahan: Menyelenggarakankegiatan pengabdianmasyarakatyang melibatkandosendanmahasiswa TindakanPencegahan: Memperluasjejaringdengan instansilain

19

Besarnyadanayang dikelolaprodimasih kurang(189juta)(Minor 1) Bahanilmiahjurnal terakreditasibaru1judul (Minor1)

Masihkurangnyajumlah mahasiswamasih

20

Ketersediaanjurnal terakreditasimasihbelum memperolehperhatian

21

Tidakmemilikijurnal internasional(Mayor)

Ketersediaanjurnal internasionalmasihbelum memperolehperhatian

22

Bahanpustakaprosiding masihkurang(Minor1)

Ketersediaanprosidingdi perpustakaanmasihbelum memperolehperhatian Umumnyaprosidingadalah milikdosen

23

KeterlibatanmahasiswaTA dalampenelitiandosen baru15%(Minor1)

Jumlahdosenpembimbing masihkurangkarenajumlah dosentetapmasihkurang

24

Kegiatanpengabdian masyarakatdosenmasih kurang(Minor1)

Jumlahdosentetapmasih kurangsehinggakesibukan dosenyangcukuptinggi

25

Kegiatankerjasamadengan instansidalamnegeri masihkurang(Minor2)

Masihkurangnyajejaring denganinstansilain

7.2. ProgramStudiTeknikElektro
Tabel4.25.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikElektro Temuan No. Standar Deskripsi 1 Sasaranmutubarutercapai 16,67% AnalisisPenyebab Untukwaktustudi,aturan DOlamastudibarusaja diterapkan LKIDdanagamabukan wewenangprodi NKDdosenyangrendahdi karenakanketerlambatan penyerahannilai RencanaTindakLanjut TindakanPerbaikan: MenerapkanaturanDO LKIDdiserahkankeDPPAI Memberikansanksiuntuk keterlambatanpenyerahannilai Mengingatkankembaliaturan aturanpadawaktusarasehandi

BPM-UII-YOGYAKARTA/2011

Halaman 71 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar 2 Temuan Deskripsi Prodibarumelakukan identifikasi&networking untukakreditasi internasional Rasiocalonmahasiswa registrasidenganmahasiswa barululusseleksibelum memenuhi Tepatwaktustudibelum sesuai AnalisisPenyebab JumlahdosenS3dan bergelarGuruBesarmasih kurang Calonmahasiswaditerima diPTN RencanaTindakLanjut akhirsemester TindakanPerbaikan: StudilanjutdosenyangmasihS2 Pembuatanmatrikskaryasiswa Meningkatkanpromosi. Pembentukantimpromosi

AturanDObarumulai diberlakukan WaktupenyelesaianTA masihlama

DosentetapS3masihsedikit Dosennyamasihrelatif muda.

6 7 8 9

BelummempunyaiGuruBesar Dosenyangmempunyai sertifikathanya1 Persentasedosentidaktetap masihtinggi69,7% Rataratakehadiran mahasiswa>75%belumada90% (baru70%)

Dosendiprodimasih relatifmuda Dosendiprodimasih relatifmuda Jumlahdosenmasihsedikit Motivasimahasiswarendah

10

Ketersediaan handout/materi/modelbaru 60%

Belumoptimalnyajurusan dlmmemintahandoutdari dosen

11

12

Rataratamahasiswaper dosenpembimbingTAmasih tinggi WaktupenyelesaianTAmasih lama

Jumlahdosenmasihsedikit

TindakanPerbaikan: PenerapanDO Perbaikanpembelajaran Penelitianbersamadosendan mahasiswauntukmempercepat waktuTA TindakanPencegahan PenerapanDO Perbaikanpembelajaran Penelitianbersamadosendan mahasiswauntukmempercepat waktuTA TindakanPerbaikan: Mendoronguntukstudilanjut Matriksstudilanjut TindakanPencegahan RekrutmenGuruBesarpurnatugas TindakanPerbaikan: RekrutmenGuruBesarpurnatugas TindakanPerbaikan: Meningkatkancaturdarmadosen TindakanPerbaikan: Penambahandosenbaru TindakanPerbaikan: Inovasipembelajaran TindakanPencegahan Penerapanaturan75% dilaksanakansecarategas TindakanPerbaikan: Segerauntukmemintahandout daridosen Timkhususuntukpengadaan handout TindakanPencegahan: Mendorongdosenuntuk menggunakanklasiber TindakanPerbaikan: Pengadaandosenbaru TindakanPerbaikan: Adaseminarprogressyang dihadirimahasiswa&dosen setiap3bulansekaliProgress masukdalampenilaian(30%) TindakanPerbaikan: Berusahameningkatkananimo mahasiswabaru Mencarifundingdariluar TindakanPerbaikan: Mendorongdosenuntukmelakukan penelitianygberorientasipada HaKI

Pembimbingankurang terkontrol

13

Jumlahdanayangdikelola prodikurangdari200juta JurnalInternasionalmasih kurang BelumadaHaKI

Jumlahmahasiswasedikit dansumberdanamayoritas darimahasiswa Belumadahasilpenelitian dosenygdipatenkan

14 15

BPM-UII-YOGYAKARTA/2011

Halaman 72 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Temuan No. Standar Deskripsi 16 Kerjasamaluarnegeribaru satu AnalisisPenyebab JumlahSDMmasihterbatas RencanaTindakLanjut TindakanPerbaikan: Sedangmerintiskerjasamadengan luarnegeri

7.3. ProgramStudiTeknikKimia
Tabel4.26.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikKimia Temuan No. Standar Deskripsi 1. 1.1.2.2.KetercapaianSasaranMutu(SM)Prodibelum 100%,dari4SM,baru1SMyangtercapai,yaitu lulusanIPK>3(25%).SMyangbelumtercapai: lulusanberkarya1tahun,lulusantepatwaktu,NKD >3. 2. 2.2.1.2.BelumtersedianyaProsedurKerja(PK) tertulisberkaitandenganpengambilankeputusandan pelaksanaanaktivitas.Misalnya:PKuntukevaluasi kurikulum,dsbmengacupadaWTProdi.Belum tersedianyapembagiantugasdankewenanganserta pendelegasiankerjadenganunitdibawahnyadanatau timyangdibentukdenganSuratKeputusan(SK). 3. 3.5.1.1.Tidakadamahasiswayanglulustepatwaktu 4. 5. Analisis Penyebab RencanaTindak Lanjut

6. 7.

3.7.1.3.Skorpengguna(user)lulusanterhadapalumni berdasarkan7kompetensi<28,yaitu16,66. 4.3.1.4.Dosentetapyangmemilikijabatangurubesar belumada,padahaljumlahdosenyangmemilikigelar doktorsudah4orang 4.3.3.Presentasejumlahdosenasing0% 4.5.3.Kegiatandosentidaktetapyangkeahliannya sesuaidenganprodidalamseminar ilmiah/lokakarya/penataran/workshop/pagelaran/pameran yangtidakhanyamelibatkandosenPTsendiriBELUM ADA .5.4.Kegiatandosentetapyangkeahliannyasesuai denganprodidalamseminar ilmiah/lokakarya/penataran/workshop/pagelaran/pameran yangtidakhanyamelibatkandosenPTsendirimasih kurangdari2,25,yaitu0,39[9:23] 4.6.1.1.Kualifikasipustakawan3oranglulusanSMA, tidakadadiplomaatausarjana 5.2.3.2.SAPtersedia100%,namunbelumadacourse outlinesatupununtuktiapmatakuliah. 5.3.4.1.Rataratakehadirandosenmengajaruntuk semuakelas/semester<95%darijumlamkehadirandalam SAP,yaitu92,64% .3.4.2.Rataratakehadiranmengajardosensesuai standar(14xpertemuan)barutercapai67%(kurang dari90%).smtgenap2009/2010,untuksmtganjil 2010/2011tidakdihitungkarenakasuserupsimerapi 5.5.2.Tidakadapembimbinganakademik,hanyaada pengesahandokumenakademikolehpegawai administratif 5.6.5. Ratarata waktu penyelesaian TA/Skripsi masih kurangdari6bulan,yaitu12bulan 5.7.3.Kegiatanilmiahyangterjadwalbelum dilaksanakansetiapbulan,masihdilaksanakanlebih darienambulansekali 6.2.1.Besarnyadanayangdikelolaprodisetahun masihkurangdari300jutapertahun,yaitu165juta pertahun .2.2.Rataratadanapenelitiandalamtigatahun terakhirperdosentetappertahunkurangdari3juta rupiah,yaituantara12jutarupiahperdosentetap pertahun .2.3.Rataratadanayangdiperolehdalamrangka

8.

9. 10. 11.

12.

13.

14. 15.

16.

17.

18.

BPM-UII-YOGYAKARTA/2011

Halaman 73 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi pelayanan/pengabdiankepadamasyarakatdalamtiga tahunterakhirkurangdari1,5jutarupiahperdosen tetapper tahun,yaitulebihdari0,51jutaper dosentetappertahun. 6.4.2.TidakadaperpustakaandiluarPTyangdapat diakses.Haliniditunjukkandenganketiadaandokumen buktikerjasamadenganperpustakaanlaindiluarPT 7.1.1.Jumlahpenelitianyangsesuaidenganbidang keilmuanprodi,yangdilakukanolehdosentetapyang bidangkeahliannyasamadenganprodipertahunselama 3tahunmasihkurangdari2,yaitu0,39 [0+(4x2)+(1x1)]/23=9/23 7.1.2.Tidakadabuktidokumenketerlibatanmahasiswa yangmelakukantugasakhirdalampenelitiandosen. 7.1.3.Jumlahartikelilmiahyangdihasilkanoleh dosentetapyangbidangkeahliannyasamadenganprodi pertahunselama3tahunmasihkurangdari6,yaitu1 [(4x1)+(2x9)+(1x1)]/23=23/23 7.1.4.Tidakadakaryakaryaprodiyangtelah memperolehperlindunganHakatasKekayaanIntelektual (HAKI)dalamtigatahunterakhir 7.2.1.Skorreratajumlahkegiatan pelayanan/pengabdiankepadamasyarakatyangdilakukan olehdosentetapyangbidangkeahliannyasamadengan prodiselamatigatahunkurangdari1,yaitu0,17 4/23 7.2.2.Keterlibatanmahasiswadalamkegiatan pengabdiankepadamasyarakathanyadimintasebagai tenagapembantu Analisis Penyebab RencanaTindak Lanjut

19.

20.

21. 22.

23.

24.

25.

7.4. ProgramStudiTeknikIndustri
Tabel4.27.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikIndustri Temuan No. Standar Deskripsi 1 SasaranmutusamadenganSasaranmutu universitas,belumditemukan dokumenyangdiotorisasi 2 Masihadadosenyangtidakmengisi materikuliahpadarealisasiSAP 3 Dataumpanbalikalumnibelum terdokumentasi 4 Persentasekelulusantepatwaktu= 49,6% 5 CapaianNilaikompetensikeUIIan lulusanrataratayangmeliputi keislaman,kebangsaan,kewirausahaan danbahasainggris(KLr)belumdiukur 6 Pendapatpengguna(employer)lulusan terhadapkualitasalumnibelum diukur. 7 Profilmasatunggukerjapertama belumdiukur 8 Profilkesesuaianbidangkerjadengan bidangstudibelumdiukur 9 Persentasejumlahdosenasing(PDA)= 0(belumadadosenasing) 10 Persentasejumlahdosentidaktetap, terhadapjumlahseluruhdosenmasih cukuptinggi=40% 11 Semuamatakuliahbelumdilengkapi denganCourseoutline 12 Persentaserataratakehadiran mahasiswa/semestermasihrendahyaitu 74.5%danyangsesuaistandar(> AnalisisPenyebab RencanaTindakLanjut

karenaterlalubanyak denganharusmemanggil datasetiapmahasiswa dalamSIMAK.

Perludibuatdalam systeminformasioleh BSI

BPM-UII-YOGYAKARTA/2011

Halaman 74 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar 13 14 Temuan Deskripsi 75%)sebesar66,5% Ketersediaanhandout/materi perkuliahanmasihrendah<70% Rataratawaktupenyelesaian penulisanTA/Skripsi/Penelitian/ KaryaTulisIlmiah=810bulan AnalisisPenyebab RencanaTindakLanjut

7.5. ProgramStudiTeknikInformatika
Tabel4.28.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikInformatika Temuan No. Standar Deskripsi 1 Ketercapaiansasaranmutu 66.6% AnalisisPenyebab AdaduaPoinsasaranmutu yangbelumterpenuhi,lulusan yangbekerjapada6bulan pertamabaru18%daritarget 70%danpublikasiilmiah24 penelitiandaritarget30 penelitianpertahun Belundibuatnyaprosedur kerja RencanaTindakLanjut TindakanPerbaikan: Dilakukanevaluasiketercapain Sasaranmutusecaraberkala TindakanPencegahan Mempertahankandan memperbaikaiprosesAkademik dijurusan TindakanPerbaikan: PembuatanprosedurkerjaProdi TeknikInformatika TindakanPencegahan Implementasiprosedurkerja yangdibuat TindakanPencegahan Melakukanusahausahayang merngarahpadaperubahanRenov untukmemenuhikriteria AkreditasiInternasional TindakanPencegahan Melakukanusahauntukpromosi untukmeningkatkananimo mahasiswadanmembukaprogram SEIPUntukmenjembatani mahasiswayangKPdengan Instansiyangmengingginkan SDM. TindakanPerbaikan: DengandiadakanyaSEIPdan Kegiatanpeningkatanmotivasi mahasiswa TindakanPencegahan MeningkatkanperanDPAdan menyelenggarakanpeningkatan motivasimahasiswa TindakanPencegahan Membuatmatrikulasi perencanaanstudilanjutuntuk dosenyangmasihS1maupunS2 TindakanPerbaikan: Dibuatmatrikulasiperencanaan studilanjut TindakanPencegahan Melakukanevaluasibagidosen yangmelakukanstudilanjut danmemotivasi. Mendorongdosenuntukjuga mengurusjabatanakademik kopertissaatmenggurus jabatanakademikyayasan TindakanPencegahan Mendorongdosenuntukmenaikan jabatanakademikKopertis menjadiLektor

Belumadaprosedurkerja

Usahaakreditasi internasionalbarusampai identifikasidan networking Rasiomahasiswabaru terhadapjumlahmahasiswa akrifbelummemenuhi

Renovbelumfokuspada akreditasiinternasional

Persentasekelulusantepat waktustudibelummemenuhi

ProdiTeknikInformatika sudahdikenalmasyarakat namunlulusantepatwaktu belumterpenuhikarenalama KerjaPraktekmahaswiswayang bervariasi,sehingga menjadikanjumlahmahasiswa aktiflebihbesar. KarenapelaksanaanKPyang relatiflama

DosentetappendidikanS2 danS3belummemenuhi (64%,seharusnya>90%) Dosentetapberpendidikan S3belummemenuhi(10,47%, seharusnya>40%)

Saatini3orangdosensudah menempuhstudiS3dan2 sedangstudilanjutmenempuh S3dan6DosenmenempuhS2 Saatinisudahada3dosen yangmenempuhS3dan2dosen sedangstudilanjutS3

Tidakadadosentetapyang memilikijabatanguru besar Dosentetapbersertifikat belummemenuhi(17,8%, seharusnya40%)

Sebagianbesardosen mempunyaijabatanakademik untukSKKopertisyangrendah dibandingkanSKYayasan. Persyaratansertifikasi adalahmempunyaijabatan akademiklektorbardasarkan SKKopertis

BPM-UII-YOGYAKARTA/2011

Halaman 75 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar 10 Temuan Deskripsi Dosentetapbersertifikat belummemenuhi(17,8%, seharusnya40%) Pembicaratamukurang(5 org/thn,seharusnya12) AnalisisPenyebab Persyaratansertifikasi adalahmempunyaijabatan akademiklektorbardasarkan SKKopertis Pembicaraseminaryangtelah dilakukanTeknikinformatika mengundangpraktisidari internal RencanaTindakLanjut TindakanPencegahan Mendorongdosenuntukmenaikan jabatanakademikKopertis menjadiLektor TindakanPerbaikan: Melakukankegiatanilmiah denganmenggundangpraktisi dariluar TindakanPencegahan: Mengagendakankegiatan pelatihan TindakanPerbaikan: Melakukankegiatanilmiahyang mengundangpraktisidariluar PTuntukmeningkatkan penggayaanpengetahuan. TindakanPerbaikan: Melakukansosialisaiterkait kehadiran75% TindakanPencegahan: Melakukanevaluasikepada mahasiswayangkehadiran kurangdari75% TindakanPerbaikan: Memberikanbimbingankepada mahasiswamelaluikegiatan konselorsebaya TindakanPencegahan: MeningkatkanperandosenDPA TindakanPerbaikan: Memberikesempatandosenuntuk meningkatkanjabatanakademik SehinggabisamembimbingTA TindakanPencegahan: Membuatmatringstudilanjut Dosen TindakanPerbaikan: Melakukanupayaupayauntuk akreditasimediapublikasi TindakanPencegahan: Meningkatkankegiatan penelitiandosenyang terjadwalperbulandan berlanggananjurnalyangtelah terakreditasi. TindakanPerbaikan: Mengumpulkaninformasitentang jurnalinternasionalbidang teknikInformatika TindakanPencegahan: Berlanggananjurnal internasionaldibidangteknik informatika TindakanPerbaikan: Dilakukankegitanilmiah sepertiSNATI. TindakanPencegahan:

11

12

Kegiatanilmiahdosen tetapPTlainmasihkurang Rataratakehadiran mahasiswabelummemenuhi (72.5%,seharusnya75%)

Kegiatanilmiahlebih mengarahpadabidang kompetensiinformatika

13

14

Jumlahmahasiswaterhadap dosenwaliterlalubanyak (61,seharusnya<20)

Kehadiran75%sudah diterapkannamunpada semestergenap2009/2010 kegiatantersebutterhalang karenaadanyabencanaerupsi merapi,Sedangkanpada semseterganjil2010/2011 aturankehadiran75%sudah diberlakukan. Jumlahdosentetapyangmasih relatifsedikit

15

Jumlahmhstiapdosen pembimbingTAterlalu banyak(12,5,seharusnya <4)

Jumlahdosentetapyang memilikiminimaljabatan AsistenAhlisebanyak12 sedangkandosenyangstudi6 dosen,dan10dosenbelum menjadiAsistenAhli

16

Jurnalilmiah terakreditasiDIKTImasih kurang

Penelitiandosensudah relatifbanyaknamunmedia publikasiyangbelum terakreditasi

17

Jurnalinternasionalmasih kurang

Ketersediaanjurnal internasionalmasihbelum memperolehperhatian

18

Prosidingseminarmasih kurang

Penelitiandosentidak dipublikasikandalam prosidingseminar.

BPM-UII-YOGYAKARTA/2011

Halaman 76 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar 19 Temuan Deskripsi Kegiatanpenelitiandosen masihkurang AnalisisPenyebab Bebanmengajardosenyang lebih RencanaTindakLanjut Menjadwalkankegiatanilmiah TindakanPerbaikan: Menrekrutdosentidak tetap/kontrakuntuk menggurangivolumebebandosen tetap TindakanPencegahan: Melakukanpenjadwalankegiatan ilmiahbagidosen TindakanPerbaikan: Mendokumentasikankegiatan ilmiahdosendanmahasiswa yangdigunakanuntukTA TindakanPencegahan: Meningkatkanperanmahasiswa dalampenelitiandosen TindakanPerbaikan: Membuatprogramyanglebih fokuspadaupayaupaya pencapaianHAKI TindakanPencegahan: Meningkatkanbudayapenelitian dosen.

20

KeterlibatanmahasiswaTA dalampenelitiandosen masihkurang

Belumterdokumentasinya kegiatanpenelitianantara dosendanmahasiswa

21

BelumadaHAKI

Sudahadaprogramtapibelum terimplementasi

8. FakultasTeknikSipildanPerencanaan 8.1. ProgramStudiTeknikArsitektur


Tabel4.29.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikArsitektur Temuan No. Standar Deskripsi 1 Tingkatketercapaiansasaran (mutu)prodiantara50%sampai 74,9%(belum100%) AnalisisPenyebab SasaranMutuyang berkaitandenganmahasiswa asingdandosenasing masihsusah RencanaTindakLanjut TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntukmendorong tercapainyasasaranmutuyang belumoptimal TindakanPencegahan: Selalumenjagakualitas prosesakademik TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntukmendorong adanyamahasiswaasing TindakanPencegahan: Selalumenjagakualitas prosesakademikagar mahasiswaasingmauuntuk studidiarsitektur TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntuk mengoptimalkanprosesbelajar mengajar TindakanPencegahan: Selalumenjagakualitas prosesakademik TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntuk mengoptimalkanprosesbelajar mengajaragarmahasiswadapat

Persentasemahasiswaasing baruterhadaptotalmahasiswa barumasihnol

Belummempunyaimahasiswa asing

IPK)selamalimatahunterakhir Proseskegiatanbelajar adalah:2IPKr<2,75 mengajarbelumoptimal

Persentasekelulusantepat waktu(KTW)barutercapai: 16,667%KTW<33,334%

Proseskegiatanbelajar mengajarbelumoptimal

BPM-UII-YOGYAKARTA/2011

Halaman 77 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut menempuhstuditepatwaktu TindakanPencegahan: Selalumenjagakualitas prosesakademik TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntuk mengoptimalkanprosesbelajar mengajaragarcapaianNilai kompetensikeUIIanlulusan rataratayangmeliputi keislaman,kebangsaan, kewirausahaandanbahasa inggrisdapatmeningkat TindakanPencegahan: Selalumenjagakualitas prosesakademik TindakanPerbaikan: Perluadanyatindakanyang bertujuanuntuk mengoptimalkanprosesbelajar mengajaragarkualitasalumni meningkat TindakanPencegahan: Selalumenjagakualitas prosesakademik TindakanPerbaikan: Perluadanyausahapercepatan agarparadosenmempunyai jabatangurubesar TindakanPencegahan: Akademikatmosferperlu dijagadenganbaik

CapaianNilaikompetensike Proseskegiatanbelajar UIIanlulusanrataratayang mengajarbelumoptimal meliputikeislaman,kebangsaan, kewirausahaandanbahasa inggris(KLr)adalah:2,5<KLr 3

Skorakhirpendapatpengguna Proseskegiatanbelajar (employer)lulusanterhadap mengajarbelumoptimal kualitasalumnisebanyak:1418 sehinggakualitasalumni belummaksimal

Dosentetapyangmemiliki jabatangurubesaryangbidang keahliannyasesuaidengan kompetensiPS KD3=PersentaseDosentetap yangmemilikijabatanguru besaryangbidangkeahliannya sesuaidengankompetensiPS adalahtidakada(belumada yanggurubesar) Rataratabebandosenper semester,atauratarataFTE (FulltimeTeachingEquivalent): 7<RFTE9sksatau15< RFTE17sks

Belumadadosentetapyang memilikijabatanguru besar

Bebanmengajardosenyang masihtinggi

Pustakawandankualifikasinya: 2A<3

Tidakdipunyaipustakawan berpendidikanS2atauS3 danjumlahpustakawanyang masihsedikit

10

Laboran,teknisi,operator, programer:Cukupdalamjumlah dankualifikasitetapimutu kerjanyasedangsedangsaja

Motivasidalambekerja kurangbagussehinggamutu kerjanyasedangsedang saja

11

Rataratapertemuan Kesibukandosendan pembimbingan/mahasiswa/semester administrasibimbingan (PP):1PP<2 yangbelumtersrtuktur

TindakanPerbaikan: Perluadanyausahapercepatan penambahandosenbaru TindakanPencegahan: Penerimaanmahasiswabaru perludikendalikanagarrasio denganbanyaknyadosenideal TindakanPerbaikan: Perluadanyausahauntuk studilanjutpustakawandan penerimaanpustakawanbaru TindakanPencegahan: Pelayananperpustakaanyang baik TindakanPerbaikan: Perluadanyausahauntuk memotivasikerjalaboran, teknisi,operator,programer TindakanPencegahan: Perlurapatkoordinasiyang rutindenganlaboran, teknisi,operator,programer TindakanPerbaikan: Perluadanyausahaagar bimbinganmahasiswadapat optimal

BPM-UII-YOGYAKARTA/2011

Halaman 78 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Dosenperlumembimbing mahasiswadenganbaik TindakanPerbaikan: Perluadanyausahaagar bimbinganakademikmahasiswa dapatoptimal TindakanPencegahan: Dosenperlumembimbing akademikmahasiswadengan baik TindakanPerbaikan: Perluadanyausahaagar setiapdosenmempunyairuang yangrepresentatif TindakanPencegahan: Kinerjadosenperlu ditingkatkanmeskipunruang dosenterbatas TindakanPerbaikan: Perluadanyausahaagar setiapdosenmempunyaigairah untukmeneliti TindakanPencegahan: Perluadanyamanajemen pembagiantugasdosenagar dosenadawaktuuntuk meneliti TindakanPerbaikan: Perluadanyausahaagar setiapdosenmempunyaigairah untukmenelitidanmahasiswa dilibatkandalamkegiatan tersebut. TindakanPencegahan: Perluadanyakomunikasiyang baikantaradosendengan mahasiswaagardosendapat melibatkanmahasiswadalam penelitiannya. TindakanPerbaikan: Perluadanyausahaagar setiapdosenmempunyaigairah untukmenelitiyang berorientasiHaKI TindakanPencegahan: Perluadanyamanajemen pembagiantugasdosenagar dosenadawaktuuntuk meneliti TindakanPerbaikan: Perluadanyausahaagar kerjasamadenganinstitusidi dalamnegerimeningkat TindakanPencegahan: Perluadanyausaha optimalisasidarikerjasama dalamnegeriyangsudah terjalin TindakanPerbaikan: Perluadanyausahaagar

12

Sistembimbinganakademikcukup efektif,ditunjukkandengan adanyapeningkatanprestasi akademikygcukupsignifikan

Kesibukandosendan administrasibimbingan akademikyangbelum tersrtuktur

13

1ruangkerjauntuk3dosen denganluas:15luas<20m2

Ruangdosenyangterbatas

14

Jumlahpenelitianyangsesuai Kurangnyadosenmeneliti denganbidangkeilmuanPS,yang karenabanyakkesibukan dilakukanolehdosentetapyang yanglain bidangkeahliannyasamadengan PSpertahun,selama3tahun (NK):0<NK<1

15

Persentasemahasiswayang melakukantugasakhirdalam penelitiandosen(PD):8,33% PD<16,67%

Kurangnyadosenmelibatkan mahasiswadalam penelitiannyakarena dosennyapunkurang meneliti

16

KaryakaryaPS/institusiyang telahmemperolehperlindungan HakatasKekayaanIntelektual (HaKI)dalamtigatahun terakhir:Tidakadaskor1

Kurangnyadosenmeneliti sehinggaperolehanHaKI sedikit

17

Adakerjasamadenganinstitusi didalamnegeri,jumlah2. Sebagianrelevandenganbidang keahlianPSataujumlah=1 ygrelevandgnPS

Kurangnyakerjasamadengan institusididalamnegeri

18

Adakerjasamadenganinstitusi diluarnegeri,jumlah=2

Kurangnyakerjasamadengan institusidiluarnegeri

BPM-UII-YOGYAKARTA/2011

Halaman 79 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi Sebagianrelevandenganbidang keahlianPS.Ataujumlah=1yg relevandgnPS AnalisisPenyebab RencanaTindakLanjut kerjasamadenganinstitusidi luarnegerimeningkat TindakanPencegahan: Perluadanyausaha optimalisasidarikerjasama luarnegeriyangsudah terjalin

8.2. ProgramStudiTeknikSipildanPerencanaan
Tabel4.30.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikSipildanPerencanaan Temuan No. Standar Deskripsi 1 Ketercapaiansasaran mutu33% AnalisisPenyebab 1. Beberapabutirsasaranmutu belumdiukur a. Capaiankepuasan indikatorpelanggan minimal60%(butir8) b. RatarataTOEFL mahasiswamenjelang wisuda400(butir9) 2. Beberapabutirsasaranmutu belumtercapai a. Lamastudimahasiswa<5 tahunminimal70% b. IPKmahasiswa>3,o minimal70% c. NilaiPraktekibadah dengannilaiBAIK minimal90% d. lulusanbekerjadalam6 bulanpertamaminimal60 % KegiatandiProdiTeknikSipil sudahterlalubanyakdan keterbatasanpersonil RencanaTindakLanjut TindakanPerbaikan: 1. Segeramemintahasil pengukurankepuasan pelanggankepada fakultas 2. Butirsasaranmutuyang belumtercapaiakan diupayakanuntuk perbaikanperbaikan sistembelajar,himbauan kedosen,perbaikan motivaskekelas TindakanPencegahan: Prodisecaraaktifmeminta fakultasuntukmelakukan pengukurankepuasanpelanggan secararutin

Evaluasiumpanbalik4 tahunsekali

Belumprosesakreditasi internasional

Belumadakesiapandari Prodiuntukproses akreditasiinternasional BelumadadukunganSDMyang memadai

Rasioseleksidengan dayatampung3:2 Rasiomahasiswabaru dengantotalmahasiswa 26% Prosentasemahasiswa asingdengantotalmhsw 0

Masihsedikitrasio mahasiswabaruyang mendaftardiProdiTeknik Sipil Jumlahmahasiswayangada masihrelatifbanyak Belumadainformasidan sistemuntukmahasiswaasing

TindakanPerbaikan: Akandiupayakanuntuktiap tahunintensitaspelaksanaan evaluasidanumpanbalik TindakanPencegahan: Ditambahpersoniluntuk menanganikegiatantersebut TindakanPerbaikan: Akandibentuktimuntuk mendukungkearahakreditasi internasional DisiapkanSDMyangmendukung kegiatantersebut TindakanPencegahan: Diupayakanakreditas internasioanlsecarabertahap TindakanPerbaikan: Dilakukanpromositerus menerusuntukmenjaring mahasiswabaru Diperbaikisistembelajar mengajaragarmahasiswacepat lulus Dibentuksistem/aturanbagi mahasiswaasing TindakanPencegahan: Meningkatkanpromosimelalui SMAdanWeb Mengajukanusulanmahasiswa baru(rowmaterial)yanglebih

BPM-UII-YOGYAKARTA/2011

Halaman 80 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut berkualitas Mengusulkanmahasiswabaru asingbiladiperlukan TindakanPerbaikan: Dibuatsistem(reward)untuk mendorongkegiatanmahasiswa dalambidangnalar,bakat,dan minat TindakanPencegahan: Meningkatkanpembelajaranyang mencakupekstrakurikuler TindakanPerbaikan: Diupayakaninputmahaasiswa baruyanglebihbaik Prosesbelajarmengajarperlu inovasibaru Dibangkitkanmotivasibelajar mahasiswasecaraterusmenerus TindakanPencegahan: Mempersingkataturanyang terlaluberbelitmisalnya aturanPKdanTA TindakanPerbaikan: Dibuatkanunittersendiri untukpengukuran,pelacakan, danperekamandatalulusan TindakanPencegahan: Akandansedangdilakukan tracerstudy TindakanPerbaikan: Dibuatkantim/unittersendiri untukalummi TindakanPencegahan: Akandikirimkanformisian kepadaparaalummiuntuk memberikanmasukankepada Prodi TindakanPerbaikan: Diupayakandengan sistem/rewarddanpunishment unutkmempercepatkenaikan jabatanakademik Mendorongdosenuntukstudi lanjutS3 TindakanPencegahan: Menyusunskedulepenelitian kepadadosentermasukuntuk melanjutkanstudi TindakanPerbaikan: MendorongFakultas/Universitas untukdibuatkansistem tersebut TindakanPencegahan: Biladiperlukanakan mengusulkankepadauniversitas untukmenerimadosenasing TindakanPerbaikan: SAMADENGANPOINKE3 TindakanPencegahan: SAMADENGANPOINKE3 TindakanPerbaikan:

Belumadaprestasi mahasiswa

Tidakadamahasiswayang mempunyaiprestasi

Lulustepatwaktu27%

Inputmahasiswabaruyangkurang baik Prosesbelajarmengajarterlalu monoton(kuno) Motivasibelajarmahasiswayang relatifrendah

Pelacakanlulusanmasih Belumadapersonil(unit)yang sekedarnya bertanggungjawab

Belumadakontribusi aluniuntuknon akademik

Tidakadayangmengurusialummi

Jumlahgurubesar8%

Jabatanfungsionaldosen masihbelumlancar MasihbanyakdosenProdi TeknikSipilyangmempunyai gelarS2

10

Jumlahdosenasing belumada

Belumadayangtertarik untukmenjadidosendiUII karenabelumadasistemnya

11

Belumprosesakreditasi internasional

SAMADENGANPOINKE3

12

Tingkatkehadirandosen

Padasemestergenap

BPM-UII-YOGYAKARTA/2011

Halaman 81 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi 63% AnalisisPenyebab 2009/2010barupertamadi terapkan14kalipertemuan Padasemesterganjil 2010/2011karenaadanya bencanaErupsiMerapi sehinggawaktukegiatan belajarmengajarmenjadi berkurang RencanaTindakLanjut Dipantaudandiingatkan apabilajumlahpertemuanmasih belummemenuhistandar TindakanPencegahan: Dipindahkankekampusyang lain,tetapibeberapamata kuliahtetaptidakbisa berjalan PelaksanaanworkshopPersiapan Kuliah TindakanPerbaikan: Ditingkatkanjumlahkegiatan yangmelibatkantenagaahli dariluarinstitusi Diupayakankenaikananggaran untukkegiatanilmiah TindakanPencegahan: Mengusulkankepadauniversitas untukmengadakantenagaahli bagiProdiTeknikSipil TindakanPerbaikan: Mendoronguntuksemuadosen agarmelakukankegiatan akademiksepertiseminar,loka karya,workshop,dll TindakanPencegahan: Meningkatkanrewardbagidosen yangmelakukankegiatan akademik TindakanPerbaikan: Mendorongdosendosenuntuk mendapatkanhibah Memberikanfasilitas/sarana untukdosenagarmendapatkan hibahhibah TindakanPencegahan: Meningkatkanrewardbagiyang mendapatkanhibahpenelitian TindakanPerbaikan: Mendorongsemuadosenuntuk melakukankegiatanakadenik danprofesidanmenjadi anggotamasyarakatbidang ilmu/profesidaridosen Pemberiandana/insentifagar dosendosenbisamenjadi anggotamasyarakatbidangilmu (akademik)/profesi TindakanPencegahan: Memberikantugaskepadadosen untukmenjadianggotaprofesi internasional TindakanPerbaikan: Membuatdanmengevaluasi kurikulum/SILABI/SAPagar bobottugaslebihdari20% lebihbanyakmatakuliahnya Ditegaskanmatamatakuliah yangmempunyaibobot tugas/PR/makalahlebihdari 20% TindakanPencegahan:

13

Tenagaahli<4

Kurangnyakegiatanprodiyang melibatkantenagaahlidariluar institusi Kekurangandosenuntuk penyelenggaraankegiatanilmiah

14

Kegiatanakademikdosen Masihbanyakdosenyangbelum masihkurang berkaryadalambidangakademik

15

Jarangmendapatkan hibah

Masihbanyakdosenyangenggan mencari/mendapatkanhibahhibah Kurangtertarikakanmanfaat hibah

16

Prosentasekeanggotaan profesiinternasional kurang15%

Masihbanyakdosenyanghanya mengajarsaja Kurangketertarikanuntuk terlibatlebihjauhdalam jejaringandosendalamakademik danprofesi

17

Prosentasetugas>20% kurang25%

SILABImatakuliahkurang mendukung

BPM-UII-YOGYAKARTA/2011

Halaman 82 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut MencantumkandalamSILABI hasilevaluasibahwa p[rosentasetugasminimal20% Kehadirandosen2 Padasemestergenap2009/2010 TindakanPerbaikan: semester50% barupertamaditerapkan14kali Dipantaudandiingatkan pertemuan. apabilajumlahpertemuanmasih Padasemesterganjil2010/2011 belummemenuhistandar karenaadanyabencanaErupsi Merapisehinggawaktukegiatan TindakanPencegahan: belajarmengajarmenjadikurang. Dipindahkandikampuslain, tetapibeberapamatakuliah tetaptidakbisaberjalan. PelaksanaanworkshopPersiapan Kuliah Kehadiranmahasiswa72% Masihbanyakmahasiswayangijin TindakanPerbaikan: tidakkuliah Mendorongdanmemotivasi Adasebagiandosenyang mahasiswaagarmengikuti menggantijammengajar,sehingga kuliah jadwalkuliahmahasiswa Dibuatagartidakada berbenturandenganmatakuliah perubahanjammengajaryang yanglain adadibuatjangansampai bersamaandenganmatakuliah yanglain TindakanPencegahan: Lebihmengetatkanaturan kehadiranmahasiswa Belumadadokumen Karenaonlinesehinggasulit TindakanPerbaikan: pembimbingandosenwali kontrakantaramahasiswadengan Dibuatsistemagar dosenpembimbingakademik terjadikontakantaramahasiswa dengandosenpembimbing akademiksepertipengambilan kartuKHSmaupunkartuujian didosenpembimbingakademik TindakanPencegahan: InsyaAllahakandibuat dokumenpembimbingdosenwali PembimbinganDPAbelum Karenaonlinesehinggasulit TindakanPerbaikan: efektif kontrakantaramahasiswadengan Dibuatsistemagar dosenpembimbingakademik terjadikontakantaramahasiswa dengandosenpembimbing akademiksepertipengambilan kartuKHSmaupunkartuujian didosenpembimbingakademik TindakanPencegahan: Membuataturanbagimahasiswa untukkontakdengandosen pembimbingminimal6kali persemester(awalsemester, tengahsemester,akhir semester) Ratarata penyelesaian KarenaTAwakyubelumterjadwal TindakanPerbaikan: TA12bulan denganbaikdanbelumseperti Dibuatkansistemyang matakuliah.Danmasihbanyak terjadwalsehinggadiupayakan dosenpembimbingTAyangsulit tepatwaktu ditemui MendorongdosenpembimbingTA untukmempercepatpenyelesaian TA TindakanPencegahan: BimbinganmahasiswaTAyang lebihintensif Sudahdibuataturanbarudan sedangberjalanuntukTAdan PK Danapenelitianmasih Masihbanyakdosenyangenggan TindakanPerbaikan:

18

19

20

21

22

23

BPM-UII-YOGYAKARTA/2011

Halaman 83 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi rendah AnalisisPenyebab mencari/mendapatkanhibahhibah Kurangtertarikakanmanfaat hibah RencanaTindakLanjut Mendorongdosendosenuntuk mendapatkanhibah Memberikanfasilitas/sarana untukdosenagarmendapatkan hibahhibah TindakanPencegahan: Meningkatkanfasilitasdan rewardbagidosenuntuk melakukanpenelitian TindakanPerbaikan: Mendorongdosendosenuntuk mendapatkanhibah Memberikanfasilitas/sarana untukdosenagarmendapatkan hibahhibah TindakanPencegahan: MengusulkankeUniversitas untukadanyadanapengabdian masyarakat TindakanPerbaikan: Permintaandatakepadadosen dosenmengenaikinerja terutamadalamdakwah islamiyah TindakanPencegahan: Memberikanformisiantentang DakwahIslamiyahkepadadosen dosensetiapakhirsemester TindakanPerbaikan: Mendorongdosendosenuntuk mengikutiseminar,workshop dankegiatanilmiahlainnya Memberikanfasilitas/sarana untukdosenuntukmengikuti berbagaimacamkaryailmiah Mengusulkankepadakadiv perpustakaanuntukmengadakan Prosiding TindakanPencegahan: Membuatschedulebagidosen dosenuntukmelakukankarya ilmiah Mengusulkanpembahasntentang pengadaanprosidingditingkat fakultas TindakanPerbaikan: Menghimbaukepadapihak terkait(perpustakanpusat) untukmenjalinkerjasama denganperpustakaanperguruan tinggilainagardapatsecara mudahdiaksesolehmahasiswa TindakanPencegahan: MengusulkankeUniversiats untukmeningkatkanpelayanan perpustakaanmelaluwebsite TindakanPerbaikan: Mendorongdosendosenuntuk mengikutiseminar,workshop dankegiatanilmiahlainnya Memberikanfasilitas/sarana untukdosenuntukmengikuti berbagaimacamkaryailmiah

24

Belumadadana Pengabdianmasyarakat

Masihbanyakdosenyangenggan mencari/mendapatkanhibahhibah Kurangtertarikakanmanfaat hibah

25

Belumadarekapdakwah islamiyah

Belummemintadatamengenai DakwahIslamiyahDosen

26

Jumlahdosenasing belumada

Masihbanyakdosenyangenggan mengikutikaryailmiahuntuk diterbitkan/dimasukandalam prosiding

27

Prosidingmasihsedikit Sisteminformasibelummendukung Aksesperpustakaanlain diluarUIIbelumbaik

28

Prosentasekaryailmiah Masihbanyakdosenyangenggan dosenmasihkurang mengikutikaryailmiah

BPM-UII-YOGYAKARTA/2011

Halaman 84 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Standar Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Membuatschedulekaryailmiah bagidosen TindakanPerbaikan: Tetapdiupayakanpengukuran parameterdenganwaktuyang sedikitdenganpenambahanjam kerja Dibentuktimtersebutuntuk mengukurparameter(khususnya alumni) Menghibaukepadadosentidak tetapuntukmelaporkan kegiatanilmiah/dosentidak tetaptersebutuntukdiukur TindakanPencegahan: Penyediaanwaktuyanglebih untukpersiapanauditinternal

29

Banyakparameteryang tidakdihitung

Tidaktersedianyawaktuuntuk mengukurparameterparameter Karenatidaktersedianyasistem untukmengukurparameter parametertersebut Karenaketidaktahuannya pentingnyaparameterkarya ilmiahdosentidaktetap tersebutuntukdiukur

8.3. ProgramStudiTeknikLingkungan
Tabel4.31.TemuanDeskriptifKinerjaPeriode20102011ProdiTeknikLingkungan Temuan No. Standar Deskripsi 1 Lulusanbekerjadalamenambulanpertama 69.5% 2 Tepatwaktustudisebanyak51,07%, 3 4 5 Indikatorkepuasanpelangganbelumdiukur Rasiocalonmahasiswayangikutseleksi: dayatampung=1,24. PersentasemahasiswaDOataumengundurkan dirisebanyak17,65%. Mahasiswayangtidakaktifsejakawal: 10.60%MahasiswayangDO4semester:7,05% Duabentukpartisipasiketerlibatanalumni :keterlibatankegiatanakademik, pengembanganjejaring.Kriteriapenerimaan 4bentukpartisipasi. Jumlahdosentidaktetap9org,jumlah seluruhdosen26org,persentasedosen tidaktetap35%. Jumlahtenagaahli/pakarsebagaipembicara dariluarPTsebanyak4org. Rataratakehadirandosenmengajarsesuai standar50,6%. RataratabanyaknyamahasiswaperDPAper semestersebesar30mahasiswa. Bahanpustakaberupaprosidingseminar belumtersediadiperpustakaan. Belum terdapat karya dosen prodi yang telahmendapatperlindunganHAKI. AnalisisPenyebab RencanaTindakLanjut

8 9 10 11 12

B. HasilPengukuranKinerjaLaboratoriumPeriode20102011
Evaluasi kinerja program studi periode 20102011 juga dilakukan untuk laboratorium yang ada di bawah koordinasi prodi atau fakultas. Unit yang
BPM-UII-YOGYAKARTA/2011 Halaman 85 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

dikategorikan dalam kelompok laboratorium adalah Pusat Studi, Pusat pendidikan, Departemen dan Laboratorium sendiri. Program studi yang tidak memiliki unit laboratoriumadalahProdiAkuntansi,IlmuEkonomidanManajemensementaraprogram studi yang membawahi unit lab adalah Prodi Ilmu Hukum, Pendidikan Dokter, Statistika, Ilmu Kimia, Farmasi, Psikologi, I.Komunikasi, T.Mesin,T. Elektro, T. Kimia, T. Industri, T. Informatika, T. Arsitektur, T. Sipil, T. Lingkungan. Berbeda dengan subunit lain, khusus untuk subunit PPPI dan PKBHI, pengelolaannyadilakukanolehFakultasIlmuAgamaIslam. Hasil pengukuran hasil kinerja akan disajikan dalam 2 bentuk data, yaitu data angka berupa indeks kinerja (skala 04) dan data temuan secara deskriptif yangdilengkapidengananalisispenyebabdantindaklanjutnya. Urutan penyajian hasil pengukuran kinerja unit yang ada di bawah koordinasiprogramstudidilakukansesuaiurutanabjadnamafakultasnya,yaitu: 1. FakultasHukum 1.1. UnitPusatProdiIlmuHukum Hasil kinerja secara kuantitatif unit PKBH dan Pusdiklat dalam bentuk indeks kinerja bisa dilihat pada table 4.30, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing unit bisadlihatpadatable4.324.34.
Tabel4.32.HasilCapaianKinerjaPeriode2010UnitPKBHdanPusdiklatProdiIlmuHukum No IndikatorKinerja IndeksKinerja PKBH Pusdiklat 4.00 3.17 4.00 4.00 4.00 3.00 4.00 2.00 4.00 4.00 3.50 3.50 4.00 3.00 4.00 2.50 3.94 3.15

1 ProsespencapaianSasaranMutuUnit(SMU) 2 Prosespencapaianprogram/rencanakerjarutin 3 Prosespencapaianprogram/rencanakerjapengembanganunit 4 ProseskoordinasiinternalunitpelaksanaanprogramkerjarutintindaklanjutRTM 5 ProsesPenerapanProsedurKerja(PK) 6 Prosespemahaman,realisasidanevaluasiDaftarCatatanMutu 7 ProsesevaluasiKedisiplinanKerja 8 ProsespengendaliandanevaluasiKeluhanPelanggan IndeksKinerja Tabel4.33.TemuanDeskriptifKinerjaUnitPeriode2010PHBH Temuan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Temuanyanglaludinyatakanditutup. Semulapembekalanhokumkepada paramedicRSUDGunungKiduldialihkan keSKPD(SatuanKerjaPemerintah Daerah)Kab.GunungKidul 2 DCMyangberlakutersedia,sesuaiPM yangberlaku,hanyadiotorisasiunit belumdiotorisasiolehBPM

No.

Tabel4.34.TemuanDeskriptifKinerjaUnitPeriode2010Pusdiklat Temuan AnalisisPenyebab Deskripsi

RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 86 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Temuan No. Deskripsi 1 TemuanAMItahunlaluyangbelum terselesaikan,yaitu:Penghapusan dokumenbelumdilaksanakan Layoutruangyangpermanenbaru sebagian 2 SMUbelumdiotorisasiolehBPM.Hanya diotorisasiolehDekandanKepala Pusdiklat Rapatkoordinasiinternal(RTMunit) dilakukansecarainformal/secara lisan/tidakmelalui Evaluasipelaksanaandantindak lanjutRTMdilakukansecara informal/secaralisan/tidakmelalui rapat DCMyangberlakutersedia,tetapi tidaksesuaiPMyangberlaku Evaluasidantindaklanjut kedisiplinankerjasebenarnyadibahas dalamrapat,tetapitidakditulis dalamnotulen Tersediadokumenkeluhanpelanggan, tetapitidaksesuaiPM.Dokumen keluhanpelangganberupakuisioner yangdibagikankepadasemuapeserta pelatihan Terdapatevaluasidantindaklanjut terhadapkeluhanpelanggan,tetapi tidaksesuaidenganPM AnalisisPenyebab RencanaTindakLanjut

5 6

2. FakultasIlmuAgamaIslam:SubunitPusatStudi Hasil kinerja PKBHI dan PPPI secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.35, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing unit bisadlihatpadatable.4.36dan4.37
Tabel4.35.IndeksKinerjaUnitPeriode2010UnitPKBHIdanPPPI No 1 2 3 4 5 6 7 8 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogram/rencanakerjarutin Pencapaianprogram/rencanakerjapengembanganunit KoordinasiinternalunitpelaksanaanprogramkerjarutindantindaklanjutRTM PenerapanProsedurKerja(PK) Pemahaman,realisasidanevaluasiDaftarCatatanMutu EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan IndeksKinerja PKBHI PPPI 2.00 2.50 2.20 2.40 0 1.75 3.67 4.00 2.67 2.67 3.50 3.50 1.00 2.00 4.00 4.00 2.38 2.85

IndeksKinerja

Tabel4.36.TemuanDeskriptifKinerjaUnitPeriode2010UnitPKBHI Temuan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutubelumdiotorisasi Belumtahubilasasaran TindakanPerbaikan: mutuharusdiukurdengan Mengukurdanmengevaluasisasaran carabagaimana mutuyangada TindakanPencegahan Mengikutipelatihansasaranmutu& menyusunpedomansasaranmutu 2 Lingkupkerjabelumsepenuhnya sesuaidenganSMU TindakanPerbaikan: 3 Programkerjarutinbelum Ketikamembuatprogram kerjabelummengantisipasi Melakukanperencanaanprogramkerja semuanyadilaksanakan(PKPA pencapaiannya belumdilakukan) yanglebihterencana

BPM-UII-YOGYAKARTA/2011

Halaman 87 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Dibuatformprogramkerjaberdasar WTyangberlaku TindakanPerbaikan: Melakukanotorisasiterhadap dokumendokumenyangada TindakanPencegahan: Dilakukanevaluasiterhadapdokumen dokumenyangditerbitkan TindakanPerbaikan: DibuatjadwalsosialisasiSMU TindakanPencegahan: DilakukansosialisasiSMUmelalui mediayanglain(missalWeb) TindakanPerbaikan: DibuatformpengukuranparameterSMU secarakonsistendanmenyeluruh TindakanPencegahan Dilakukanevaluasisecararutin terhadappengisianformpengukuran parameterSMU TindakanPerbaikan: MelakukanevaluasiSMU TindakanPencegahan: Dibuatformevaluasiuntuksetiap sasaranmutu TindakanPerbaikan: Dibuatjadwalsosialisasiprogram kerjadenganmediaweb TindakanPencegahan Dilakukansosialisasiprogramkerja melaluimediayanglain(misalWeb) TindakanPerbaikan: Diilakukanpertemuandenganpihak pihakyangbersangkutanguna menentukanprogramkerja pengembangan TindakanPencegahan Dilakukanpertemuandenganterjadwal untukmenentukanprogramkerja pengembangankemudiandilaksanakan &disosialisasikansertadievaluasi tidaklanjutnya TindakanPerbaikan: Dibuatform&penjadwalanuntuk evaluasiPK TindakanPencegahan Dilakukanpenjadwalanuntukevaluasi PK TindakanPerbaikan: Mengukurdanmengevaluasisasaran mutuyangada

4 5 6 7 8

NotulenRTMFtidaktersedia Metodepengelolaandokumenbelum sepenuhnyasesuaidenganDCM Jenisdokumenbelumtersedia semuanya Beberapa lingkup kerja belum sesuaidengansasaranmutu Beberapadokumenpencapaian sasaranbelumdiotorisasi

Belumpahambahwasemua dokumenperluotorisasi

SMUdisosialisasimelaluirapat

SosialisasiSMUhanya melaluirapatbelum dilakukancarasosialisasi yanglain

10

BeberapaparameterSMUyangada belumtercapaipelaksanaannya

Pengukuranparameterbelum dilakukansecarakonsisten danmenyeluruh

11

BelumadaevaluasiSMU

Belumdilakukanevaluasi SMU

12

sosialisasi program kerja hanya Sosialisasiprogramkerja melaluirapatdanditempel hanyamelaluirapat& ditempelbelumdilakukan carasosialisasiyanglain

13

Program kerja pengembangan belum Belumtersediaprogram tersedia kerjapengembangan

14

Prosedurkerjabelumdievaluasi

Belumtahukalauprosedur kerjaharusdievaluasi

15

Sasaranmutuunitbelumdiukur secarakonsisten

Belumtahubilasasaran mutuharusdiukurdengan carabagaimana

BPM-UII-YOGYAKARTA/2011

Halaman 88 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan Mengikutipelatihansasaranmutu& menyusunpedomansasaranmutu TindakanPerbaikan: Tetapdilakukanevaluasidisiplin kerjawalaustatushonorer TindakanPencegahan Tetapdilakukanevaluasidisiplin kerjawalaustatushonorer,secara rutin,bisabekerjasamadenganDOSDM

16

Tidakevaluasidisiplinkerja

KaryawanPKBHIberstatus honorer

Tabel4.37.TemuanDeskriptifKinerjaUnitPeriode2010UnitPPPI Temuan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 BukuPedomanPelaksanaanPPL Belummengetahuiprosedur TindakanPerbaikan: belumdiberikodeidentifikasi pemberiankodeidentifikasi Memberikankodeidentifikasibuku sesuaidenganPM02UII bukupedoman pedomanpelaksanaanPPLsesuai ketentuanPM02UII TindakanPencegahan Melakukansosialisasitentang prosedurPM02UII 2 ProsedurkerjaPenelitian& PengabdianMasyarakatsertaPPL belumterbarukansesuaiPMUII 03&PMUII02 3 Belumpernahdilakukanevaluasi MengevaluasiPKyangada TindakanPencegahan PK disesuaikandengan MelakukanevaluasiPKsecara perkembanganyangterjadi periodik 4 PenyusunanBukuPedoman PenyusunanBukuPedoman TindakanPerbaikan: PelaksanaanPPL,belumadadasar PelaksanaanPPL,belum Menambahkandasarperaturan hukumnya kurikulumyangberlakudalambuku dikaitkandenganperaturan kurikulumyangberlaku pedomanpelaksanaanPPL TindakanPencegahan Setiappenyusunanbukupedoman, selaludikaitkandenganprosedur mutuUII 5 Sasaranmutuunitbelumdiukur Belumtahubilasasaranmutu TindakanPerbaikan: secarakonsisten harusdiukurdengancara Mengukurdanmengevaluasisasaran bagaimana mutuyangada TindakanPencegahan Mengikutipelatihansasaranmutu &menyusunpedomansasaranmutu 6 Beberapalingkupkerjabelum Belumtahukalaulingkup TindakanPerbaikan: sesuaidengansasaranmutu kerjaberhubungandengan Memahamipedomansistemmutu sasaranmutu TindakanPencegahan Mengikutipelatihansistemmutu, khususnyatentangsasaranmutu 7 BeberapaparameterSMUyangada Pengukuranparameterbelum TindakanPerbaikan: belumtercapaipelaksanaannya dilakukansecarakonsisten Dibuatformpengukuranparameter danmenyeluruh SMUsecarakonsistendan menyeluruh TindakanPencegahan Dilakukanevaluasisecararutin terhadappengisianform pengukuranparameterSMU 8 Beberapadokumenpencapaian Belumpahambahwasemua TindakanPerbaikan: sasaranbelumdiotorisasi dokumenperluotorisasi Melakukanotorisasiterhadap dokumendokumenyangada TindakanPencegahan

BPM-UII-YOGYAKARTA/2011

Halaman 89 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. Temuan Deskripsi AnalisisPenyebab RencanaTindakLanjut Dilakukanevaluasiterhadap dokumendokumenyangditerbitkan TindakanPerbaikan: MelakukanevaluasiSMU TindakanPencegahan Dibuatformevaluasiuntuksetiap sasaranmutu TindakanPerbaikan: Melakukanevaluasiprogramkerja dikaitakndenganWT TindakanPencegahan Dibuatformevaluasiprogram kerjaberdasarWTyangberlaku TindakanPerbaikan: Melakukantindakanbantuanpada SDMyangkompetendenganWeb TindakanPencegahan Dibuatjadwalkoordinasidengan bagianSIM TindakanPerbaikan: Melakukanevaluasiprogramkerja rutin TindakanPencegahan Dibuatjadwalkoordinasidengan seluruhbagiandiFakultasuntuk menetukanprogramkerjayang efisien&efektif TindakanPerbaikan: Melakukanevaluasiprogramkerja rutin TindakanPencegahan Dibuatjadwalkoordinasiuntuk melakukanevaluasiprogramkerja rutin TindakanPerbaikan: Melakukanevaluasiprogramkerja pengembanganyangmengacupada SMU TindakanPencegahan Dibuatjadwalkoordinasiuntuk melakukanevaluasiprogramkerja pengembangandenganmengacupada SMU TindakanPerbaikan: Melakukansosialisasiprogram kerjapengembangandengan ditempeldanweb TindakanPencegahan Dibuatjadwaluntukmelakukan sosialisasiprogramkerja pengembangandenganditempeldan web TindakanPerbaikan: Melakukanevaluasiprogramkerja pengembangan TindakanPencegahan Dibuatjadwaluntukmelakukan evaluasiprogramkerja pengembangan TindakanPerbaikan:

BelumadaSMU

BelumdilakukanevaluasiSMU

10

Programkerjabelumsepenuhnya dikaitkandenganWT

Ketikamembuatprogramkerja belummengaitkandenganWT

11

Sosialisasiprogramkerja melaluiwebbelumdilakukan

Mengalamikesulitanuntuk memasukankeWeb

12

Belumsemuaprogramkerjarutin dilakukan

Adanyakendalakeuangan dalammendukungprogramkerja rutin

13

Belumadaevaluasiprogram kerjarutin

Tidak/belumdilakukan evaluasiprogramkerjarutin

14

Programkerjapenegembangan belumsepenuhnyamendukungSMU

Tidak/belumdilakukan evaluasiprogramkerja pengembangan

15

Sosuialisasiprogramkerja dilakukanmelaluirapatsaja

Tidak/belumdilakukan sosialisasimelaluiwebdan ditempel

16

Belumadaevaluasiprogramkerja Tidak/belumdilakukan pengembangan evaluasiprogramkerja pengembangan

17

Belumadaevaluasiprosedur

Tidak/belumdilakukan

BPM-UII-YOGYAKARTA/2011

Halaman 90 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. kerja Temuan Deskripsi AnalisisPenyebab evaluasiprosedurkerja RencanaTindakLanjut Melakukanevaluasiprosedurkerja TindakanPencegahan Dibuatjadwaluntukmelakukan evaluasiprosedurkerja TindakanPerbaikan: Melakukanevaluasidalam pengelolaandokumen TindakanPencegahan Dibuatjadwaluntukmelakukan pengelolaandokumen TindakanPerbaikan: Melakukanpengarsipandarisetiap kegiatanprogramkerjasesuai systemmutu TindakanPencegahan Dibuatformpengarsipandokumen sesuaikegiatanyangdilakukan dandilakukanevaluasi TindakanPerbaikan: Melakukanpenyusunantugasharian staff TindakanPencegahan Dibuatformsusunantugasharian staff TindakanPerbaikan: Melakukanotorisasidisiplin kerja TindakanPencegahan Membiasakanmelakukanotorisasi untuksetiapdokumenyangada

18

Pengelolaandokumenbelum sepenuhnyadilakukandenganbaik

Pengarsipandokumenbelum sesuaidenganDCM

19

Belumtersediadokumensecara Pengarsipandokumentidak penuh lengkap

20

Belumtersediadaftartugas harianstaff

Tidak/belumdilakukan penyusunantugasharianstaff

21

Evaluasidisiplinkerjabelum diotorisasi

Tidak/belumdilakukan otorisasievaluasidisiplin kerja

3. FakultasKedokteran: 3.1. UnitDepartemenProdiPendidikanDokter HasilkinerjaUnitDepartemensecarakuantitatifdalambentukindekskinerjabisa dilihatpadatable4.38,sementarauntukhasiltemuansecaradeskriptif,analisis penyebab dan rencana tindak lanjut untuk masingmasing unit bisa dlihat pada table.4.394.44
Tabel4.38.IndeksKinerjaPeriode2010UnitDepartemenProdiPendidikanDokter HasilCapaianKinerjaDepartemen No 1 2 3 4 5 6 7 8 9 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan KemampuanKepemimpinanoperasional:proses koordinasiinternalunitdantindaklanjut RTM Pencapaianprogrampendidikantingkat sarjanakedokteran ProsesKaryaTulisIlmiahmahasiswa KoordinasidenganTimBlokterkaitmateri blokyangsesuaidengandepartemennya Pencapaianprogrampendidikantingkat pendidikanklinik PenerapanProsedurKerja(PK)untukLab
Obstetri Ginekologi IlmuBedah Ilmu Penyakit Syaraf IlmuKed. Jiwa Ilmu Penyakit THT IlmuKed Forensik

2.50 0.33 0.00 1.33 3.40 * 3.00 3.33 0.00

2.50 0.25 0.25 1.33 3.40 * 3.00 3.33 0.00

3.50 4.00 4.00 3.67 3.50 4.00 4.00 4.00 3.67

3.50 4.00 4.00 3.67 3.50 4.00 4.00 4.00 3.67

3.33 4.00 3.75 3.67 3.50 4.00 4.00 4.00 3.67

3.50 4.00 4.00 3.67 3.50 4.00 4.00 4.00 3.67

BPM-UII-YOGYAKARTA/2011

Halaman 91 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

HasilCapaianKinerjaDepartemen No 10 IndikatorKinerja
Obstetri Ginekologi IlmuBedah Ilmu Penyakit Syaraf IlmuKed. Jiwa Ilmu Penyakit THT IlmuKed Forensik

Pemahaman,realisasidanevaluasiDaftar CatatanMutu(DCM) 11 EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhan 12 Pelanggan IndeksKinerja

0.75 2.00 2.00 1.70

1.00 2.00 2.00 1.73

0.00 2.00 2.00 3.19

0.00 2.00 3.00 3.28

0.00 2.00 3.00 3.24

0.00 2.00 2.00 3.19

Tabel4.39.IndeksKinerjaPeriode2010UnitDepartemenProdiPendidikanDokter(Lanjutan) HasilCapaianKinerjaDepartemen No 1 2 3 IndikatorKinerja


Anestesi Radiologi Ilmu Penyakit Mata Ilmu Kesehatan Anak Ilmu Penyakit Dalam IlmuKes Kulit& Kelamin

PencapaianSasaranMutuUnit(SMU) 3.50 3.50 3.50 3.50 3.33 2.00 Pencapaianprogramkerjarutin 4.00 4.00 4.00 4.00 1.50 1.50 Pencapaianprogramkerjapengembangan 4.00 4.00 4.00 4.00 1.00 0.75 KemampuanKepemimpinanoperasional:proses 4 koordinasiinternalunitdantindaklanjut 3.67 3.67 3.67 3.67 2.00 1.67 RTM Pencapaianprogrampendidikantingkat 5 3.50 3.50 3.50 3.50 2.60 2.60 sarjanakedokteran 6 ProsesKaryaTulisIlmiahmahasiswa 4.00 4.00 4.00 4.00 * * KoordinasidenganTimBlokterkaitmateri 7 4.00 4.00 4.00 4.00 4.00 4.00 blokyangsesuaidengandepartemennya Pencapaianprogrampendidikantingkat 8 4.00 4.00 4.00 4.00 3.00 3.67 pendidikanklinik 9 ProsesPenerapanProsedurKerja(PK) 3.67 3.67 3.67 3.67 2.67 4.00 10 Prosespemahaman,realisasi&evaluasiDCM 0.00 0.00 0.00 0.00 1.25 2.25 11 ProsesdanevaluasiKedisiplinanKerja 2.00 2.00 2.00 2.00 0.50 1.00 12 ProsespengendaliandanevaluasiKP 2.00 2.00 2.00 2.00 2.50 4.00 IndeksKinerja 3.19 3.19 3.19 3.19 2.21 2.49 Tabel4.40.TemuanDeskriptifPeriode2010UnitDep.ObstetriGinekologiProdiPendidikanDokter TemuanDep.ObstetriGinekologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutuUnit(SMU): Stafdidipartemenmasih TindakanPerbaikan: 1. BelumadasosialisasiSMU 1. AkandilakukanotorisasiSMU barubarupertamakali selaindiforumrapat olehDekan dilakukanaudit 2. Dokumenevaluasiterhadap 2. AkanDilakukansosialisasi ketercapaianSMUtidak diforumrapat,ditempeldan tersedia melaluiWEB 3. AkandilakukanevaluasiSMU khususnyapadaSMUbutir3 karenaidentikdenganbutir2. TindakanPencegahan 1. PSMFperlumembantudan memonitorTindakanPerbaikan 2. Diperlukanpelatihanpenyusunan SMU Stafdidipartemenmasih 2 Programkerja TindakanPerbaikan: barudanbarupertamakali Akandisusunprogramkerjarutindan ProgramKerjaRutin: dilakukanaudit 1. Tidaktersedia pengembangantermasuksosialisasi 2. Tidakadasosialisasi danevaluasinya 3. Pelaksanaanprogramkerja TindakanPencegahan 1. PSMFperlumembantudan rutintidakterukur memonitorTindakanPerbaikan 4. Evaluasiterhadapprogram 2. DekandanKaProdiharus kerjarutintidak memasitikatersusunnyaprogram terdokumentasi kerjadiDepartemen ProgramKerjaPengembangan: 1. Tidaktersedia 2. Tidakadasosialisasi 3. Pelaksanaanprogramkerja rutintidakterukur 4. Evaluasiterhadapprogram kerjarutintidak

BPM-UII-YOGYAKARTA/2011

Halaman 92 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.ObstetriGinekologi AnalisisPenyebab No. Deskripsi terdokumentasi 3 RapatTinjauanManajemen(RTM): Stafdidipartemenmasih 1. RapatRTMunitbelumdilakukan barubarupertamakali secararutindantersetruktur dilakukanaudit 2. Belumdilakukanevaluasi pelaksanaandantindaklanjut RT 4 ProsedurKerja(PK): 1. BelumtersediaPK 2. ImplementasiPKtidakterukur 3. BelumdilakukanevaluasiPK 4. Belumtersediadokumendan prosedurkeluhanpelanggan Stafdidipartemenmasih barudanbarupertamakali dilakukanaudit RencanaTindakLanjut TindakanPerbaikan: Kepaladepartemenakanmenyusun skedulurapatdanevaluasiRTM TindakanPencegahan PSMFperlumembantudanmemonitor tindakanperbaikan TindakanPerbaikan: AkandisusunPKbeserta implementasinya TindakanPencegahan 1. PSMFperlumembantudan memonitortindakanperbaikan 2. Diperlukanpelatihanpenyusunan PK TindakanPerbaikan: Akandisusundandilakukanevaluasi DCM TindakanPencegahan 1. PSMFperlumembantudan memonitortindakanperbaikan 2. Diperlukanpelatihanpenyusunan DCM

DaftarCatatanMutu(DCM): 1. DCMbelumsesuaistandar (tidakditempel,tidak menunjukantempatpenyimpanan danbanyakdokumenyangbelum masukdiDCM) 2. DCMtidakditempel 3. Carapengarsipandan penyimpananmayoritasbelum sesuaidenganDCM 4. Banyakdokumenyangbelum masukdiDCM Tidaktersediadokumenevaluasi kedisiplinankerja.

Staftdidipartemenmasih barubarupertamakali dilakukanaudit

Stafdidipartemenmasih barudanbarupertamakali dilakukanaudit

TindakanPerbaikan: Akandisusundokumenevaluasi kedisiplinankerja. TindakanPencegahan Fakultas(Wakildekan)perlu mengkoordinasipelaksanaanevaluasi kedisiplinankerja.

Tabel4.41.TemuanDeskriptifPeriode2010UnitDep.IlmuBedahProdiPendidikanDokter TemuanDepartemenIlmuBedah AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutuUnit(SMU): Stafdidipartemenmasih TindakanPerbaikan: 1. Belumadasosialisasi 1. AkandilakukanotorisasiSMU barubarupertamakali SMUselaindiforum olehDekan dilakukanaudit rapat 2. AkanDilakukansosialisasi 2. Dokumenevaluasi diforumrapat,ditempeldan terhadapketercapaian melaluiWEB SMUtidaktersedia 3. AkandilakukanevaluasiSMU khususnyapadaSMUbutir3 karenaidentikdenganbutir2. TindakanPencegahan 1. PSMFperlumembantudan memonitortindakanperbaikan 3. Diperlukanpelatihanpenyusunan SMU 2 Programkerja TindakanPerbaikan: Stafdidipartemenmasih ProgramKerjaRutin: barudanbarupertamakali Akandisusunprogramkerjarutin 1. Tidaktersedia dilakukanaudit danpengembangantermasuk 2. Tidakadasosialisasi sosialisasidanevaluasinya 3. Pelaksanaanprogramkerja TindakanPencegahan 1. PSMFperlumembantudan rutintidakterukur memonitortindakanperbaikan 4. Evaluasiterhadapprogram 2. DekandanKaProdiharus kerjarutintidak memasitikatersusunnyaprogram terdokumentasi kerjadiDepartemen ProgramKerjaPengembangan: 1. Tidaktersedia 2. Tidakadasosialisasi 3. Pelaksanaanprogramkerja rutintidakterukur 4. Evaluasiterhadapprogram

BPM-UII-YOGYAKARTA/2011

Halaman 93 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanDepartemenIlmuBedah AnalisisPenyebab Deskripsi kerjarutintidak terdokumentasi RapatTinjauanManajemen(RTM): Stafdidipartemenmasih 3. RapatRTMunitbelumdilakukan barubarupertamakali secararutindantersetruktur dilakukanaudit 4. Belumdilakukanevaluasi pelaksanaandantindaklanjut RT ProsedurKerja(PK): 5. BelumtersediaPK 6. ImplementasiPKtidakterukur 7. BelumdilakukanevaluasiPK 8. Belumtersediadokumendan prosedurkeluhanpelanggan Stafdidipartemenmasih barudanbarupertamakali dilakukanaudit RencanaTindakLanjut

DaftarCatatanMutu(DCM): 5. DCMbelumsesuaistandar (tidakditempel,tidak menunjukantempatpenyimpanan danbanyakdokumenyangbelum masukdiDCM) 6. DCMtidakditempel 7. Carapengarsipandan penyimpananmayoritasbelum sesuaidenganDCM 8. Banyakdokumenyangbelum masukdiDCM Tidaktersediadokumenevaluasi kedisiplinankerja.Hanya terdapatsatustafyangmelayani beberapadepartemensekaligus.

Staftdidipartemenmasih barubarupertamakali dilakukanaudit

TindakanPerbaikan: Kepaladepartemenakanmenyusun skedulurapatdanevaluasiRTM TindakanPencegahan PSMFperlumembantudanmemonitor tindakanperbaikan TindakanPerbaikan: AkandisusunPKbeserta implementasinya TindakanPencegahan 3. PSMFperlumembantudan memonitortindakanperbaikan 4. Diperlukanpelatihanpenyusunan PK TindakanPerbaikan: Akandisusundandilakukanevaluasi DCM TindakanPencegahan 3. PSMFperlumembantudan memonitortindakanperbaikan 4. Diperlukanpelatihanpenyusunan DCM

Stafdidipartemenmasih barudanbarupertamakali dilakukanaudit

TindakanPerbaikan: Akandisusundokumenevaluasi kedisiplinankerja. TindakanPencegahan Fakultas(Wakildekan)perlu mengkoordinasipelaksanaanevaluasi kedisiplinankerja.

Tabel4.42.TemuanDeskriptifPeriode2010UnitDep.IlmuPenyakitSyarafProdiPendidikanDokter TemuanDep.IlmuPenyakitSyaraf AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen TindakanPerbaikan: khususmengevalusiSMUyang Akandilakukanrapatrutinwalaupun sudahdanbelumtercapaibelum denganpersonilyangterbatas dilakukan,belumadapenjelasan akarpermasalahan.Rapat TindakanPencegahan: Akan dilakukan evaluasi pelaksanaan evaluasiadaditingkatProdi rapatdandibuatprosedurkerja. atauFakultas. 2 Rapatkoordinasiinternalunit diDepartemenbelumdilakukan, Termasukrapatmengevaluasi ProgramKerjaRutindan Pengembangan.Rapatmenjadisatu denganProdiatauFakultas Kedokteranuntuksemuakegiatan yangberhubungandenganWT (tidakadakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunan silabusbelumdilakukandi departemen,evaluasidilakukan sesuaijadwalblokolehProdi ataurapatFakultas. 4 Metodesosialisasisilabuslewat webbelumdilakukan 5 Belumadarapatkhususuntuk mengevaluasiPK,walaupunsudah adaPKyangdirevisisebanyak1 dari13PK(7%),semuabelum

BPM-UII-YOGYAKARTA/2011

Halaman 94 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.IlmuPenyakitSyaraf No. Deskripsi diotorisasidandisesuaikan denganformatPM 6 BelumtersediaDaftarCatatan Mutu(DCM) AnalisisPenyebab RencanaTindakLanjut

BelumdibuatDCM

BelumadasosialisasiDaftar CatatanMutu(DCM)

BelumdibuatDCMdan evaluasiDCM

Belumdilakukanpengelolaan dokumen

Belumdilakukanpengelolaan dokumenmelaluiDCM

BelumtersediaDCMyangberlaku

BelumdibuatDCM

10

Belumtersediadokumen pengukuranevaluasikedisiplinan kerjastafdidepartemen, evaluasimenjadisatudengan Fakultas(jumlahstafdi departementerbatas)

Pengukurandilakukandi Fakultas

11

Tersediadokumenkeluhan pelanggantetapibelumsesuai denganPM

Dokumenkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

12

Evaluasidantindaklanjut terhadapkeluhanbelumsesuai denganPM

Dokumenevaluasidantindak lanjutkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: AkandibuatDCMdandievalusi secaraberkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. TindakanPerbaikan: Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerja departemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform keluhanpelangandanhasil penanganannya. TindakanPerbaikan: Dokumenevaluasidantindaklanjut keluhanpelangganakanmenggunakan formyangsesuaidenganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

Tabel4.43.TemuanDeskriptifPeriode2010UnitDep.IlmuKedokteranJiwaProdiPendidikanDokter TemuanDep.IlmuKedokteranJiwa AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen PersonildepartemenIKJ TindakanPerbaikan: khususmengevalusiSMUyangsudah Akandilakukanrapatrutinwalaupun yangterbatas danbelumtercapaibelum denganpersonilyangterbatas dilakukan,belumadapenjelasan TindakanPencegahan Akandilakukanevaluasipelaksanaan akarpermasalahan.Rapatevaluasi rapatdandibuatprosedurkerja. adaditingkatProdiatauFak. 2 Rapatkoordinasiinternalunitdi

BPM-UII-YOGYAKARTA/2011

Halaman 95 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.IlmuKedokteranJiwa No. Deskripsi Departemenbelumdilakukan, Termasukrapatmengevaluasi ProgramKerjaRutindan Pengembangan.Rapatmenjadisatu denganProdiatauFakultas Kedokteranuntuksemuakegiatan yangberhubungandenganWT(tidak adakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunansilabus belumdilakukandidepartemen, evaluasidilakukansesuaijadwal blokolehProdiataurapat Fakultas. 4 Metodesosialisasisilabuslewat webbelumdilakukan 5 Belumadarapatkhususuntuk mengevaluasiPK,walaupunsudah adaPKyangdirevisisebanyak1 dari13PK(7%),semuabelum diotorisasidandisesuaikandengan formatPM 6 BelumtersediaDaftarCatatanMutu (DCM) AnalisisPenyebab RencanaTindakLanjut

BelumdibuatDCM

BelumadasosialisasiDaftar CatatanMutu(DCM)

Belumdilakukanpengelolaan dokumen

Belumdilakukan pengelolaandokumen melaluiDCM

BelumtersediaDCMyangberlaku

BelumdibuatDCM

10

Belumtersediadokumenpengukuran evaluasikedisiplinankerjastafdi departemen,evaluasimenjadisatu denganFakultas(jumlahstafdi departementerbatas)

Pengukurandilakukandi Fakultas

11

Tersediadokumenkeluhanpelanggan tetapibelumsesuaidenganPM

Dokumenkeluhanpelanggan belummenggunakanform yangsesuaidenganPM

TindakanPerbaikan: AkabdibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: AkandibuatDCMdandievalusi secaraberkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. TindakanPerbaikan: Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan Akandilakukanevaluasisetiap semesterkedisiplinankerja departemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpenggunaanform keluhanpelangandanhasil penanganannya.

Tabel4.44.TemuanDeskriptifPeriode2010UnitDep.IlmuPenyakitTHTProdiPendidikanDokter

BPM-UII-YOGYAKARTA/2011

Halaman 96 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.IlmuPenyakitTHT No. Deskripsi 1 SasaranMutuUnit(SMU)barutercapai 75%seharusnya100% 2 Pelaksanaanprogramkerja pengembangan75%seharusnya100% 3 Rapatevaluasididepartemenkhusus mengevalusiSMUyangsudahdanbelum tercapai,belumdilakukan,belumada penjelasanakarpermasalahan.Rapat evaluasiadaditingkatProdiatau Fakultas. 4 Rapatkoordinasiinternalunitdi Departemenbelumdilakukan,Termasuk rapatmengevaluasiProgramKerja RutindanPengembangan.Rapatmenjadi satudenganProdiatauFakultas Kedokteranuntuksemuakegiatanyang berhubungandenganWT Evaluasiprosespenyusunansilabus belumdilakukandidepartemen, evaluasidilakukansesuaijadwalblok olehProdiataurapatFakultas. Metodesosialisasisilabuslewatweb belumdilakukan Belumadarapatkhususuntuk mengevaluasiPK,walaupunsudahada PKyangdirevisisebanyak1dari13 PK(7%),semuabelumdiotorisasidan disesuaikandenganformatPM BelumtersediaDaftarCatatanMutu (DCM) AnalisisPenyebab TindakanPerbaikan: Akandilakukanrapatrutinwalaupun denganpersonilyangterbatas TindakanPencegahan: Akan dilakukan evaluasi pelaksanaan rapatdandibuatprosedurkerja. RencanaTindakLanjut

6 7

BelumdibuatDCM

BelumadasosialisasiDaftarCatatan Mutu(DCM)

BelumdibuatDCMdan evaluasiDCM

10

Belumdilakukanpengelolaandokumen

Belumdilakukan pengelolaandokumen melaluiDCM

11

BelumtersediaDCMyangberlaku

BelumdibuatDCM

12

Belumtersediadokumenpengukuran evaluasikedisiplinankerjastafdi departemen,evaluasimenjadisatu denganFakultas(jumlahstafdi departementerbatas)

Pengukurandilakukan diFakultas

13

Tersediadokumenkeluhanpelanggan tetapibelumsesuaidenganPM

Dokumenkeluhan pelangganbelum menggunakanformyang sesuaidenganPM

TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: AkandibuatDCMdandievalusi secaraberkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. TindakanPerbaikan: Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerja departemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM

BPM-UII-YOGYAKARTA/2011

Halaman 97 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanDep.IlmuPenyakitTHT Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform keluhanpelangandanhasil penanganannya. Tabel4.45.TemuanDeskriptifPeriode2010UnitDep.IlmuKedokteranForensikProdiPendidikanDokter Dep.IlmuKedokteranForensik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen TindakanPerbaikan: khususmengevalusiSMUyang Akandilakukanrapatrutinwalaupun sudahdanbelumtercapai denganpersonilyangterbatas belumdilakukan,belumada penjelasanakarpermasalahan. TindakanPencegahan: Akan dilakukan evaluasi pelaksanaan Rapatevaluasiadaditingkat rapatdandibuatprosedurkerja. ProdiatauFakultas. 2 Rapatkoordinasiinternal unitdiDepartemenbelum dilakukan,Termasukrapat mengevaluasiProgramKerja RutindanPengembangan.Rapat menjadisatudenganProdi atauFakultasKedokteran untuksemuakegiatanyang berhubungandenganWT(tidak adakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunan silabusbelumdilakukandi departemen,evaluasi dilakukansesuaijadwalblok olehProdiataurapat Fakultas. 4 Metodesosialisasisilabus lewatwebbelumdilakukan 5 Belumadarapatkhususuntuk mengevaluasiPK,walaupun sudahadaPKyangdirevisi sebanyak1dari13PK(7%), semuabelumdiotorisasidan disesuaikandenganformatPM 6 BelumtersediaDaftarCatatan BelumdibuatDCM TindakanPerbaikan: Mutu(DCM) AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM 7 BelumadasosialisasiDaftar BelumdibuatDCMdan TindakanPerbaikan: CatatanMutu(DCM) evaluasiDCM AkandibuatDCMdandievalusisecara berkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. 8 Belumdilakukanpengelolaan Belumdilakukanpengelolaan TindakanPerbaikan: dokumen dokumenmelaluiDCM Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM BelumtersediaDCMyang BelumdibuatDCM TindakanPerbaikan: berlaku AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM

BPM-UII-YOGYAKARTA/2011

Halaman 98 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Dep.IlmuKedokteranForensik No. Deskripsi 9 Belumtersediadokumen pengukuranevaluasi kedisiplinankerjastafdi departemen,evaluasimenjadi satudenganFakultas(jumlah stafdidepartementerbatas) AnalisisPenyebab Pengukurandilakukandi Fakultas RencanaTindakLanjut TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerjadepartemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanformkeluhan pelangandanhasilpenanganannya. TindakanPerbaikan: Dokumenevaluasidantindaklanjut keluhanpelangganakanmenggunakan formyangsesuaidenganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

10

Tersediadokumenkeluhan pelanggantetapibelumsesuai denganPM

Dokumenkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

11

Evaluasidantindaklanjut terhadapkeluhanbelumsesuai denganPM

Dokumenevaluasidantindak lanjutkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

Tabel4.43.TemuanDeskriptifPeriode2010UnitDep.AnestesiProdiPendidikanDokter TemuanDepartemenAnestesi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen PersonildepartemenIKJyang TindakanPerbaikan: khususmengevalusiSMUyang terbatas Akandilakukanrapatrutinwalaupun sudahdanbelumtercapai denganpersonilyangterbatas belumdilakukan,belumada penjelasanakarpermasalahan. TindakanPencegahan Akandilakukanevaluasipelaksanaan Rapatevaluasiadaditingkat rapatdandibuatprosedurkerja. ProdiatauFakultas. 2 BelumtersediaDaftarCatatan BelumdibuatDCM TindakanPerbaikan: Mutu(DCM) AkabdibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM 3 BelumadasosialisasiDaftar BelumdibuatDCMdan TindakanPerbaikan: CatatanMutu(DCM) evaluasiDCM AkandibuatDCMdandievalusisecara berkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. 4 Belumdilakukanpengelolaan Belumdilakukanpengelolaan TindakanPerbaikan: dokumen dokumenmelaluiDCM Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM 5 Belumtersediadokumen Pengukurandilakukandi TindakanPerbaikan: pengukuranevaluasi Akanmemintahasilpengukurandi Fakultas kedisiplinankerjastafdi Fakultassebagaibahanevaluasi departemen,evaluasimenjadi satudenganFakultas(jumlah TindakanPencegahan Akandilakukanevaluasisetiap stafdidepartementerbatas semesterkedisiplinankerjadepartemen 6 Tersediadokumenkeluhan Dokumenkeluhanpelanggan TindakanPerbaikan: pelanggantetapibelumsesuai belummenggunakanformyang Akanmenggunakanformyangsesuai denganPM sesuaidenganPM denganPM

BPM-UII-YOGYAKARTA/2011

Halaman 99 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanDepartemenAnestesi Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpenggunaanformkeluhan pelangandanhasilpenanganannya. TindakanPerbaikan: Dokumenevaluasidantindaklanjut keluhanpelangganakanmenggunakan formyangsesuaidenganPM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

Evaluasidantindaklanjut keluhanpelangganbelum sesuaidenganPM

Dokumenevaluasidantindak lanjutkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

Tabel4.46.TemuanDeskriptifPeriode2010UnitDep.RadiologiProdiPendidikanDokter TemuanDepartemenRadiologi No. Deskripsi 1 Rapatevaluasididepartemen khususmengevalusiSMUyang sudahdanbelumtercapaibelum dilakukan,belumadapenjelasan akarpermasalahan.Rapat evaluasiadaditingkatProdi atauFakultas. 2 Rapatkoordinasiinternalunit diDepartemenbelumdilakukan, Termasukrapatmengevaluasi ProgramKerjaRutindan Pengembangan.Rapatmenjadisatu denganProdiatauFakultas Kedokteranuntuksemuakegiatan yangberhubungandenganWT (tidakadakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunan silabusbelumdilakukandi departemen,evaluasidilakukan sesuaijadwalblokolehProdi ataurapatFakultas. 4 Metodesosialisasisilabuslewat webbelumdilakukan 5 Belumadarapatkhususuntuk mengevaluasiPK,walaupunsudah adaPKyangdirevisisebanyak1 dari13PK(7%),semuabelum diotorisasidandisesuaikan denganformatPM 6 BelumtersediaDaftarCatatan Mutu(DCM) AnalisisPenyebab RencanaTindakLanjut TindakanPerbaikan: Akandilakukanrapatrutinwalaupun denganpersonilyangterbatas TindakanPencegahan: Akan dilakukan evaluasi pelaksanaan rapatdandibuatprosedurkerja.

BelumadasosialisasiDaftar CatatanMutu(DCM)

Belumdilakukanpengelolaan dokumen

TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM BelumdibuatDCMdan TindakanPerbaikan: evaluasiDCM AkandibuatDCMdandievalusisecara berkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. Belumdilakukanpengelolaan TindakanPerbaikan: dokumenmelaluiDCM Akandilakukanpengelolaandokumen melaluiDCM

BelumdibuatDCM

BPM-UII-YOGYAKARTA/2011

Halaman 100 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanDepartemenRadiologi Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM BelumdibuatDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM Pengukurandilakukandi TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultas Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerja departemen Dokumenkeluhanpelanggan TindakanPerbaikan: belummenggunakanformyang Akanmenggunakanformyangsesuai sesuaidenganPM denganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform keluhanpelangandanhasil penanganannya. Dokumenevaluasidantindak TindakanPerbaikan: lanjutkeluhanpelanggan Dokumenevaluasidantindaklanjut belummenggunakanformyang keluhanpelangganakanmenggunakan sesuaidenganPM formyangsesuaidenganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

BelumtersediaDCMyangberlaku

10

Belumtersediadokumen pengukuranevaluasikedisiplinan kerjastafdidepartemen, evaluasimenjadisatudengan Fakultas(jumlahstafdi departementerbatas)

11

Tersediadokumenkeluhan pelanggantetapibelumsesuai denganPM

12

Evaluasidantindaklanjut terhadapkeluhanbelumsesuai denganPM

Tabel4.47.TemuanDeskriptifPeriode2010UnitDep.IlmuPenyakitMataProdiPendidikanDokter TemuanDepIlmuPenyakitMata AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen TindakanPerbaikan: khususmengevalusiSMUyang Akandilakukanrapatrutinwalaupun sudahdanbelumtercapai denganpersonilyangterbatas belumdilakukan,belumada penjelasanakarpermasalahan. TindakanPencegahan: Akan dilakukan evaluasi pelaksanaan Rapatevaluasiadaditingkat rapatdandibuatprosedurkerja. ProdiatauFakultas. 2 Rapatkoordinasiinternal unitdiDepartemenbelum dilakukan,Termasukrapat mengevaluasiProgramKerja RutindanPengembangan.Rapat menjadisatudenganProdi atauFakultasKedokteran untuksemuakegiatanyang berhubungandenganWT(tidak adakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunan silabusbelumdilakukandi departemen,evaluasi dilakukansesuaijadwalblok olehProdiataurapat Fakultas. 4 Metodesosialisasisilabus lewatwebbelumdilakukan 5 Belumadarapatkhususuntuk

BPM-UII-YOGYAKARTA/2011

Halaman 101 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDepIlmuPenyakitMata No. Deskripsi mengevaluasiPK,walaupun sudahadaPKyangdirevisi sebanyak1dari13PK(7%), semuabelumdiotorisasidan disesuaikandenganformatPM 6 BelumtersediaDaftarCatatan Mutu(DCM) AnalisisPenyebab RencanaTindakLanjut

BelumdibuatDCM

BelumadasosialisasiDaftar CatatanMutu(DCM)

BelumdibuatDCMdan evaluasiDCM

Belumdilakukanpengelolaan dokumen

Belumdilakukanpengelolaan dokumenmelaluiDCM

BelumtersediaDCMyang berlaku

BelumdibuatDCM

10

Belumtersediadokumen pengukuranevaluasi kedisiplinankerjastafdi departemen,evaluasimenjadi satudenganFakultas(jumlah stafdidepartementerbatas)

Pengukurandilakukandi Fakultas

11

Tersediadokumenkeluhan pelanggantetapibelumsesuai denganPM

Dokumenkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

12

Evaluasidantindaklanjut terhadapkeluhanbelumsesuai denganPM

Dokumenevaluasidantindak lanjutkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: AkandibuatDCMdandievalusisecara berkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. TindakanPerbaikan: Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerjadepartemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanformkeluhan pelangandanhasilpenanganannya. TindakanPerbaikan: Dokumenevaluasidantindaklanjut keluhanpelangganakanmenggunakan formyangsesuaidenganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

Tabel4.48.TemuanDeskriptifPeriode2010UnitDep.IlmuKesehatanAnakProdiPendidikanDokter TemuanDep.IlmuKesehatanAnak AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Rapatevaluasididepartemen PersonildepartemenIKAyang TindakanPerbaikan: khususmengevalusiSMUyang Akandilakukanrapatrutinwalaupun terbatas sudahdanbelumtercapai denganpersonilyangterbatas belumdilakukan,belumada penjelasanakarpermasalahan. TindakanPencegahan: Akandilakukanevaluasipelaksanaan Rapatevaluasiadaditingkat

BPM-UII-YOGYAKARTA/2011

Halaman 102 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.IlmuKesehatanAnak No. Deskripsi ProdiatauFakultas. 2 Rapatkoordinasiinternal unitdiDepartemenbelum dilakukan,Termasukrapat mengevaluasiProgramKerja RutindanPengembangan.Rapat menjadisatudenganProdi atauFakultasKedokteran untuksemuakegiatanyang berhubungandenganWT(tidak adakelengkapanrapatdi Departemen) 3 Evaluasiprosespenyusunan silabusbelumdilakukandi departemen,evaluasi dilakukansesuaijadwalblok olehProdiataurapat Fakultas. 4 Metodesosialisasisilabus lewatwebbelumdilakukan 5 Belumadarapatkhususuntuk mengevaluasiPK,walaupun sudahadaPKyangdirevisi sebanyak1dari13PK(7%), semuabelumdiotorisasidan disesuaikandenganformatPM 6 BelumtersediaDaftarCatatan Mutu(DCM) AnalisisPenyebab RencanaTindakLanjut rapatdandibuatprosedurkerja.

BelumdibuatDCM

BelumadasosialisasiDaftar CatatanMutu(DCM)

BelumdibuatDCMdan evaluasiDCM

Belumdilakukanpengelolaan dokumen

Belumdilakukanpengelolaan dokumenmelaluiDCM

BelumtersediaDCMyang berlaku

BelumdibuatDCM

10

Belumtersediadokumen pengukuranevaluasi kedisiplinankerjastafdi departemen,evaluasimenjadi satudenganFakultas(jumlah stafdidepartementerbatas)

Pengukurandilakukandi Fakultas

11

Tersediadokumenkeluhan pelanggantetapibelumsesuai denganPM

Dokumenkeluhanpelanggan belummenggunakanformyang sesuaidenganPM

TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: AkandibuatDCMdandievalusisecara berkala. TindakanPencegahan: AkandilakukanevaluasiDCMdan dijadikanbahanrapatrutin. TindakanPerbaikan: Akandilakukanpengelolaandokumen melaluiDCM TindakanPencegahan Akandilakukanevaluasisetiap semesteruntukpengelolaanDCM TindakanPerbaikan: AkandibuatDCM TindakanPencegahan Akandilakukanevaluasiyang berhubungandenganDCM TindakanPerbaikan: Akanmemintahasilpengukurandi Fakultassebagaibahanevaluasi TindakanPencegahan: Akandilakukanevaluasisetiap semesterkedisiplinankerjadepartemen TindakanPerbaikan: Akanmenggunakanformyangsesuai denganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanformkeluhan

BPM-UII-YOGYAKARTA/2011

Halaman 103 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDep.IlmuKesehatanAnak No. Deskripsi 12 Evaluasidantindaklanjut terhadapkeluhanbelumsesuai denganPM AnalisisPenyebab Dokumenevaluasidantindak lanjutkeluhanpelanggan belummenggunakanformyang sesuaidenganPM RencanaTindakLanjut pelangandanhasilpenanganannya. TindakanPerbaikan: Dokumenevaluasidantindaklanjut keluhanpelangganakanmenggunakan formyangsesuaidenganPM TindakanPencegahan: Akandilakukanevaluasisetiap semesteruntukpenggunaanform evaluasidantindaklanjutkeluhan pelangandanhasilpenanganannya.

Tabel4.49.TemuanDeskriptifPeriode2010UnitDep.IlmuPenyakitDalamProdiPendidikanDokter TemuanDep.IlmuPenyakitDalam AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Tidakadadokumenevaluasidantindaklanjut Belumdibuatanalisis SMU penyebabdanrencana tindaklanjut 2 ProgramKerjaRutinhanyaotorisasiunitsaja 3 TidakadabentuksosialisasiProgramKerja Rutin 4 DokumenpelaksananProgramKerjaRutintidak terotorisasi 5 Tidakadadokumenevaluasidantindaklanjut dariProgramKerjaRutin 6 TidakadabentuksosialisasiProgram Pengembangan 7 TidakadaDokumenPelaksanaanProgram Pengembangan 8 Tidakadadokumenevaluasiprogram pengembangan 9 RapatKoordinasiRTMUnittidakrutindan tidakadadokumenkelengkapanrapat 10 TidakadapeneapantindaklanjutdariRTM Unit 11 Dokumenpenyusunansilabusdalamsemiloka tidakspesifik 12 Ketersediaansilabus,tidakjelaswaktunya 13 MetodesosialisasiSilabusmelaluikuliahdan semiloka(beloummelaluiWebsite) 14 Evaluasipenyusunansilabustidakdisertai rencanatindaklanjut 15 Metodesosialisasipedomanbimbingankoas, belummelaluiwebsitedantanpanotulenrapat 16 Ketepatanwaktupenyelesaianprosesbimbingan kliniktidak100%(dihitungperperiode) 17 PKtidakSesuaiFormatPM 18 TidakadadokumenTindaklanjutdarievaluasi PK 19 DCMTidaksesuaiPMyangberlaku 20 MetodesosialisasiDCMtidakditempelpada tempatpenyimpanandokumen 21 Belumdilakukanpengelolaandokumen,tidak adalemaridokumen 22 TidaktersediaevaluasiDCM 23 Evaluasikedisiplinankerja,hanyatersedia dokumenpresensidariDOSDM 24 Tidakadadokumentindaklanjuthasil evaluasiReward&Punishment 25 Tidakadatindakanevaluasidantindaklanjut terhadapkeluhanpelanggan

BPM-UII-YOGYAKARTA/2011

Halaman 104 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.50.TemuanDeskriptifPeriode2010UnitDep.IlmuKesehatanKulit&KelaminProdiPendidikan Dokter TemuanDep.IlmuKesehatanKulitdanKelamin RencanaTindak AnalisisPenyebab Lanjut No. Deskripsi 1 SMUbaruOtorisasiUnit Belumdibuatanalisis penyebabdanrencanatindak lanjut 2 RekapDokumenPengukuranparameterSMUbelum ada 3 TidakadabentukSosialisasiSMU 4 TidakAdaDokumenEvaluasidanTindakLanjut SMU 5 DokumenProgramKerjaRutinhanyaotorisasi Unit 6 TidakadaSosialisasiProgramKerjaRutin 7 ProgramKerjaRutintidakterlaksana100% 8 TidakadaDokumenEvaluasiProgramKerja Rutin 9 OtorisasiProgramPengembanganhanyadari unitsaja 10 BelumadaBentukSosialisasiProgram Pengembangan 11 Belum ada Dokumen Realisasi Pelaksanaan ProgramPengembangan 12 Belum ada Dokumen Evaluasi Program Pengembangan 13 TidakadaDokumenRapatKoordinasiInternal (RTMUnit)tidakrutin 14 TidakadaDokumenEvaluasiPelaksanaandan TindakLanjutRTMUnit 15 ProsesPenyusunanSilabuspendidikanDoker dilakukandalamsemiloka,tetapitidak spesifik 16 KetersediaanSilabustidakjelaswaktunya 17 SosialisasiSilabustidakmelaluiWebsite 18 EvaluasiPenyusunanSilabustidakdisertai penelasanakarmasalah 19 Ketepatanwaktupenyelesaianprosesbimbingan Kliniktidak100%(metodeperhitungan) 20 DCMTidaksesuaiPM(tanggalberlakutidak ada) 21 SosialisasiDCMtidakdilakukan.Tidak ditempel,otorisasitidaklengkap 22 EvaluasiDCMtidakada,lemaridokumentidak ada,dandokumentidaktertatarapi 23 Evaluasikedisiplinankerjatidaklengakap, hanyapresensidariDOSDMsaja 24 Rapat Pleno karyawan untk reward & Punishment tidakadanotulensirapat.

3.2. UnitDepartemen(Praktikum)ProdiPendidikanDokter Hasilkinerjasecarakuantitatifdalambentukindekskinerjabisadilihatpada table4.51,sementarauntukhasiltemuansecaradeskriptif,analisispenyebabdan rencanatindaklanjutuntukmasingmasingunitbisadlihatpadatable.4.525.61


Tabel4.51.IndeksKinerjaPeriode2010UnitDepartemen(Praktikum)ProdiPendidikanDokter HasilCapaianKinerjaDepartemen IndikatorKinerja Patalogi
Histologi Mikrobiologi Parasitologi Anatomi

No 1 2 3 4 5 6

Patologi Klinik

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum

3.67 3.50 3.50 4.00 3.50 4.00

3.00 3.25 3.25 3.70 3.50 *

2.50 2.75 3.50 3.80 3.50 3.75

2.67 2.25 2.50 4.00 3.50 4.00

3.50 3.25 3.00 3.70 3.75 4.00

BPM-UII-YOGYAKARTA/2011

Halaman 105 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

HasilCapaianKinerjaDepartemen No IndikatorKinerja
Histologi Mikrobiologi Parasitologi Patalogi Anatomi Patologi Klinik

7 EvaluasiPraktikum 3.11 3.63 3.33 3.11 3.67 8 KinerjaLab 1.67 0.67 2.67 2.33 1.67 9 PenerapanProsedurKerja(PK)untukLab 2.67 2.67 2.67 4.00 2.67 10 Pemahaman,realisasidanevaluasiDCM 4.00 3.50 3.75 4.00 3.75 11 EvaluasiKedisiplinanKerja 4.00 2.00 2.50 4.00 2.00 12 PengendaliandanevaluasiKeluhanPelanggan 4.00 3.00 4.00 4.00 4.00 IndeksKinerja 3.47 2.92 3.23 3.31 3.25 Tabel4.51.IndeksKinerjaPeriode2010UnitDepartemen(Praktikum)ProdiPendidikanDokter(Lanjutan) HasilCapaianKinerjaDepartemen No IndikatorKinerja Ketrampilan
Fisiologi Farmakologi Biokimia Anatomi Medik

1 PencapaianSasaranMutuUnit(SMU) 3.67 3.67 3.67 3.83 3.83 2 Pencapaianprogramkerjarutin 3.50 3.50 3.50 3.50 3.75 3 Pencapaianprogramkerjapengembangan 3.50 3.50 3.50 3.50 3.50 4 PersiapanPraktikum 3.80 3.80 4.00 3.56 3.67 5 PelaksanaanPraktikum 3.75 3.75 3.50 3.00 3.25 6 ResponsiPraktikum 3.50 3.75 3.50 3.75 3.75 7 EvaluasiPraktikum 2.00 2.70 3.70 3.00 2.80 8 KinerjaLab 0.33 2.00 2.33 0.00 0.00 9 PenerapanProsedurKerja(PK)untukLab 2.33 2.33 4.00 4.00 3.67 10 Pemahaman,realisasidanevaluasiDCM 3.50 3.50 3.50 3.50 3.50 11 EvaluasiKedisiplinanKerja 2.50 2.50 2.50 3.50 4.00 12 PengendaliandanevaluasiKeluhanPelanggan 1.00 4.00 0.00 3.00 2.50 IndeksKinerja 2.78 3.25 3.14 3.18 3.18 Tabel4.52.TemuanDeskriptifKinerjaPeriode2010UnitDep.HistologiProdiPendidikanDokter TemuanDepartemenHistologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMU,Programkerjarutindan pengembanganbarudalamrapatdanditempel 2 TidakadapengukuranNKA 3 4 5 Tidakadaevaluasiuntukasistenataudosenpengampu praktikumdenganNilaiKinerjaAsisten(NKA)3.00 Belumdilakukanreviewmodul(tidakadadata) Minimnyatingkatkunjunganlaboratorium:1% Kenaikankunjunganlab4%dibandingsemester sebelumnyadengandisertaibukti TidakdilakukanpengukuranProsedurKerja Tabel4.53.TemuanDeskriptifKinerjaPeriode2010UnitDep.MikrobiologiProdiPendidikanDokter TemuanDepartemenMikrobiologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ada sosialisasi SMU, dengan cara: 1. rapat penjelasan SMU dengan bukti notulen yang diotorisasi 2.Ditempel(Namunbelumdionlinekan)l 2 AdasosialisasiProgramKerjadengancara: 1.rapatpenjelasanProgramKerjadenganbukti notulenyangdiotorisasi 3 2.Ditempel(Namunbelumdionlinekan) AdasosialisasiProgramKerjaPengembangandengan cara: 1.rapatpenjelasanProgramPengembangandengan buktinotulenyangdiotorisasi 2.ditempel (Namunbelumdionlinekan) AdasosialisasiSAPPraktikumdengancara: 1.rapatpenjelasanSAPPraktikumdenganbukti notulendiotorisasi(Namunbelumdionlinekan)

BPM-UII-YOGYAKARTA/2011

Halaman 106 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

5 UraianTemuan:Belumadanyadatapengesahan reviewer 1%jumlahmodulyangdireviewdenganpengesahan reviewer29% 1%kenaikanpemanfaatanlabuntukpenelitian4% dibandingsemestersebelumnyadenganbuktiyang diotorisasi TidakadakunjungankeLaboratorium TidakdilakukanpengukuranPK

7 8 9

TerkaitrewarddanPunishment,adaevaluasidan tindaklanjut: 1.melaluirapatevaluasidengannotulenbelum diotorisasi 2.tidakadapenetapantindaklanjut

Tabel4.54.TemuanDeskriptifKinerjaPeriode2010UnitDep.ParasitologiProdiPendidikanDokter TemuanDepartemenParasitologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Pengukuransasaranmutu:50%parameteryang diukur74,9% 2 AdasosialisasiSMU,dengancara: 1.rapatpenjelasanSMUdenganbuktinotulenyang diotorisasi 2.ditempel(Namunbelumdionlinekan) 3 Pencapaian sasaran yang didukung dok. Terotorisasi ;50%parameteryangdiukur74,9% 4 Adasosialisasiprogramrutindengancara: 1.rapatpenjelasanProgramKerjadenganbukti notulenyangdiotorisasi 2.ditempel(Namunbelumdionlinekan) 5 Adasosialisasiprogrampengembangandengancara: 1.rapatpenjelasanProgramPengembangandengan buktinotulenyangdiotorisasi 2.ditempel(Namunbelumdionlinekan) 6 AdasosialisasiSAPPraktikumdengancara: 1.rapatpenjelasanSAPPraktikumdenganbukti notulendiotorisasi(Namunbelumdionlinekan) 7 Tersedia evaluasi dan tindak lanjut untuk Jumlah Mahasiswa yang mengulang lebih dari 10% per Mata Praktikum 1. melalui rapat evaluasi dengan bukti notulen 2.adapenjelasanakarmasalah 8 TidakadakunjunganLaboratorium 9 10 TidakdilakukanpengukurandanEvaluasiPK

AdaevaluasidantindaklanjutRewadrdand Punishment: 1.melaluirapatevaluasidengannotulenbelum diotorisasi 2.tidakadapenetapantindaklanjut,

Tabel4.55.TemuanDeskriptifKinerjaPeriode2010UnitDep.PatalogiAnatomiProdiPendidikanDokter TemuanDepartemenPatalogiAnatomi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 EvaluasiSMUtidakdisertaiRencanatindaklanjut 2 3 4 5 6 7 DokumenrealisasiProgramKerjaRutintidakdibuat EvaluasiProgramKerjaRutinada,tapitidakada rencanatindaklanjut DokumenrealisasiProgrampengembangantidakdibuat EvaluasiProgrampengembanganada,tapitidakada rencanatindaklanjut JadwalPraktikumtersedia1harisebelumpraktikum SAPtidaksesuaiFormatPM

BPM-UII-YOGYAKARTA/2011

Halaman 107 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDepartemenPatalogiAnatomi No. Deskripsi 8 SosalisasiSAPtidakmelaluiWebsite 9 10 11 12 13 14 15 16 17 18 19 20 21 TingkatKehadiranAsistentidak100%sesuaijadwal DilakukanevaluasiKehadiranAsisten,tapitidak adarencanatindaklanjut Tingkatkehadiranmahasiswapraktikum<100% AnalisisPenyebab RencanaTindakLanjut

Tidak ada tindak lanjut thd kehadiran mahasiswa< 95% TingkatkehadiranmahasiswaResponsi<100% AdaevaluasikehadiranmahasiswaResponsi,tapi tidakadarencanatindaklanjut TidakadaDokumenpengukuranmahasiswaMengulang Praktikum TidakadaevaluasidantindaklanjutMahasiswa mengulangpraktikum DCMhanyaOtorisasiUnitsaja Metodesosialisasiditempel,tanpaotorisasi lengkap Reward&Punishmentadaevaluasi,tapitidakada rencanatindaklanjut FormKEluhanpelanggantidaksesuaiPM(Buku) TindakanevaluasikeluhanpelanggantidaksesuaiPM

Tabel4.56.TemuanDeskriptifKinerjaPeriode2010UnitDep.PatologiKlinikProdiPendidikanDokter TemuanDepartemenPatologiKlinik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 AdasosialisasiSMU,dengancara: 1.rapatpenjelasanSMUdenganbuktinotulenyang diotorisasi 2.Ditempel(Namunbelumdionlinekan) 2 Adasosialisasidengancara: 1.rapatpenjelasanProgramKerjadenganbukti notulenyangdiotorisasi 2.ditempel (Namunbelumdionlinekan) 3 Adasosialisasidengancara: 1.rapatpenjelasanProgramPengembangandengan buktinotulenyangdiotorisasi 2.ditempel (Namunbelumdionlinekan) 4 AdasosialisasiSAPPraktikumdengancara: 1.rapatpenjelasanSAPPraktikumdenganbukti notulendiotorisasi (Namunbelumdionlinekan) 5 TersediaevaluasidantindaklanjutuntukJumlah Mahasiswayangmengulanglebihdari10%perMata Praktikum 1.melaluirapatevaluasidenganbuktinotulen 2.adapenjelasanakarmasalah 6 1%jumlahmodulyangdireviewdenganpengesahan reviewer29% 7 TidakadadatakunjunganLaboratorium 8 9 TidakdilakukanpengukurandanEvaluasiPK

AdaevaluasidantindaklanjutRewarddan Punishment: 1.melaluirapatevaluasidengannotulenbelum diotorisasi 2.namun,tidakadapenetapantindaklanjut

BPM-UII-YOGYAKARTA/2011

Halaman 108 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.57.TemuanDeskriptifKinerjaPeriode2010UnitDep.FisiologiProdiPendidikanDokter TemuanDepartemenFisiologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUmelaluiRapattidakdisertai dokumenNotulendantidakadamelaluiWeb. 2 SosialisasiProgramKerjayangefektifmelalui RapattidakdisertaidokumenNotulendantidakada melaluiWeb. 3 SosialisasiProgramPengembanganyangefektif melaluiRapattidakdisertaidokumenNotulendan tidakadamelaluiWeb. 4 SosialisasiSAPMelaluirapatsemilokatidak disertaidokumenNotulensidantidakmelaluiweb 5 TingkatkehadiranmahasiswaPraktikum<100% 6 7 8 9 10 11 12 13 14 15 16 17 Tabel4.58.TemuanDeskriptifKinerjaPeriode2010UnitDep.FarmakologiProdiPendidikanDokter TemuanDepartemenFarmakologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUmelaluiRapattidakdisertaidokumen NotulendantidakadamelaluiWeb. 2 SosialisasiProgramKerjayangefektifmelaluiRapat tidakdisertaidokumenNotulendantidakadamelalui Web. 3 SosialisasiProgramPengembanganyangefektif melaluiRapattidakdisertaidokumenNotulendan tidakadamelaluiWeb 4 SosialisasiSAPMelaluirapatsemilokatidak disertaidokumenNotulensidantidakmelaluiweb 5 TingkatkehadiranmahasiswaPraktikum<100% 6 7 8 9 10 BahanPenunjangfasilitasResponsi<7hari(6hari) sebelumpelaksanaanresponsi TingkatkehadiranmahasiswaResponsi<100% SAPsesuai,tetapitidakadaFormulirrealisasiSAP disetiapPraktikum Ada3PK,tetapiFormattidakSesuaiPM BahanPenunjangfasilitasResponsi<7hari(6 hari)sebelumpelaksanaanresponsi NKA<90% FormRekapitulasiSAP,tidakadabuktiRealisasi SAPnya ReviewModulPraktikumtidakadaotorisasi (Pengesahan)Reviewer PemanfaatanLaboratoriumsebagaipusatriset,2008 =1;2009=0;2010=3 PK ada 8, otorisasi hanya Unit dan PSMF dan tidak sesuaiFormatPM JumlahMahasiswayangmengulangpraktikum,belum diukur Evaluasidantindaklanjutterhadapmahasiswa mengulangpraktikumbelumdilakukan PengirimannilaiakhirketimBloktidak menggunakanformulirtandaterima(beritaacara) TidakadadokumenkunjunganLaboratorium TidakadaevaluasiPK,karenaPKmasihPKlamadan tidaksesuaiformat Rapatevaluasitidakdisertainotulensi,dantidak adapenetapantindaklanjutReward&Punishment

11 12

DCM tidak sesuai PM yang berlaku, dan otorisasi hanyaunityangbersangkutan Jumlahmahasiswayangmengulangpraktikumbelum diukur Evaluasidantindaklanjutbilamahasiswamengulang praktikumbelumdilakukan PengirimannilaiakhirketimBloktidakdisertai buktipenerimaan

BPM-UII-YOGYAKARTA/2011

Halaman 109 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDepartemenFarmakologi No. Deskripsi 13 NKAbelumdiukur 14 15 16 17 18 19 20 21 Tabel4.59.TemuanDeskriptifKinerjaPeriode2010UnitDep.BiokimiaProdiPendidikanDokter TemuanDepartemenBiokimia AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SMUyangberlakutidakdisertaidenganMetode Pengukuran 2 SosialisasiProgramKerjaTidakMelaluiWebsite 3 4 5 6 7 8 9 10 11 12 13 14 15 Tabel4.60.TemuanDeskriptifKinerjaPeriode2010UnitDep.AnatomiProdiPendidikanDokter TemuanDepartemenAnatomi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 EvaluasiSMUtidakdisertaiRencanatindaklanjut 2 3 4 5 6 7 8 DokumenrealisasiProgramKerjaRutintidakdibuat EvaluasiProgramKerjaRutinada,tapitidakada rencanatindaklanjut DokumenrealisasiProgrampengembangantidakdibuat EvaluasiProgrampengembanganada,tapitidakada rencanatindaklanjut JadwalPraktikumtersedia1harisebelumpraktikum SAPtidaksesuaiFormatPM SosalisasiSAPtidakmelaluiWebsite SosialisasiProgramPengembanganTidakMelalui Website TingkatKehadiranMahasiswaPraktikum<100% EvaluasidantindaklanjutterhadapNKAbelum dilakukan TidakadaDokumenReviewterhadapmodulpraktikum AnalisisPenyebab RencanaTindakLanjut

Penurunanpemanfaatanlaboratoriumuntukpenelitian, 2009=3,2010=2 TidakadaKunjunganlaboratorium(tidakadadokuman) TidakadaevaluasiPK,karenaPKmasihPKlamadan tidaksesuaiformat Rapatevaluasitidakdisertainotulensi,dantidak adapenetapantindaklanjutReward&Punishment FormulirpengendaliankeluhantidaksesuaiPM Tidakdilakukanevaluasidantindaklanjutterhadap keluhan,dantidaksesuaiPM

EvaluasiTingkatkehadiranmahasiswaPraktikum, tidakadarencanatindakLanjut BahanPenunjangfasilitasResponsi<7hari(6hari) sebelumpelaksanaanresponsi TingkatKehadiranMahasiswaResponsi<100% PengirimanNilaiPraktikumtidakdisertaiBukti Tandaterima(terkadanglewatemail) EvaluasiNKA,tidakdisertaidenganadanyarencana tindakLanjut ModulPraktikumDireview,tetapitidakada Otorisasi(Pengesahan)reviewer DCM Tidak Sesuai dengan PM yang berlaku, dan otorisasiUnitsaja LaboratoriumbelummenjadiRoleModel(tidakada KunjunganLaboratorium) Rapatevaluasitidakdisertainotulensi,dantidak adapenetapantindaklanjutReward&Punishment TidakAdaFormulirPengendalianKeluhanPelanggan TidakadaEvaluasidantindaklanjutterhadap Keluhan

BPM-UII-YOGYAKARTA/2011

Halaman 110 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanDepartemenAnatomi No. Deskripsi 9 TingkatKehadiranAsistentidak100%sesuaijadwal 10 11 12 13 14 15 16 17 18 19 20 21 DilakukanevaluasiKehadiranAsisten,tapitidakada rencanatindaklanjut Tingkatkehadiranmahasiswapraktikum<100% AnalisisPenyebab RencanaTindakLanjut

Tidak ada tindak lanjut terhadap kehadiran mahasiswa <95% TingkatkehadiranmahasiswaResponsi<100% AdaevaluasikehadiranmahasiswaResponsi,tapitidak adarencanatindaklanjut TidakadaDokumenpengukuranmahasiswaMengulang Praktikum TidakadaevaluasidantindaklanjutMahasiswa mengulangpraktikum DCMhanyaOtorisasiUnitsaja Metodesosialisasiditempel,tanpaotorisasilengkap Reward&Punishmentadaevaluasi,tapitidakada rencanatindaklanjut FormKEluhanpelanggantidaksesuaiPM(Buku TindakanevaluasikeluhanpelanggantidaksesuaiPM

Tabel4.61.TemuanDeskriptifKinerjaPeriode2010UnitDep.KetrampilanMedikProdiPendidikan Dokter TemuanDepartemenKetrampilanMedik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 EvaluasiSMUtidakdisertaiRencanatindaklanjuy 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 EvaluasiProgramKerjaRutinada,tapitidakada rencanatindaklanjut DokumenrealisasiProgrampengembangantidakdibuat EvaluasiProgrampengembanganada,tapitidakada rencanatindaklanjut JadwalPraktikumtersedia1harisebelumpraktikum SAPtidaksesuaiFormatPM SosalisasiSAPtidakmelaluiWebsite TingkatKehadiranAsistentidak100%sesuaijadwal DilakukanevaluasiKehadiranAsisten,tapitidakada rencanatindaklanjut Tingkatkehadiranmahasiswapraktikum<100% Tidakadadokumenperhitunganjumlahmahasiswa mengulangpraktikum(tidakdiukur) Tidakadadokumenevaluasidantindaklanjutuntuk mahasiswamengulangpraktikum AdapengirimanNilai,tetapitidakmenggunakan formulirbuktipenerimaan AdaevaluasiNKI(NilaiKinerjaInstruktur),tapi tidakadarencanatindaklanjut Tidakadadokumenbuktimodulyangdireviewoleh ahli TidakadaDokumenjikalaboratoriummenjadiRole Model/Benchmarking(kunjungan) PKTidaksesuaiFormatPM(Tanggalberlaku,tanggal revisi,dankodedokumenkosong) DCMhanyaOtorisasiUnitsaja,versi/revisikosong Metodesosialisasiditempel,tanpaotorisasilengkap FormKeluhanpelanggantidaksesuaiPM(Buku) TindakanevaluasikeluhanpelanggantidaksesuaiPM

BPM-UII-YOGYAKARTA/2011

Halaman 111 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

4. FakultasMatematikadanIlmuPengetahuanAlam 4.1. UnitProgramStudiStatistika:UnitKordinatorLab.Statistika Hasil kinerja Unit Kordinator Lab. Statistika secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.62 dan unit lab komputasi pada table 4.62, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisi bisa dlihat pada table.4.63 dan 4.65
Tabel4.62IndeksKinerjaPeriode2010UnitKorlabStatistika No 1 2 IndikatorKinerja Pencapaianprogram/rencanakerjapengembanganlab KemampuanKepemimpinanoperasionaldalamhalproseskoordinasi internalunitdantindaklanjutRTM Prosespenyediaanfasilitaspraktikum IndeksKinerja Statistika 3.00 4.00 4.00 4.00 4.00 3.25 3.50 3.68

3 4 Mengukurprosespenggunaandanalab 5 PenerapanProsedurKerja(PK) 6 Tingkatpemahaman,realisasidanevaluasiDCM 7 ProsespengendaliandanevaluasiKeluhanPelanggan IndeksKinerja 1

4.63.TemuanDeskriptifKinerjaPeriode2010UnitKorlabStatistika Temuan AnalisisPenyebab RencanaTindakLaut Deskripsi Ketercapaianprogram MinimnyajumlahSDMbaikdi TindakanPerbaikan: pengembanganbaru66% JurusandanLaboratorium Akandipilihkursusmaupunworkshop untukpelaksanaankuliahdan yanglebihflexiblewaktunya praktikumsehinggawaktu untukpengadaankursusbelum TindakanPencegahan: Memilihkursusmaupunworkshopyang terpenuhi. bisadilakukansecaraonline Sosialisaiprogramkerja Belumdipilihkontendari TindakanPerbaikan: pengembanganbelumdiuploadvia programkerjayangharus Akandiadakanrapatuntukpemilihan web diuploadviawebmelalui kontenprogramkerjayangperlu rapat diuploadmelaluiweb TindakanPencegahan: PerludibuatPKuntukupload programkerjakeWeb

Tabel4.64.IndeksKinerjaPeriode2010UnitLabKomputasi No IndikatorKinerja IndeksKinerja Komputasi 3.50 4.00 3.00 3.90 3.50 3.75 3.90 4.00 4.00 3.50 4.00 3.50 3.71

1 PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin 2 Pencapaianprogramkerjapengembangan 3 PersiapanPraktikum 4 PelaksanaanPraktikum 5 ResponsiPraktikum 6 EvaluasiPraktikum 7 KinerjaLab 8 PenerapanProsedurKerja(PK)untukLab 9 Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) 10 EvaluasiKedisiplinanKerja 11 PengendaliandanevaluasiKeluhanPelanggan 12 IndeksKinerja

BPM-UII-YOGYAKARTA/2011

Halaman 112 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

1 4.65.TemuanDeskriptifKinerjaPeriode2010LabKomputasiProdiStatistika Temuan AnalisisPenyebab RencanaTindakLaut Deskripsi Belumadaotorisasi TindakanPerbaikan: SosialisaiSMUbelumdilakukan penanggungjawabpemasukan lewatweb Akandiadakanrapatevaluasidan kontenkeWebdariadminke segeradisosialisasikanlewatWeb korlabataupunkelaboran TindakanPencegahan: Evaluasirutinsetiapsemester TindakanPerbaikan: Kehadiranmahasiswapraktikum AnalisisPenyebab: Perlunyapemantapandanorientasi 100%sesuaijadwalbaru65% lulusanStatistikaagarmahasiswabaru Penyebabterbanyakkarena tetapdiJurusanStatistikaUII Mahasiswaangkatanbaru2010 masihraguragumasukdi TindakanPencegahan: JurusanStatistikadan Pemilihanmatakuliahdanpraktikum Mahasiswatersebutsudahkey untuksemestersatudanduasebaiknya inuntukPraktikumtetapi tidakterlaluberatsehinggamahasiswa ternyatapindahkePTlain barumerasatidakterlalusulituntuk memahamistatistikasecarakeseluruhan TindakanPerbaikan: Sosialisaiprogramkerja Belumdipilihkontendari pengembanganbelumdiuploadvia programkerjayangharus Akandiadakanrapatuntukpemilihan web diuploadviawebmelalui kontenprogramkerjayangperlu rapat diuploadmelaluiweb TindakanPencegahan: PerludibuatPKuntukuploadprogram kerjakeWeb TindakanPerbaikan: Akandipilihkursusmaupunworkshop yanglebihflexiblewaktunya. TindakanPencegahan: Memilihkursusmaupunworkshopyang bisadilakukansecaraonline.

Ketercapaianprogram pengembanganbaru66%

MinimnyajumlahSDMbaikdi JurusandanLaboratorium untukpelaksanaankuliahdan praktikumsehinggawaktu untukpengadaankursusbelum terpenuhi.

4.2. UnitProgramStudiIlmuKimia 4.2.1. UnitKorlabProdiIlmuKimia. Hasil kinerja Korlab Prodi Ilmu Kimia secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.66, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable.4.67
Tabel4.66.IndeksKinerjaPeriode2010UnitKoordinatorLabProdiIlmuKimia IndeksKinerja No IndikatorKinerja IlmuKimia 1 Pencapaianprogram/rencanakerjapengembanganlab 3.25 KemampuanKepemimpinanoperasionaldalamhalproses 2 4.00 koordinasiinternalunitdantindaklanjutRTM Prosespenyediaanfasilitaspraktikum 3 4.00 4 Mengukurprosespenggunaandanalab 3.00 5 PenerapanProsedurKerja(PK) 3.00 6 Tingkatpemahaman,realisasidanevaluasiDCM 3.00 7 ProsespengendaliandanevaluasiKeluhanPelanggan 3.00 IndeksKinerja 3.32

BPM-UII-YOGYAKARTA/2011

Halaman 113 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.67.TemuanDeskriptifKinerjaPeriode2010KoordinatorLabProdiIlmuKimia Temuan AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PelaksanaanProgrampengembanganyang didukungdokumenyangterotorisasi belumterpenuhi. 2 EvluasiPKbelumberjalansecara efektif 3 DatarCatatanMutubelumterotorisasi secaralengkapsesuaiSistemMutu(SM) UII

4.2.2. UnitLab.ProdiIlmuKimia Hasil kinerja Unit Lab. Prodi Ilmu Kimia secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.68, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisibisadlihatpadatable.4.69dan4.70
Tabel4.68.HasilCapaianKinerjaPeriode2010UnitLabProdiIlmuKimia No IndikatorKinerja IndeksKinerja PendidikanKimia PenelitianKimia 3.83 3.83 3.50 4.00 3.25 4.00 3.70 3.80 3.75 3.50 3.50 4.00 3.78 3.89 3.33 3.33 3.00 3.00 3.75 3.75 3.50 3.50 2.50 2.50 3.45 3.59

1 PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin 2 Pencapaianprogramkerjapengembangan 3 PersiapanPraktikum 4 PelaksanaanPraktikum 5 ResponsiPraktikum 6 EvaluasiPraktikum 7 KinerjaLab 8 PenerapanProsedurKerja(PK)untukLab 9 Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) 10 EvaluasiKedisiplinanKerja 11 PengendaliandanevaluasiKeluhanPelanggan 12 IndeksKinerja Tabel4.69.TemuanDeskriptifKinerjaPeriode2010LabPendidikanKimiaProdiIlmuKimia TemuanLab.PendidikanKimia AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 JumlahasistendenganNKA3 SemesterGanjil2010/2011 TindakanPerbaikan: baru67,6%daritarget100% Asistenyangtidakdapathadir Asistentidakdapathadirpada padajadwalyangtelah jadwalyangtelahditentukan. ditentukandigantikanoleh asistenlaindenganpersetujuan dosenpengampu TindakanPencegahan Dibuatsuratpernyataan kesediaanmenjadiasisten 2 PKyangdievaluasibaru50% Belum dilakukan rapat evaluasi TindakanPerbaikan: PK AkandilakukanrapatevaluasiPK TindakanPencegahan: Diadakanevaluasisecaraberkala terkaitpelaksanaanPKdan evaluasi 3 Dokumenkeluhanpelanggantidak Dokumen keluhan pelanggan tidak TindakanPerbaikan: sesuaiformatPM menggunakanformatPM Akandibuatformkeluhan pelanggansesuaiPM TindakanPencegahan: Disediakanformkeluhan pelanggansesuaiPM

BPM-UII-YOGYAKARTA/2011

Halaman 114 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.70.TemuanDeskriptifKinerjaPeriode2010LabPenelitianKimiaProdiIlmuKimia TemuanLab.PenelitianKimia AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 KetercapaianSMUbaru79% 2 3 4 5 6 7 8 9 10 11 12 13 14 Sosialisasijadwalpraktikumbelumdiuploadkeweb SosialisasiSAPbelumdiuploadkeweb Tingkatkehadiranasistenpraktikumbaru92,5% Tingkatkehadiranmahasiswasesuaijadwalbaru97% NKAlebihdari3baru88% Kenaikanpenggunaanlabuntukpenelitiandibawah 20% Kunjungandilabsebagaibenckmarkingkurangdari 20% KetersedianPKbaru75%darikegiatanyangadadi lab JumlahPKyangdievaluasibaru50% DCMbaruterotorisasiolehunit Belumtersediapengukurankinerjakaryawan FormkeluhanpelangganbelumsesuaiPM Evaluasiterhadapkeluhanpelangganbelumsesuai denganPM

4.3. UnitProgramStudiFarmasi: 4.3.1. SubunitKepalaLabProdiFarmasi Hasilkinerjasecarakuantitatifdalambentukindekskinerjabisadilihatpada table 4.71, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing divisi bisa dlihat pada table.4.724.77
Tabel4.71.IndeksKinerjaPeriode2010UnitLabProdiFarmasi IndeksKinerjaLaboratorium No IndikatorKinerja Kimia Farmakologi& Tek. Biologi Mikro Farmasetika Farmasi Farmakoterapi Farmasi Farmasi biologi 1 PencapaianSasaranMutuUnit(SMU) 3.50 3.67 3.67 3.67 3.50 3.67 2 Pencapaianprogramkerjarutin 4.00 4.00 4.00 3.75 4.00 4.00 Pencapaianprogramkerja 3 3.25 4.00 4.00 3.75 3.50 4.00 pengembangan 4 PersiapanPraktikum 4.00 3.70 3.80 3.70 3.30 3.80 5 PelaksanaanPraktikum 3.50 3.00 4.00 3.25 3.75 3.50 6 ResponsiPraktikum 3.75 3.75 4.00 3.75 1.25 3.50 7 EvaluasiPraktikum 3.90 3.60 3.80 3.80 2.80 3.80 8 KinerjaLab 2.67 3.00 3.33 0.67 1.33 2.33 9 PenerapanProsedurKerjauntukLab 3.67 3.33 3.67 3.33 2.67 3.67 Pemahaman,realisasidanevaluasi 10 4.00 4.00 4.00 3.75 4.00 4.00 DaftarCatatanMutu Evaluasi Kedisiplinan Kerja 11 4.00 3.50 4.00 3.50 4.00 4.00 PengendaliandanevaluasiKeluhan 12 3.50 4.00 4.00 3.00 4.00 3.00 Pelanggan IndeksKinerja 3.64 3.63 3.86 3.33 3.18 3.61 Tabel4.72.TemuanDeskriptifKinerjaPeriode2010UnitLabFarmasetikaProdiFarmasi TemuanLab.Farmasetika AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 KetercapaianSasaranMutu Ketidakcapaianbiaskarena1 TindakanPerbaikan: Akandibuatkendalikegiatanper barumencapai40% parameteruntukbeberapa parameterSasaranMutu

BPM-UII-YOGYAKARTA/2011

Halaman 115 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

kegiatan TindakanPencegahan Perbaikan Proses monitor untuk mencapai SasaranMutu TindakanPerbaikan: Menambahjumlahasisten TindakanPencegahan Rekruitmen asisten waktu lebih lama & jumlahlebihbanyak TindakanPerbaikan: Akansegeradibuatkanmetodepengukuran yangtepat TindakanPencegahan Mahasiswayangngulangwajibhanyauntuk praktikumyangnilainyarendah TindakanPerbaikan: Akansegeradibuatkanaturan TindakanPencegahan Pelaksanaan bias dibarengkan dengan lab lain TindakanPerbaikan: Akandipirkan TindakanPencegahan Masukdalamagendapromositahunan

Tingkatkehadiranasisten 85%

Jadualpraktikumbersamaan denganjadualkuliahyang diambil

Tingkatkehadiran mahasiswapraktikum(95%, 92%,97%)

Metodepengukuranbelumtepat

Kehadiranmahasiswa responsesesuaijadwal94 %

Adayangtidakhadir mundur

Programpengembangan3 barutercapai33%

Waktu1thpendekutuk pelaksanaan

Tabel4.73.TemuanDeskriptifKinerjaPeriode2010UnitLabKimiaFarmasiProdiFarmasi TemuanLab.KimiaFarmasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 PencapaianSasaranMutu Caraperhitungankehadiran TindakanPerbaikan; 3/5=60% mahasiswa100% Sosialisasiperhitungankehadiran Adamahasiswayang mengundurkandiri TindakanPencegahan: Formatperhitunganmahasiswaaktifsaja 2 Kenaikankunjungantahunan Kurangpromosi TindakanPerbaikan: Promosiditingkatkan tidakada(0%) TindakanPencegahan Masukdalamagendapromositahunan TindakanPerbaikan: Mengetahuifactoryangmenentukantidak dapatdiimplementasikanPK TindakanPencegahan Revisi PK yang sesuai dengan kemampuan implementasi Tabel4.74.TemuanDeskriptifKinerjaPeriode2010UnitLabFarmakologi&FarmakoterapiProdi Farmasi TemuanLab.Farmakologi&Farmakoterapi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSAP,JadwalPraktikumbelumadadiweb 2 Pelaporanpenggunaananggaran(25/1)sementara respansipraktikum(24/12) 3 Modulpraktikumdirevietapibelumdibuatkan beritaacaranya 4 ImplementasipelaksanaanPKada1spbelum dilaksanakan Tabel4.75.TemuanDeskriptifKinerjaPeriode2010UnitLabTek.FarmasiProdiFarmasi TemuanLab.Tek.Farmasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Tingkatkehadiranasisten Jadualpraktikum TindakanPerbaikan: Segeradievaluasi praktikumbarumencapai barengandenganjadual 57.37% perkuliahan TindakanPencegahan Akandibuatkanpenjadualyanglebihcepat agarasisten(mahasiswa)biasmengatur

ImplementasiPK50%

Waktudiharapkandiubahtidak sesuaidenganfakta/kemampuan yangada

BPM-UII-YOGYAKARTA/2011

Halaman 116 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

2 Modulpraktikumbelumdi review Belumadapakartersebut diUII lebihcepat TindakanPerbaikan: Segeradicarireviewer TindakanPencegahan Sebelumdipakaimahasiswasebaiknyasudah direview(biasdicarireviewereksternal) TindakanPerbaikan: TindakanPencegahan Akanbekerjasamadenganlaboratoriumlain dalam1prodi TindakanPerbaikan: Terusditingkatkan TindakanPencegahan Lebihbekerjasamadenganprodifarmasi Tabel4.76.TemuanDeskriptifKinerjaPeriode2010UnitLabBiologiFarmasiProdiFarmasi TemuanLab.BiologiFarmasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Tidak ada data untuk Belumdidokumentasikan(sebenarnya TindakanPerbaikan: Akandibuatkan ketersediaan bahan penunjang sudahdilakukan)sehinggatidak fasilitaspraktikum biasdinilai TindakanPencegahan Tersediaformuliruntuk ketersediaanbahanpenunjang fasilitaspraktikum 2 Ketercapaian Sasaran Mutu 40 % Kehadiranmahasiswabelummencapai TindakanPerbaikan: Akandiusahakan (2/5) 100% Nilaipraktikum>A/B80% belumtercapai TindakanPencegahan MenjadiLabterakreditasibelum Regulasikehadirandireview kembali 3 Tidaktersediajadualresponsi Belumdibuatkandata TindakanPerbaikan: Segeradibuatkan (dokumentasinya)Kalab merangkapnya TindakanPencegahan Prosedurkerjaresponse dibuatkanataubarengjadwal praktikum 4 Tingkat kehadiran mahasiswa Belumdibuatkankalabnerangkap TindakanPerbaikan: Segeradibuatkan response tidak tersedia (tidak terekap) TindakanPencegahan Proseskerjaresponsebelum dibuatkan 5 Jumlahmahasiswayangmengulang Belumdibuatkanrekapkalab TindakanPerbaikan: Segeradibuatkan praktikumbelumdiukur merangkap TindakanPencegahan Menelitikembalidaftar presentasipraktikum Tabel4.77.TemuanDeskriptifKinerjaPeriode2010UnitLabMikrobiologiProdiFarmasi TemuanLab.Mikrobiologi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 KetercapaianSasaranMutu60% Yang belum tercapai : Kehadiran TindakanPencegahan: Peraturandirevisi Mahasiswapraktikum97.3% NilaiPraktikum>A/B:28% 2 Modul praktikum belum ada yang Pakar (reviewer) harus didatangkan TindakanPerbaikan: Segeradicarikanreviwer direviewolehtenagaahli exsternal TindakanPencegahan Sebelummodulpraktikum digunakandireviewdulu

Laboratoriummenjadipusat risetdiprodi(karena adanyapenurunan45%) Labmenjadirolemodel rujukandibidangmasing2

Belumdapatditingkatkan

Sebenarnyapeningkatan tidakadatapisama dengantahunsebelumnya

BPM-UII-YOGYAKARTA/2011

Halaman 117 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

5. FakultasPsikologidanIlmuSosialBudaya 5.1. UnitLaboratoriumProgramStudiPsikologi Hasil kinerja Unit Laboratorium Program Studi Psikologi secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.78, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masing masingdivisibisadlihatpadatable.4.79.
Tabel.4.78.IndeksKinerjaPeriode2010UnitLabProdiPsikologi No 1 2 IndikatorKinerja

ProsespencapaianSasaranMutuUnit(SMU) Prosespencapaianprogram/rencanakerjarutin Prosespencapaianprogram/rencanakerjapengembangan 3 unit 4 ProsesPersiapanPraktikum 5 PelaksanaanPraktikum 6 ProsesResponsiPraktikum 7 ProsesEvaluasiPraktikum 8 TingkatKinerjaLab 9 ProsesPenerapanProsedurKerja(PK) 10 Prosespemahaman,realisasidanevaluasiDCM 11 ProsesdanevaluasiKedisiplinanKerja 12 ProsespengendaliandanevaluasiKeluhanPelanggan IndeksKinerja Tabel.4.79.TemuanDeskriptifKinerjaPeriode2010UnitLabProdiPsikologi Temuan No. Deskripsi 1 Pencapaiansasaranmutuunityangdidukung olehdokumenyangudahdiotorisasibaru mencapai75%ketercapiansasaran99,9% 2 PelaksanaanProgramKerrjaUnityangdidukung olehdokumenterotorisasibarumencapi75% pelaksanaanprogramkerjarutin99% 3 PelaksanaanProgramKerrjaPengembanganyang didukungolehdokumenterotorisasibaru mencapi75%pelaksanaanprogramkerja pengembangan99% 4 Kehadiranasistenpraktikumyangsesuaijadwal yangditetapkanbarumencapi75%99% AnalisisPenyebab

RencanaTindakLanjut

5.2. UnitLaboratoriumProgramStudiIlmuKomunikasi Hasilkinerja LaboratoriumProgramStudiIlmuKomunikasisecarakuantitatifdalam bentuk indeks kinerja tidak bisa ditampilkan karena proses audit tidak bisa dilaksanakan. 6. FakultasTeknologiIndustri 6.1. UnitLab.ProdiTeknikKimia Hasil kinerja Lab. Prodi Teknik Kimia secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.80, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing lab bisadlihatpadatable4.814.86.

BPM-UII-YOGYAKARTA/2011

Halaman 118 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No Tabel4.80.HasilCapaianKinerjaPeriode2010UnitLaboratoriumProgramStudiT.Kimia IndeksKinerjaLaboratorium IndikatorKinerja Evaluasi Kimia Komp. Pengatar Per


Tekstil Proses Proses T.Kimia tekstilan Operasi Tek.Kimia

1 PencapaianSasaranMutuUnit(SMU) 3.67 3.50 3.67 3.67 3.50 3.67 2 Pencapaianprogramkerjarutin 3.50 3.25 3.50 3.25 3.25 3.25 3 Pencapaianprogramkerjapengembangan 3.50 0.00 3.50 2.25 3.25 2.50 4 PersiapanPraktikum 3.60 3.50 3.60 3.70 3.40 3.70 5 PelaksanaanPraktikum 4.00 3.50 4.00 3.50 3.50 3.50 6 ResponsiPraktikum 0.00 3.75 4.00 4.00 4.00 4.00 7 EvaluasiPraktikum 4.00 3.60 4.00 4.00 3.70 4.00 8 KinerjaLab 4.00 3.00 2.33 3.00 3.33 3.00 9 PenerapanProsedurKerjauntukLab 4.00 3.33 4.00 3.33 3.00 3.33 10 Pemahaman,realisasidanevaluasiDCM 4.00 3.75 4.00 2.75 3.75 2.75 11 EvaluasiKedisiplinanKerja 4.00 2.00 4.00 3.00 3.50 3.00 12 PengendaliandanevaluasiKeluhanPelanggan 4.00 3.00 4.00 3.00 3.50 3.00 IndeksKinerja 3.52 3.02 3.72 3.29 3.47 3.31 Tabel.4.81.TemuanDeskriptifKinerjaPeriode2010Lab.Evaluasi.TekstilProdiT.Kimia TemuanLab.Evaluasi.Tekstil AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Terlalu padat acara praktikum TindakanPerbaikan: TidakadaResponsiuntuk yangharusdilaksanakan praktikumEvaluaiTekstil Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada webtersebut 2 Belumadaprogrampembuatanweb TindakanPerbaikan: SosialisasiSAPbelummelalui Akandibuatwebdandiupload dilaboratorium web padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada webtersebut 3 Belumadaprogrampembuatanweb TindakanPerbaikan: JadwalPraktikumtidakdimuat dilaboratorium Akandibuatwebdandiupload dalamweb padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut 6 SoaialisasiSMUbelumdimuatdi Belumadapembuatanprogramweb web untukdilaboratorium TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut

Programkerjapengembangan tidakdimuatdiweb

Belumadaprogrampembuatanweb dilaboratorium

ProgramKerjsRutintidak disosialisasikanviaweb

Belumadapembuatanprogramweb untukdilaboratorium

BPM-UII-YOGYAKARTA/2011

Halaman 119 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel.4.82.TemuanDeskriptifKinerjaPeriode2010Lab.KimiaProsesProdiT.Kimia TemuanLab.Evaluasi.Tekstil No. Deskripsi 1 TidakadaResponsiuntuk praktikumEvaluaiTekstil AnalisisPenyebab RencanaTindakLanjut

SosialisasiSAPbelummelalui web

Terlalu padat acara praktikum TindakanPerbaikan: yangharusdilaksanakan Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada webtersebut Belumadaprogrampembuatanweb TindakanPerbaikan: Akandibuatwebdandiupload dilaboratorium padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada webtersebut TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut

JadwalPraktikumtidakdimuat dalamweb

Belumadaprogrampembuatanweb dilaboratorium

Programkerjapengembangan tidakdimuatdiweb

Belumadaprogrampembuatanweb dilaboratorium

ProgramKerjsRutintidak disosialisasikanviaweb

Belumadapembuatanprogramweb untukdilaboratorium

SoaialisasiSMUbelumdimuatdi Belumadapembuatanprogramweb web untukdilaboratorium

TindakanPerbaikan: Akandibuatwebdandiupload padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepada webtersebut

Tabel.4.83TemuanDeskriptifKinerjaPeriode2010Lab.KomputasiProsesProdiT.Kimia TemuanLab.KomputasiProses AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SMUbelumdimuatdiweb Belum ada program pembuatan web TindakanPerbaikan: Akandibuatwebdanakandiupload dilaboratorium padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada web tersebut 2 ProgramKerjabelumdimuat diweb Programpembuatanwebbelum diprogramkan TindakanPerbaikan: Akandibuatwebdanakandiupload padatanggal29April2011 TindakanPencegahan Akan dilakukan Maintenance pada web tersebut

BPM-UII-YOGYAKARTA/2011

Halaman 120 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.KomputasiProses No. Deskripsi 3 ProgramKerjapengembangan belumadadiweb AnalisisPenyebab Pembuatanwebdilaboratorium belumdiprogramkan RencanaTindakLanjut TindakanPerbaikan: Akandibuatkanwebdanakandi uploadpadatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancepadaweb tersebut TindakanPerbaikan: Akandilakukanpembuatanwebdan akandiuploadpadatanggal29 April2011 TindakanPencegahan AkandilakukanMaintenanceterhadap webtersebut TindakanPerbaikan: Akandilakukanpembuatanwebdan akandiuploadpadatanggal29 April2011 TindakanPencegahan AkandilakukanMaintenanceterhadap webtersebut TindakanPerbaikan: Akandilakukanpromosilewatweb padatanggal29April2011 TindakanPencegahan AkandilakukanMaintenancedanup dateterhadapwebtersebut TindakanPerbaikan: Akandilakukanpromosiaplikasi softwarekedosendosen TindakanPencegahan AkandilakukanMaintenancepromosi terhadapaplikasisoftwaretersebut Tabel.4.84TemuanDeskriptifKinerjaPeriode2010Lab.PengantarTek.KimiaProdiT.Kimia TemuanLab.PengantarTek.Kimia AnalisisPenyebab No. Deskripsi 1 Sosialisasi SMU, Program Kerja Laboratoriumbelummemilikiweb rutin dan pengembangan hanya melaluirapatdanditempel 2 Pelaksanaan program Program pengembangan belum pengembangan<75% jelasdantergantungjurusan RencanaTindakLanjut TindakanPerbaikan: Akandibuatwebdandilakukan sosialisasimelaluiweb TindakanPerbaikan: Memperjelasarahpengembangan TindakanPencegahan Lebihproaktifkejurusan TindakanPerbaikan: Merencanakantindaklanjut TindakanPencegahan Lebihproaktifkejurusan TindakanPerbaikan: Mengoptimalkanpengembangan laboratorium TindakanPencegahan Sosialisasi perkembangan laboratorium TindakanPerbaikan: AkandilakukanevaluasiPK

Sosialisasijadwalbelum dimuatdiweb

Webuntuklaboratoriumbelum diprogramkan

SosialisasiSAPbelumlewat Web

ProgrampembuatanwebuntukLab. Belumada

Tidakadakunjungandari pihakluarkelaboratorium

Kurangpromosilaboratoriumke pihakluar

Hanyaadasatudosenyang melakukanpenelitian

Aplikasisoftwaremasihterbatas

Belumadarencanatindaklanjut Programpengembangan darievaluasiprogram laboratoriumtergantungjurusan pengembangan

Junganlaboratorium<10%

Pengembanganlaboratoriumbelum optimal

BelumsemuaPKdievaluasi

BPM-UII-YOGYAKARTA/2011

Halaman 121 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.PengantarTek.Kimia No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan Evaluasi PK dilakukan secara berkala TindakanPerbaikan: AkandisesuaikandandibuatDCM baru TindakanPencegahan EvaluasiDCMsecaraberkala TindakanPerbaikan: RevisiDCM TindakanPencegahan EvaluasiDCMsecaraberkala Tabel.4.85.TemuanDeskriptifKinerjaPeriode2010Lab.PertekstilanProdiT.Kimia TemuanLab.Pertekstilan No. Deskripsi 1 SasaranMutudanProgramkerja belumdisosialisasikanlewat web AnalisisPenyebab Belumdiketahuidanbelumada kesepakatanharus disosialisasikanlewatweb RencanaTindakLanjut TindakanPerbaikan: Akandilakukanusahasosialisasi lewatWEB TindakanPencegahan SosialisasilewatWEB TindakanPerbaikan: DilakukanevaluasiProsedur Kerjaen TindakanPencegahan PerludilakukanevaluasiProsedur Kerjasecaraperiodik Tabel.4.86.TemuanDeskriptifKinerjaPeriode2010Lab.OperasiTek.KimiaProdiT.Kimia TemuanLab.OperasiTek.Kimia No. Deskripsi 1 SosialisasiSMU,ProgramKerja RutindanPengembanganhanya melaluirapatdanditempel AnalisisPenyebab RencanaTindakLanjut

DCMyangberlakutersedianamun Beberapadokumenbarubelum belumsesuaidenganPMyang masukDCM berlaku

BelumsemuadokumenmasukDCM

Dokumendokumenbarubelum dimasukanDCM

EvaluasiProsedurKerjabelum dilakukan100%

Belumdiketahuikalauhal tersebutadalahperlu

Laboratoriumbelummemilikiweb TindakanPerbaikan: Akandibuatwebdandilakukan sosialisasimelaluiweb TindakanPerbaikan: Memperjelasarahpengembangan

Pelaksanaanprogram pengembangan<75%

Programpengembanganbelum jelasdantergantungjurusan

Belumadarencanatindak lanjutdarievaluasiprogram pengembangan

TindakanPencegahan Lebihproaktifkejurus Programpengembangan TindakanPerbaikan: laboratoriumtergantungjurusan Merencanakantindaklanjut TindakanPencegahan Lebihproaktifkejurusan Pengembanganlaboratoriumbelum TindakanPerbaikan: optimal Mengoptimalkanpengembangan laboratorium TindakanPencegahan Sosialisasiperkembangan laboratorium TindakanPerbaikan: AkandilakukanevaluasiPK TindakanPencegahan EvaluasiPKdilakukansecara berkala

Kenaikankunjungan laboratorium<10%

BelumsemuaPKdievaluasi

BPM-UII-YOGYAKARTA/2011

Halaman 122 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.OperasiTek.Kimia No. Deskripsi 6 DCMyangberlakutersedia namunbelumsesuaidenganPM yangberlaku AnalisisPenyebab Beberapadokumenbarubelum masukDCM RencanaTindakLanjut TindakanPerbaikan: AkandisesuaikandandibuatDCM baru TindakanPencegahan EvaluasiDCMsecaraberkala TindakanPerbaikan: RevisiDCM TindakanPencegahan EvaluasiDCMsecaraberkala

BelumsesuaidokumenmasukDCM

Dokumendokumenbarubelum dimasukanDCM

6.2. UnitLaboratoriumProdiTeknikInformatika Hasilkinerja UnitLaboratoriumProdiTeknikInformatikasecarakuantitatifdalam bentuk indeks kinerja bisa dilihat pada table 4.87, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masing masinglabbisadlihatpadatable4.884.92.
Tabel4.87.HasilCapaianKinerjaPeriode2010UnitLab.T.Informatika IndeksKinerjaLaboratorium No IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPelatihan/Praktikumpendukungmata 4 kuliah 5 PelaksanaanPraktikum/pelatihan ResponsiPraktikum/ujianpraktikum/tesakhir 6 pelatihan 7 EvaluasiPraktikum/pelatihan 8 KinerjaLab 9 PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatan 10 Mutu(DCM) 11 EvaluasiKedisiplinanKerja 12 PengendaliandanevaluasiKeluhanPelanggan 1 2 3 IndeksKinerja Tabel4.88.TemuanDeskriptifKinerjaPeriode2010UnitLab.SIRKELProdiT.Informatika TemuanLab.SistemInformasidanRekayasaPerangkat Lunak(SIRKEL) AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ketercapaiansasaranmutubaru85% 2 Dokumenbuktikegiatanmasihberupasoftcopy dicomputerkalab.Otorisasisertaakses terhadapinformasibuktikegiatanmenjadisulit dilakukan.Notulenrapat,buktitindaklanjut, programpengembanganmasihdalamsoftcopy. FormulirkehadiranpraktikumdanasistenBlm menggunakanformulirstandard,tidakada realisasimateripraktikum,sehinggatidak lengkapkesesuaianmateripraktikumnya Kehadiranpraktikummahasiswabelummencapai 100%(96%) Belumadadokumenyangmengukurjumlah mahasiswanilaiC,jugaevaluasidantindak lanjutnya DitemukanNKA3,00adalah75% KinerjaLabsebagairolemodelsudahberjalan denganadanyakunjungan,tetapibelumadabukti
SIRKEL Pemrograman &Inform Teori Grafika Komputasi dan &Sistem Multimedia Cerdas Sistem Jaringan Komputer

3.33 3.25 3.25 3.80 3.75 3.75 3.00 4.00 2.00 3.75 4.00 2.00 3.32

3.33 3.25 3.25 3.70 3.25 3.75 3.60 2.67 2.33 3.50 4.00 4.00 3.39

4.00 3.50 3.00 3.55 3.33 4.00 2.50 3.67 0.00 4.00 4.00 3.23

3.50 4.00 3.50 3.90 3.50 3.75 4.00 3.00 4.00 3.50 4.00 2.50 3.60

3.83 3.25 0.00 3.33 3.50 3.75 3.50 4.00 2.67 4.00 4.00 0.00 2.99

4 5

6 7

BPM-UII-YOGYAKARTA/2011

Halaman 123 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.SistemInformasidanRekayasaPerangkat Lunak(SIRKEL) No. Deskripsi dokumentasidarilab,karenakegiatanterpusat dijurusan(dokumentasidijurusan).Saran:ada buktikunjungan(bukutamu)untuklab 8 Belumtersediadokumenprosedurkerjayang berlakuyangsesuaiformatdokumenmutuPK 9 DitemukanBelumadaevaluasiProsedurKerja 10 MetodesosialisasiDCMbelumsesuaimetodeyang sesuaiprosedurmutu,sosialisasiDCMditempel diraktapibelumotorisasi Pengelolaankeluhanpelanggandilakukanlewat web,danbelumsesuaiSMM. Adaevaluasi,tindaklanjutterhadapkeluhan pelanggantapibelumsesuaiSMM. AnalisisPenyebab RencanaTindakLanjut

11 12

Tabel4.89.TemuanDeskriptifKinerjaPeriode2010UnitLab.PemrogramandanInformatikaTeoriProdi T.Informatika TemuanLab.PemrogramandanInformatikaTeori No. Deskripsi 1 Ketercapaiansasaranmutumasih75% 2 3 BelumadadokumendiotorisasiuntukEvaluasi tindaklanjutpencapaianSMU Sosialisasiprogramkerjadanprogram pengembangan,jadwalpelatihanbelumefektif, barudirapatdanditempel,tidakmenggunakan web. SosialisasiSAPbelumefektifsecaraoptimal, barumenggunakanmediabukupanduansaja Tingkatkehadiranmahasiswapraktikum85% Evaluasitindaklanjutkehadiranmahasiswa praktikumbelumsampaipenjelasanakarmasalah Kehadiranpengawasresponsi<100% Belumadadokumentasievaluasitindaklanjut padapengukuranevaluasipraktikumsamapai penjelasanakarmasalah HasilNKA>3ada87% EvaluasitindaklanjutterhadapAsistendengan NKA<3,Belumadapenjelasanakarmasalah KinerjaLabsebagairolemodelsudahberjalan denganadanyakunjungan,tetapibelumadabukti dokumentasidarilab,karenakegiatanterpusat dijurusan(dokumentasidijurusan).Saran:ada buktikunjungan(bukutamu)untuklab PKyangtersediabaru50%kegiatandilapangan BelumpernahdilakukanpengukuranevaluasiPK AnalisisPenyebab RencanaTindakLanjut

4 5 6 7 8

9 10 11

12 13

Tabel4.90.TemuanDeskriptifKinerjaPeriode2010UnitLab.GrafikadanMultimediaProdiT.Informatika TemuanLab.GrafikadanMultimedia No. Deskripsi 1 EvaluasidantindaklanjutSMUsudahadatetapi tidakadabuktinotulenyangdiotorisasi 2 ProgramkerjarutinBelumdilaksanankan100% (barun75%) 3 Programkerjapengembanganadayangbelum dilaksanakan(baru50%) 4 Ketersediaanjadwalpraktikum/pelatihan7hari. 5 KehadiranmahasiwapelatihanTingkatkehadiran 75% AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 124 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.GrafikadanMultimedia No. Deskripsi 6 KinerjaLabsebagairoleofmodelmasihrendah (belumadakunjunganbenchmark) 7 Prosedurkerjayangtersediadiimplementasikan 75% 8 Tidaktersediapengukuranpemahaman,realisasi danevaluasiDaftarCatatanMutu(DCM) 9 LabGMMadalahlabpendukung/pelatihan sehinggatidakadakegiatanpraktikum, Padaperiode1tahuninilabinibelummelakukan pelatihan,baruakandilakukanworkshopsemester ini(bulanmei). AnalisisPenyebab Workshoptertunda karenaerupsimerapi kemudiandiundur. Kemudiansemester ganjil2010/2011lab digunakanoleh fakultasFPBS. Sehinggabeberapa borangtidakbisa (3043)diisi RencanaTindakLanjut

Tabel4.91.TemuanDeskriptifKinerjaPeriode2010UnitLab.KomputasidansistemCerdasProdiT. Informatika TemuanLab.KomputasidansistemCerdas AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ketercapaiansasaranmutubaru90 2 3 4 5 6 7 8 9 Tersediaevaluasidantindaklanjuttetapibelum adapenjelasanakarmasalah Sosialisasiprogrampengembangandenganlewat web,danrapat,tetapitidakditempel Programpengembangandilaksanakan90%, Penelitianbelumdipublikasikan Bahanpenunjangpraktikumtersedia2hari sebelumnya Kehadiranasistenpraktikumkurangdari100% Kehadiranmahasiswapraktikum83% Tingkatkehadiranmahasiswaresponsi97% KunjunganKeLabsebagairolemodelmasih sedikit,kenaikansekitar5%,dantidakada buktiterdokumentasi MetodesosialisasiDaftarcatatanmutuDitempel padatempatpenyimpanan,tanpaotorisasibpm. Dokumenpengendaliankeluhanpelanggan,tidak sesuaidokSMM,diterapkanmengikutiketentuan Adatindaklanjutdanevaluasiterhadapkeluhan pelanggan,tapitidaksesuaidokSMM

10 11

12

Tabel4.92.TemuanDeskriptifKinerjaPeriode2010UnitLab.SistemJaringanKomputerProdiT. Informatika TemuanLab.SistemJaringanKomputer No. Deskripsi 1 Ketercapaiansasaranmutubelummencapai100% baru82% 2 Sosialisasiprogramkerjayangefektifbelum lewatweb,baruadalewatrapatdanditempel 3 Tidakadaprogrampengembangan,sosialisasiyang efektif,danevaluasiprogrampengembangan, Sebenarnyaadakegiatanpengembanganyang dilakukantetapitidakterdokumentasisebagai programpengembangan. 4 Sosialisasikegiatanbelumdilakukanefektif, belummenggunakanwebsecaraoptimaluntuk sosialisasijadwalpraktikumataupunSAP. 5 Formulirdaftarhadirpraktikumdanasistenbelum sesuaiformulirrealisasimateri. AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 125 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.SistemJaringanKomputer No. Deskripsi 6 FormulirkehadiranpraktikumdanasistenBlm menggunakanformulirstandard,tidakada realisasimateripraktikum,sehinggatidak lengkapkesesuaianmateripraktikumnya 7 Kehadiranpraktikummahasiswabelummencapai100 %(80%) 8 Belumadadokumenyangmengukurjumlahmahasiswa nilaiC,jugaevaluasidantindaklanjutnya 9 KinerjaLabsebagairolemodelsudahberjalan denganadanyakunjungan,tetapibelumadabukti dokumentasidarilab,karenakegiatanterpusatdi jurusan(dokumentasidijurusan).Saran:ada buktikunjungan(bukutamu)untuklab 10 Tidakadaevaluasiprosedurkerja(sejak2002) 11 TidakadadokumentasiPengelolaankeluhan pelanggandanbelumsesuaiPM.Belumada evaluasi,DanTidakadatindaklanjutterhadap keluhanpelanggantapibelumsesuaiPM AnalisisPenyebab RencanaTindakLanjut

6.3. UnitLaboratoriumProdiTeknikElektro Hasil kinerja Unit Laboratorium Prodi Teknik Elektro secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.93, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasinglabbisadlihatpadatable4.944.99.
No 1 2 3 4 5 6 7 8 9 10 11 12 Tabel4.93.HasilCapaianKinerjaPeriode2010UnitLab.ProdiT.Elektro IndeksKinerjaLaboratorium IndikatorKinerja Pemrograman DasarTeknik Kendalidan
Komputer Elektro

Mikroprosesor

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatan Mutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan

4.00 4.00 4.00 4.00 4.00 4.00 4.00 3.00 3.67 4.00 4.00 3.50 3.85

3.50 3.50 1.75 3.80 3.75 4.00 3.80 4.00 3.33 4.00 4.00 4.00 3.62

3.50 3.50 1.00 3.60 3.50 4.00 3.80 3.00 3.00 3.75 3.50 4.00 3.35

IndeksKinerja

Tabel4.93.HasilCapaianKinerjaPeriode2010UnitLab.ProdiT.Elektro(Lanjutan) IndeksKinerjaLaboratorium No IndikatorKinerja Instalasidan Elektronika


MesinListrik Telekomunikasi Digital

1 2 3 4 5 6 7 8 9 10 11 12

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatan Mutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan

3.67 3.50 1.75 3.60 3.75 4.00 3.70 2.33 3.00 4.00 2.50 3.00 3.23

3.83 4.00 4.00 4.00 3.75 4.00 4.00 3.00 3.33 4.00 4.00 4.00 3.83

3.50 3.50 2.75 3.60 3.75 3.50 3.60 2.33 4.00 3.75 2.50 4.00 3.40

IndeksKinerja

BPM-UII-YOGYAKARTA/2011

Halaman 126 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.94.TemuanDeskriptifKinerjaPeriode2010Lab.PemrogramanKomputerProdiT.Elektro TemuanLab.PemrogramanKomputer No. Deskripsi 1 AdasatuPKyangtidaksesuai penerapannya 2 Moduldalamprosesreview 3 Keluhanadatapitidak didokumentasikan AnalisisPenyebab RencanaTindakLanjut

Tabel4.95.TemuanDeskriptifKinerjaPeriode2010Lab.DasarTeknikElektroProdiT.Elektro TemuanLab.DasarTeknikElektro No. Deskripsi 1 SMUbelumdisosialisasilewatweb Sasaranmututercapai86,1%,(Target 2 100%) Programkerjabelumdisosialisasi 3 lewatweb Programpengembangansudahdilakukan, 4 tapibelumadadokumennya Sosialisaiprogrampengembanganbelum 5 lewatweb Pelaksanaanprogrampengembangan 6 belummaksimalkarenaterkendala cuaca Evaluasiprogrampengembangansudah 7 dilakukankepadamahasiswa,tapi belumdidokumentasi SAPbelumdisosialisasikandenganweb 8 9 10 11 Kehadiranmahasiswa99%(target100%) Jumlahmahasiswayangmengulang praktikum19,3%(targetmaksimal10%) EvaluasiPKsudahdilakukantetapi belumdidokumentasi AnalisisPenyebab RencanaTindakLanjut

Tabel4.96.TemuanDeskriptifKinerjaPeriode2010Lab.KendalidanMikroprosesorProdiT.Elektro TemuanLab.KendalidanMikroprosesor No. Deskripsi SMUbelumdisosialisaikandenganweb. 1 2 3 4 5 6 7 8 9 10 11 12 Sasaranmutubelumtercapaiantara 75%dengan99,9% SosialisasiProgramkerjabelum disosialisasikanlewatweb. ProgramkerjaPengembanganadatapi belumdidokumentasikan. ProgramPengembangansosialisasi masihlisan. Pelaksanaanprogrampengembangan dalamproses EvaluasiProgramPengembanganbelum didokumentasi Adasosialisasijadwalpraktikum, tapibelumdisosialisaikanlewatweb. AdasosialisasiSAPPraktikum,tapi belumdisosialisaikanlewatweb. Kehadiranasistenpraktikum75% sesuaijadwalmasih99% KehadiranmahasiswaPraktikum75% sesuaijadwalyangditetapkanmasih kurang99% Jumlahmahasiswayangmengulang Praktikumdiantara16%sampai20%. AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 127 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.KendalidanMikroprosesor No. Deskripsi Jumlahmodulyangdireviewdengan pengesahanreviewerdalamproses. EvaluasiPKdilakukan,tapibelum didokumentasikan. DCMyangberlakutersediabaru diotorisasiunit. AnalisisPenyebab RencanaTindakLanjut

Tabel4.97.TemuanDeskriptifKinerjaPeriode2010Lab.InstalasidanMesinListrikProdiT.Elektro TemuanLab.InstalasidanMesin Listrik No. Deskripsi 1. SosialisasiSMUtidaklewatWEB AnalisisPenyebab Belumterfikirkanuntuk disosialisasikanlewatWEB RencanaTindakLanjut Tindakanperbaikan: Akan disampaikan ke jurusan untuk dibantulewatWEB TindakanPencegahan: Setiap kali ada perubahan Sasaran Mutu akan disampaikan ke Jurusan agardibantuuntuklewatWEB Tindakanperbaikan: Akan disampaikan ke jurusan untuk dibantulewatWEB TindakanPencegahan: Setiap kali ada perubahan Sasaran Mutu akan disampaikan ke Jurusan agardibantuuntuklewatWEB Tindakanperbaikan: Akan disampaikan ke jurusan untuk dibantulewatWEB TindakanPencegahan: Setiap kali ada perubahan Sasaran Mutu akan disampaikan ke Jurusan agardibantuuntuklewatWEB Tindakanperbaikan: Akan disampaikan ke jurusan untuk dibantulewatWEB TindakanPencegahan: Setiap kali ada perubahan Sasaran Mutu akan disampaikan ke Jurusan agardibantuuntuklewatWEB Tindakanperbaikan: Akandisampaikankejurusanuntuk dibantulewatWEB TindakanPencegahan: SetiapkaliadaperubahanSasaran MutuakandisampaikankeJurusan agardibantuuntuklewatWEB Tindakanperbaikan: Dimintakantandabuktipenerimaan nilai TindakanPencegahan: Agardibuatkanformbukti penerimaanagartidakterlupakan Tindakanperbaikan: Segeramenetapkanreviewerdan mintapengesahan TindakanPencegahan: MemintaJurusanuntukmembantu menetapkanreviewer Tindakanperbaikan: AkansegeradilakukanevaluasiPK

2.

SosialisasiProgramKerjatidak lewatWEB

Belumterfikirkanuntuk disosialisasikanlewatWEB

3.

SosialisasiProgramKerja PengembangantidaklewatWEB

Belumterfikirkanuntuk disosialisasikanlewatWEB

4.

SosialisasiJadwaltidaklewat WEB

Belumterfikirkanuntuk disosialisasikanlewatWEB

5.

SosialisasiSAPtidaklewatWeb

Belumterfikirkanuntuk disosialisasikanlewatWEB

6.

Pengiriman nilai tidak ada bukti Tidakmemintatandabukti penerimaan penerimaanpengirimannilai

7.

Modul belum direview, sedang Sedangdicarireviewernya dalamproses

8.

PKbelumdievaluasi

BelummelakukanevaluasiPK

BPM-UII-YOGYAKARTA/2011

Halaman 128 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.InstalasidanMesin Listrik No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Evaluasidilakukansetiaptahun akademi Tindakanperbaikan: Akandibuatdokumenkinerjastaf TindakanPencegahan: Kinerjastafakandisusundan didokumentasikansecararapi Tindakanperbaikan: Akandidokumentasikan TindakanPencegahan: Dibuatdokumentasi

9.

Evaluasi staf tidak terdomentasi Belumdilakukandokumentasi kinerjastaf kinerjastaf

10.

Evaluasi dan tindak keluhan ada, terdokumentasi

lanjut Tidakadakeluhantetapi tidak tidakdirekap

Tabel4.98.TemuanDeskriptifKinerjaPeriode2010Lab.TelekomunikasiProdiT.Elektro No. 1 2 3 4 5 Tabel4.99.TemuanDeskriptifKinerjaPeriode2010Lab.ElektronikaDigitalProdiT.Elektro No. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 TemuanLab.ElektronikaDigital Deskripsi SMUbelumdisosialisasilewatweb Sasaranmututercapai89,7%,(target100%) Programkerjabelumdisosialisasilewatweb Sosialisaiprogrampengembanganbelumlewatweb Pelaksanaanprogrampengembanganbelumadadokumen Evaluasiprogrampengembangansudahdilakukankepada mahasiswa,tapibelumdidokumentasi Sosialisasijadwalbelumdenganweb SAPbelumdisosialisasikandenganweb Kehadiranmahasiswa82,6%(target100%) Kehadiranpengawasresponsiratarata87,5% Kehadiranmahasiswaresponsi94,7%(target100%) Jumlahmahasiswayangmengulangpraktikum11,1% (targetmaksimal10%) Jumlahasistenataudosenpengampupraktikumdengan NilaiKinerjaAsisten(NKA)73,55%(target3.00) PelaporanpenggunaananggaranLabdiotorisasitidak tepatwaktu Modulpraktikumdalamprosesreview Kunjunganlabnaik,tapibelumdidokumentasi DCMdiotorisasiunit Evaluasistafdifakultas,tidakadadokumen AnalisisPenyebab RencanaTindakLanjut TemuanLab.Telekomunikasi Deskripsi SasaranMututercapaiantara75%99,9% KehadiranmahasiswaPraktikumantara75%99% Moduldalamprosesmencarireviewyangsesuaidengan bidang DokumenPKsudahdiotorisasi,jumlahyangtersedia 75%100% JumlahPKyangdiimplementasikandilapangan75% 99,9% AnalisisPenyebab RencanaTindakLanjut

BPM-UII-YOGYAKARTA/2011

Halaman 129 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

6.4. UnitLaboratoriumProdiTeknikIndustri HasilkinerjaUnitLaboratoriumProdiTeknikIndustrisecarakuantitatifdalam bentuk indeks kinerja bisa dilihat pada table 4.100, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasingdivisibisadlihatpadatable4.1014.106.
Tabel4.100.HasilCapaianKinerjaPeriode2010UnitLab.T.Industri IndeksKinerja No 1 2 3 4 5 6 7 8 9 10 11 12 Tabel4.100.HasilCapaianKinerjaPeriode2010UnitLab.T.Industri(Lanjutan) IndeksKinerja No IndikatorKinerja Enterprise
R.Planning

IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan

Inovasidan Pengemb.Org

Pemodelan& SimulasiInd

APKdan Ergonomi

4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4.00 4

3.50 3.75 3.50 4.00 3.75 3.75 3.90 3.67 3.33 4.00 4.00 4.00 3.76

3.83 3.75 3.75 3.90 3.75 4.00 3.90 4.00 4.00 3.50 0.00 3.50 3.49

IndeksKinerja

DataMining

Lab.Sist Manufaktur

1 2 3 4 5 6 7 8 9 10 11 12

PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan

3.83 4.00 4.00 4.00 3.75 4.00 3.20 0.33 4.00 3.75 4.00 4.00 3.57

3.67 3.75 3.75 3.90 3.75 4.00 3.70 3.67 3.33 4.00 3.50 4.00 3.75

3.50 3.50 3.25 3.80 3.75 3.75 3.10 4.00 3.00 3.75 4.00 3.58

IndeksKinerja

Tabel4.101.TemuanDeskriptifKinerjaPeriode2010Lab.IPOProdiT.Industri TemuanLab.InovasidanPengembangan Organisasi(IPO) AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ditemukan Laboratorium belum menjadi Belum ada mitra riset dari TindakanPerbaikan: Pusat Riset, riset masih terbatas pada luar,sedangdijajaki Penjajakanmitrarisetdari TugasAkhirmahasiswa luarsehinggadimungkinkan diselenggarakanrisetbersama TindakanPencegahan: Perlutindakankonkritberupa surveysurveylapanganuntuk berorientasipadariset bersama

BPM-UII-YOGYAKARTA/2011

Halaman 130 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.102.TemuanDeskriptifKinerjaPeriode2010Lab.DELSIMProdiT.Industri TemuanLab.PemodelandanSimulasiIndustri(DELSIM) AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 TingkatKehadiranPraktikumdanResponsibelum sesuai 2 PelaporanPenggunaananggaranlabdiotorisasitidak tepatwaktu 3 PeningkatanPemanfaatanlabsebagaipusatRiset belummaksimal(antara1019%)dibandingsemester sebelumnya 4 BelumseluruhPKdiImplementasikan 5 BelumseluruhPKdievaluasi

Tabel4.103.TemuanDeskriptifKinerjaPeriode2010Lab.APKdanErgonomiProdiT.Industri TemuanLab.APKdanErgonomi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutuUnit(SMU)belumtercapai100% 2 3 4 5 6 7 8 9 PelaksanaanProgramKerjaRutinBelum100% ProgramPengembanganBelumdilaksanakan100% BahanPenunjangFasilitasPraktikumdenganbukti dokumentidaktepatwaktu TingkatKehadiranPraktikumMahasiswabelum100% JumlahMahasiswayangmengulangpraktikumantara10 15% DCMsesuaiPMyangberlaku,diotorisasiunit

KedisiplinanKerjabelumdiukurdandievaluasi karenatidakadastaf Evaluasi dan Tindak Lanjut terhadap Keluhan belum sesuaiPM

Tabel4.104.TemuanDeskriptifKinerjaPeriode2010Lab.EnterpriseResourcePlanningProdiT. Industri TemuanLab.EnterpriseResourcePlanning AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutuUnit(SMU)belumtercapai100% 2 TingkatKehadiranPraktikumMahasiswabelum100% 3 TidakadaAsistensehinggatidakadapengukuranNKA 4 BelumadaReviewterhadapmodulpraktikum 5 BelumadapemanfaatanlabsebagaipusatRisetPS 6 BelumadakunjungankeLab Tabel4.105.TemuanDeskriptifKinerjaPeriode2010Lab.DataMiningProdiT.Industri TemuanLab.DataMining AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Tidakadatemuan Tabel4.106.TemuanDeskriptifKinerjaPeriode2010Lab.SistemManufakturProdiT.Industri TemuanLab.SistemManufaktur AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMutuUnit(SMU)belumtercapai100% 2 TingkatKehadiranPraktikumMahasiswabelum100% 3 TidakadaAsistensehinggatidakadapengukuranNKA 4 BelumadaReviewterhadapmodulpraktikum 5 BelumadapemanfaatanlabsebagaipusatRisetPS 6 BelumadakunjungankeLab


BPM-UII-YOGYAKARTA/2011 Halaman 131 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

6.5. UnitLaboratoriumProdiTeknikMesin Hasil kinerja Unit Laboratorium Prodi Teknik Mesin secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.107, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untukmasingmasingdivisibisadlihatpadatable4.1084.113.
Tabel4.107.HasilCapaianKinerjaPeriode2010UnitLab.T.Mesin No IndikatorKinerja 1 2 3 4 5 6 7 8 9 10 11 12 PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDCM EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan Mekatronika 3.20 4.00 4.00 3.80 3.50 3.75 3.00 1.33 2.67 3.50 1.00 4.00 3.15 IndeksKinerja CAD/CAM/CAE ProsesProduksi 3.33 2.83 2.25 2.50 0.25 2.75 2.90 3.10 2.00 3.00 3.50 3.50 1.90 3.00 0.33 1.33 2.67 2.33 3.50 2.75 * 2.50 0.00 2.28 2.46

IndeksKinerja

Tabel4.107.HasilCapaianKinerjaPeriode2010UnitLab.T.Mesin(Lanjutan) IndeksKinerja No IndikatorKinerja Sistem MetrologiIndustri Manufaktur danInstrumentasi 1 PencapaianSasaranMutuUnit(SMU) 3.00 3.33 2 Pencapaianprogramkerjarutin 2.50 3.50 3 Pencapaianprogramkerjapengembangan 2.25 0.00 4 PersiapanPraktikum 3.30 2.50 5 PelaksanaanPraktikum 3.50 3.75 6 ResponsiPraktikum 2.75 3.50 7 EvaluasiPraktikum 3.56 3.50 8 KinerjaLab 0.00 0.00 9 PenerapanProsedurKerjauntukLab 4.00 2.33 10 Pemahaman,realisasidanevaluasiDCM 4.00 3.75 11 EvaluasiKedisiplinanKerja 1.00 0.00 12 PengendaliandanevaluasiKeluhanPelanggan 2.00 1.50 IndeksKinerja 2.65 2.31

Konversi Energi 3.17 3.00 2.25 3.60 3.50 4.00 2.88 1.33 2.33 3.75 * 0.00 2.71

Tabel4.108.TemuanDeskriptifKinerjaPeriode2010Unitlab.Lab.MekatronikaProdiT.Mesin TemuanLab.Mekatronika AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 BelumterdapatWTyang WTbelumdibuatsejakLab TindakanPerbaikan: diotorisasi didirikan(2006), PembuatanWTuntukdapat ketidaktelitiandalam diotorisasi penanganandokumenmutu TindakanPencegahan: Pengecekandokumenmutu 2 Ketercapaiansasaranmutu Mahasiswabelummengetahuitata TindakanPerbaikan: 33%,seharusnya100% tertib,materipraktikum PencantumantatatertibdiBuku dianggapsulit PetunjukPraktikum TindakanPencegahan: PerbaikanBukuPetunjukPraktikum, perbaikanmetoderesponsi 3 Kehadiranpraktikan72% Mahasiswabelummengetahuitata TindakanPerbaikan: tertib PencantumantatatertibdiBuku PetunjukPraktikum 4 Penyerahannilaiakhir Ketidaktelitiandalam TindakanPerbaikan: praktikumolehasistentanpa penanganandokumenmutu Pembuatanformulirpengumpulan buktipenyerahan nilai

BPM-UII-YOGYAKARTA/2011

Halaman 132 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanLab.Mekatronika Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Pencatatanwaktupengumpulannilai TindakanPencegahan: Menunjukpraktikandengannilai baikuntukmenjadiasisten, pelatihanasistensebelumpraktikum TindakanPerbaikan: Perencanaanreviewmodulpraktikum olehtenagaahli TindakanPencegahan: Pelaksanaanreviewmodulpraktikum olehtenagaahli TindakanPerbaikan: Pembuatandokumencatatankunjungan laboratorium TindakanPencegahan: Pencatatankunjunganlaboratorium TindakanPerbaikan: PerencanaanpengukuranevaluasiPK TindakanPencegahan: PelaksanaanevaluasiPK TindakanPerbaikan: Perencanaanpembuatandaftartugas hariandanpelaksanaanevaluasi kinerjastaf TindakanPencegahan: Perencanaanpembuatandaftartugas hariandanpelaksanaanevaluasi kinerjastaf TindakanPerbaikan: Perencanaantindaklanjutevaluasi staf TindakanPencegahan: Pelaksanaantindaklanjutevaluasi staf

PersentaseNKA3.00adala 33%,seharusnyaminimal90%

Belumadamodulpraktikum yangdireviewolehtenaga ahli,seharusnyaminimal80%

Kurangnyaminatmahasiswa menjadiasisten,seleksi asistenkurangkompetitif, kompetensiasistenbelum memadai Belumdianggapperlureview modulpraktikumolehtenaga ahli

Tidakditemukandokumen catatankunjungan laboratorium

Dukumencatatankunjungan laboratoriumbelumdibuat

Belumdilakukanpengukuran jumlahPKyangdievaluasi

Belumdianggapperluevaluasi PK

Evaluasikedisiplinanbaru berdasarkanevaluasipresensi dariDivisiUmumFTI, seharusnyadilengkapidengan daftartugashariandan daftarevaluasikinerjastaf

Belumdibuatdaftartugas hariandanbelumdilakukan evaluasikinerjastaf

10

Belumadabuktitindaklanjut atashasilevaluasistaf

Belumadatindaklanjuthasil evaluasistaf

Tabel4.109.TemuanDeskriptifKinerjaPeriode2010UnitLab.SistemManufakturProdiT.Mesin TemuanLab.SistemManufaktur AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Belumadanotulenrapat Tidakdilakukansecarakhusus, TindakanPerbaikan: evaluasiprogramkerjarutin Mengusulkankepadakaprodiuntuk namunbersamasamadengan danpengembangan, pembahasankhususevaluasiprogram evaluasiprogramkerjaprodi kedisiplinankerjastaf, kerjasaatrakorja. padarakorja. keluhanpelanggan. TindakanPencegahan: Notulenrapathasilevaluasi diperiksapadaauditmendatang. 2 Kesesuaiankompetensiasisten Kurangnyapeminatmahasiswa TindakanPerbaikan: dengandaftarkualifikasi menjadiasistenpraktikum. Memperbaikisistemrekruitmen asisten asisten. TindakanPencegahan: Rekruitmenasistendilakukanjauh jauhharisebelumpraktikum dimulai. 3 SosialisasiSMU,Program Mengetahuikewajiban TindakanPerbaikan: KerjaRutindanPengembangan, menampilkannyakewebbaru Melaporkantemuankepadakajur SAPbelummelaluiwebdan untukdapatditindaklanjuti. setelahmenerimaborangAMI. rapat.

BPM-UII-YOGYAKARTA/2011

Halaman 133 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.SistemManufaktur No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Mengikutiarahandarikajur. TindakanPerbaikan: Programpengembanganlabdiarahkan kesana. TindakanPencegahan: Memeriksaprogrampengembangan telahmengarahkesanapadaawal tahunanggaran. TindakanPerbaikan: Sosialisasiuntukpraktikumyang akandatangdilakukanjugamelalui web TindakanPencegahan: Padapraktikumyangsudahberjalan (smtrgenap2010/2011),mulai sosialisasilewatweb TindakanPerbaikan: Menulisevaluasidantindaklanjut programkerjarutin TindakanPencegahan: Menulisevaluasidantindaklanjut programkerjarutin TindakanPerbaikan: Pembuatanmodulbaru TindakanPencegahan: Rapatrutin(monitoring) TindakanPerbaikan: Polareruitmendiperbaiki TindakanPencegahan: Koordinasi TindakanPerbaikan: Menulisevaluasidantindaklanjut bagimahasiswadengannilaiC TindakanPencegahan: Koordinasi TindakanPerbaikan: MengirimkannilaikeDivAkademik secepatmungkin,maksimal7hari setelahyudisiumuntukpraktikum setelahnya TindakanPencegahan: Koordinasi TindakanPerbaikan: PembuatanSAPyangsesuaidengan materipraktikum TindakanPencegahan: Koordinasi TindakanPerbaikan: Menjadikanlabuntukriset TindakanPencegahan: Koordinasi TindakanPerbaikan: Upgrade/pengadaanalat TindakanPencegahan: Koordinasi TindakanPerbaikan: Penambahananggota/asisten

Modulbelumdireviewtenaga ahli,Labbelummenjadipusat risetataurolemodel

Labbarudiarahkanuntuk keperluanpraktikumdantugas akhirmahasiswa.

No.4SosialisasiSMUbelum lewatweb No.8SosialisasiProgram Kerjabelumlewatweb

Belumtahumetodesosialisasi denganweb

Belumadaevaluasidantindak lanjutprogramkerjarutin

Belumadapenulisanevaluasi dantindaklanjutprogramkerja rutin

No.14programpengembangan belumterlaksana

Kekurangfokusanpenanggung jawabdalampembuatanmodul, karenakesibukankuliah

NilaidanIPKassistem praktikumbelummemenuhi Evaluasidantindaklanjut bagimahasiswadengannilai C

Kurangnyaminatmahasiswa menjadiasisten

Belumadapenulisantentang evaluasidantindaklanjutbagi mahasiswadengannilaiC

10

PengirimannilaikeDivAkd palinglambat1minggu sebelumyudisium

Belumadatandaterima

11

KesesuaianSAPdenganmateri praktikum

Pergantianalat

12

Laboratoriummenjadirisetdi programstudi

Belumterdokumentasi

13

Labmenjadirolemodellab rujukandibidangmasing masing

Belummenjadikanlabsebagai rujukandibidangmasingmasing

14

EvaluasidantindaklanjutPK

Bebankerjaasistenterlalu tinggi

BPM-UII-YOGYAKARTA/2011

Halaman 134 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.SistemManufaktur No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Koordinasi TindakanPerbaikan: Pengadaandokumenpengendalian keluhanpelanggan TindakanPencegahan: Koordinasi TindakanPerbaikan: Pengadaandokumenpengendalian keluhanpelanggandanmengadakan evaluasidantindaklanjutnya. TindakanPencegahan: Koordinasi

15

Ketersediaandokumen pengendaliankeluhan pelanggan

Belumadadokumenpengendalian keluhanpelanggan

16

Evaluasidantindaklanjut terhadapdokumenpengendalian keluhanpelanggan

Belumadadokumenpengendalian keluhanpelanggan

Tabel4.110.TemuanDeskriptifKinerjaPeriode2010UnitLab.MetrologiIndustridanInstrumentasi ProdiT.Mesin TemuanLab.MetrologiIndustri danInstrumentasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUHanyalewat MahasiswaPraktikanyang TindakanPerbaikan: webdan/atauditempel relatifsedikit MengadakanrapatpenjelasanSMU (4.2.3e) Mahasiswapraktikanberdomisili denganbuktinotulenyang dijogja diotorisasi Mahasiswapraktikanaktifdi Mengumumkanlewatweb kampus TindakanPencegahan: MemasukansosialisaiSMUkedalam prosedurkerja 2 SosialisasiProgramkerja MahasiswaPraktikanyang TindakanPerbaikan: yangefektif(8) Mengadakanrapatpenjelasan relatifsedikit Hanyaadasosialisilewatweb Mahasiswapraktikanberdomisili programkerjadenganbuktinotulen dan/atauditempel yangdiotorisasi dijogja Mengumumkanlewatweb Mahasiswapraktikanaktifdi kampus TindakanPencegahan: Memasukansosialisaiprogramkerja kedalamprosedurkerja 3 KetersediaanProgram Adanyakekurangtelitiandalam TindakanPerbaikan: pengembangandalamrangka Pembuatandokumensosialisasi, menyiapakankebutuhan mendukungSMUyangdidukung evaluasi,dantindaklanjutprogram kelengkapandokumen olehdokumenterotorisasi kerjapengembangantiapawaldan akhirtahun. 3.1TidaktersEdyaprogram kerjapengembangan(5.4.2) TindakanPencegahan: Dibuatdaftarcekdokumenprogram 3.2Tidakadasosialisasi kerjayangperludisiapkansetiap ProgramPengembangan(8.2.3) awaldanakhirtahunakademik 3.3Belumadapelaksanaan programpengembangan 3.3Tidakadaevaluasi ProgramPengembangan(8.2.4) 4 Kesesuaiankompetensiasisten Sangatsedikitmahasiswayang TindakanPerbaikan: praktkum Mengadakanrekruitmenasistendari mendaftarmenjadiasisten 50%kesesuaiankompetensi luaruniversitas praktikum asistenpraktikum74% (8.2.3) TindakanPencegahan: Mengadakanrekrutmenasisten praktikumdenganwaktuyanglebih lama 5 Sosialisasijadwalpraktikum MahasiswaPraktikanyang TindakanPerbaikan: Hanyaadasosialisilewatweb relatifsedikit Mengadakanrapatsosialisasi dan/atauditempel(8.5.2) Mahasiswapraktikanberdomisili jadwalpraktikumdenganbukti dijogja notulenyangdiotorisasi Mahasiswapraktikanaktifdi Mengumumkanlewatweb kampus TindakanPencegahan:

BPM-UII-YOGYAKARTA/2011

Halaman 135 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.MetrologiIndustri danInstrumentasi No. Deskripsi AnalisisPenyebab RencanaTindakLanjut Memasukansosialisaijadwal praktikumkedalamprosedurkerja TindakanPerbaikan: MengadakanrapatpenjelasanSAP denganbuktinotulenyang diotorisasi Mengumumkanlewatweb TindakanPencegahan: MemasukansosialisaiSAPkedalam prosedurkerja TindakanPerbaikan: Membuatsemuadokumenkesiapan praktikumjauhharisebelum praktikumdimulai TindakanPencegahan: Memasukandokumenketersediaan bahanpenunjangfasilitaspraktikum kedalamprosedurkerjakesiapan praktikum TindakanPerbaikan: Membuatsemuadokumenkesiapan praktikumsebelumkesiapan praktikum TindakanPencegahan: Memasukanpengecekandanseeting alatdalamProsedurkerjakesiapan praktikumm TindakanPerbaikan: Memberikanpengertianterhadap pentingnyabuktipenyerahannilai. Menyimpandenganbaikbukti penyerahannilai. TindakanPencegahan: Membuatformisianbuktipenyerahan nilai.

SosialisasiSAP Hanyaadasosialisilewatweb dan/atau(5.6)

MahasiswaPraktikanyang relatifsedikit Mahasiswapraktikanberdomisili dijogja Mahasiswapraktikanaktifdi kampus

Ketersediaanbahanpenunjang fasilitaspraktikum Bahanpenunjangfasilitas praktikum100%tersEdyatanpa diketahuiwaktunya(8.2.3)

Adanyakekurangtelitiandalam menyiapkankebutuhanbahan penunjangpraktikum

Pengecekandansettingalat praktikumdan/ataukomputer Pengecekandansettingalat praktikumdan/ataukomputer selesaitidakdiketahui waktunya.(8.2.4)

Adanyakekurangtelitian,tidak tertib,/disiplin,/cermatdalam menyimpandanmenyiapkan kebutuhankelengkapandokumen

10

11

PenyerahanNilaiAkhir Praktikumolehasisten 8.1Penyerahannilaiakhir praktikumolehasistentanpa tandabuktipenyerahan(8.3) Penyerahannilaipraktikumke Div.Akdpalinglambat1 minggusebelumyudisium 8.2Pengirimannilai praktikumkediv.akdtanpa tandabuktipenerimaan(8.3) MengukurkinerjaLab: 9.1modulperaktikumyang direviewolehtenagaahli agaruptodatedengan perkembanganilmudan relevancedgnduniakerja (8.3) 9.2laboratoriummenjadi pusatrisetdanstudiprogram (8.3) 9.3laboratoriummenjadirole modellab/benchmarking/ rujukandibidangnyamasing masing(8.3) EvaluasiPKmelaluirapatdan tindaklanjutevaluasiPK unitdan(bilaperlu)usulan perubahandanataupenambahan PKbaru. Tidakdilakukanpengukuran (8.2.4)

Ketidaktahuanterhadap pentingyabuktipenyerahan nilai,sehinggabukti penyerahannilaihilang

Laboratorumhanyasebagai laboratoriumpendukungmata kuliah Belumadarencanaprogram pengembanganlaboraoriumyang menujukepusatrisetdanrole model

TindakanPerbaikan: Dibuatprogrampengembangansecara bertahapmenujupusatrisetdan rolemodeldiprogramstudi. TindakanPencegahan: Mengawasipelaksanaanarahprogram pengembangandanberusahamemacu penapaiansesuaidengankapasitas yangada

Pemahamantentangevaluasi Programkerjayangmasih kurang.

TindakanPerbaikan: MengadakanrapatevaulasiPKdan tindaklanjutevaluasiPKunitdan (bilaperlu)usulanperubahandan ataupenambahanPKbarudengan notulenrapatyangdiotorisasi TindakanPencegahan: Memasukanrapatevaluasiprogram kerjakedalamprosedurkerja.

BPM-UII-YOGYAKARTA/2011

Halaman 136 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.MetrologiIndustri danInstrumentasi No. Deskripsi 12 Mengukurdanevaluasi kedisiplinankerja: 11.1Ketersediaanevaluasi kedisiplinankerjaberdasar tersEdyanyadaftarpengukuran kinerjastaf(6.2) 11.2Evaluasidantindak lanjuthasilevaluasi (reward,punishment)(7.1.3) 13 evaluasidantindaklanjut hasilevaluasiterhadap keluhanyangditerimadengan mengikutiPM(8.3) AnalisisPenyebab Belumtersedianyadokumen evaluasi RencanaTindakLanjut TindakanPerbaikan: Menyiapkandokumenevaluasisebelum praktikumdimulai TindakanPencegahan: Memasukanpembuatandokumen evaluasikedalamprosedurkerja

Belumtersedianyadokumen evaluasi

TindakanPerbaikan: Menyiapkandokumenevaluasisebelum praktikumdimulai TindakanPencegahan: Memasukanpembuatandokumen evaluasikedalamprosedurkerja

Tabel4.111.TemuanDeskriptifKinerjaPeriode2010UnitLab.CAD/CAM/CAEProdiT.Mesin TemuanLab.CAD/CAM/CAE AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMUbaru Belumdilakukanuploaddiweb TindakanPerbaikan: dilaksanakandenganrapatdan Perencanaanuploaddiwebsite ditempel,belumdiuploaddi web TindakanPencegahan Uploaddiwebsite SosisalisasiProgramKerja melaluirapatdanditempel Belumadasosialisasiprogram pengembangan Sosialisasijadwalpraktikum hanyaditempel SosialisasiSAPhanyadengan notulen 2 PencapaianSasaranMutu66,67 Ada2sasaranmutuyangbelum TindakanPerbaikan: % dicapai(tingkatkehadiran 1. Sosialisasiperaturanpraktikum praktikumdannilaikinerja kepraktikan asisten) 2. Dilakukanrefresing/pelatihan bagiasistenbaikmaterimaupun metodepengajaran 3 EvaluasiProgramKerjaUnit Belumdilakukanevaluasi TindakanPerbaikan: barudilakukandenganrapat Perencanaanevaluasi Evaluasiprogrampengembangan belumada TindakanPencegahan Belumadaevaluasiasisten Pelaksanaanevaluasi denganNKD<3,00 Belumadaevaluasidantindak lanjutbilakehadiran mahasiswa<95% Belumadaevaluasidantindak lanjutuntukmahasiswadengan nilaipraktikum<C Belumadaevaluasibila jumlahmahasiswamengulang praktikum>10% Belumadaevaluasiatau tindaklanjutuntukasisten denganNKA<3,00 Belumdilakukanevaluasidan tindaklanjutusulan perubahanPK Belumadaevaluasidantindak lanjutterhadapkeluhan 4 Programkerjapengembangan Programkerjapengembangan30% TindakanPerbaikan: 30%mendukungSMU Penambahanprogramkerja mendukungSMU pengembangan 5 Pengecekandansetting Belumadabuktipengecekan TindakanPerbaikan: komputerwaktunyatidak komputer Rencanapembuatanbuktipengecekan

BPM-UII-YOGYAKARTA/2011

Halaman 137 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanLab.CAD/CAM/CAE Deskripsi diketahui AnalisisPenyebab RencanaTindakLanjut komputer TindakanPencegahan: Pembuatanbuktipengecekankomputer TindakanPerbaikan: Perencanaansosialisasiperaturan Praktikum TindakanPencegahan: SosialisasiperaturanPraktikum TindakanPerbaikan: Rencanapembuatanbuktipenerimaan TindakanPencegahan: Pembuatanbuktipenerimaan TindakanPerbaikan: Dilakukanpelatihanuntukasisten TindakanPerbaikan: Rencanapembuatanbuktireview TindakanPencegahan: Pembuatanbukti/keteranganbahwa modultelahdireview TindakanPerbaikan: Perencanaandokumentasijumlah mahasiswayangmengerjakanTAdi Lab. TindakanPerbaikan: PeningkatankapasitasLab TindakanPerbaikan: Dokumenakandiarsipsesuaidengan DCP

Kehadiranmahasiswapraktikum 66,26% Tingkatkehadiranmahasiswa responsi67,86% Jumlahmahasiswamengulang praktikum20,29% Belumadabuktipenyerahan nilaiakhirpraktikumoleh asisten

Mahasiswakurangmemahami peraturanpraktikum

Belumadabuktipenerimaan

8 9

JumlahasistendenganNKA> 3,00=66,67% Tidakadabuktibahwamodul telahdireviewolehtenaga ahli

Penguasaanmaterikurang Tidakadabuktibahwamodul telahdireviewolehtenagaahli

10

11

12

13

Laboratoriumdigunakan sebagaitempatmahasiswa melakukanTA,belummenjadi pusatrisetdiprogramstudi Laboratoriumbelummenjadi rolemodellabdibidang masingmasing Barusebagiandokumenyang dikelolapengarsipannya sesuaiDCM Belumadaevaluasidisiplin kerja Belumadaevaluasihasil evaluasi(rewarddan punishment)

Belumterdapatdokumentasi mahasiswayangmengerjakanTA diLab Belumadakunjungankelab

Dokumensebagianberadadi prodi Tidakmempunyaistafatau laboran

Tabel4.112.TemuanDeskriptifKinerjaPeriode2010UnitLab.P.ProduksiProdiT.Mesin TemuanLab.P.Produksi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisaiSMUbelumditempel Stafkhususyangmempersiapkan Tindakanperbaikan: dandipublikasikanlewatWEB dokumenmasihbaru MengadakanPelatihandanpenyuluhan kepadastafbaru TindakanPencegahan: SosialisasidanKoordinasi 2 PencapaianSMU50% Stafkhususyangmempersiapkan Tindakanperbaika: ketercapaiansasaran74.9% dokumenmasihbaru MengadakanPelatihandanpenyuluhan kepadastafbaru TindakanPencegahan: SosialisasidanKoordinasi 3 Sosialisasiprogramkerja Stafkhususyangmempersiapkan Tindakanperbaikan: belumditempeldandi MengadakanPelatihandanpenyuluhan dokumenmasihbaru publikasikanlewatWEB kepadastafbaru TindakanPencegahan: SosialisasidanKoordinasi 4 Programkerjabelumdi Programkerjabelumdi Tindakanperbaikan: evaluasi sosialisasi Melakukanevaluasisecaraberkala Stafkhususbelumtersedia danrutin Melakukanperekrutanstaf TindakanPencegahan:

BPM-UII-YOGYAKARTA/2011

Halaman 138 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. 5 TemuanLab.P.Produksi Deskripsi Evaluasiprogrampengembangan belumdilakukan AnalisisPenyebab Stafkhususyangmempersiapkan dokumenmasihbaru RencanaTindakLanjut SosialisasidanKoordinasi Tindakanperbaikan: Melakukanevaluasisecaraberkala danrutin Melakukanperekrutanstaf TindakanPencegahan: SosialisasidanKoordinasi Tindakanperbaikan: Melakukanpelatihanterhadapstaf dalammemepersiapkandokumenSAPdi tempeldandipublikasilewatWEB TindakanPencegahan: SosialisasidanKoordinasi Tindakanperbaikan: Melakukanpenyuluhandan sosialisasi Meningkatkanmotivasimahasiswa melaluipenyuluhan TindakanPencegahan: Koordinasi Tindakanperbaikan: Menambahjumlahperalatan Melakukanberbagaipelatihadan trainingterhadapSDM TindakanPencegahan: SosialisasidanKoordinasi TindakanPerbaikan: Menambahjumlahperalatan Melakukanberbagaipelatihadan trainingterhadapSDM TindakanPencegahan: SosialisasidanKoordinasi TindakanPerbaikan: Melakukanrapatkoordinasiuntuk evaluasiPK TindakanPencegahan: SosialisasidanKoordinasi TindakanPerbaikan: Melakukanrapatrutindan sosialisasi TindakanPencegahan: Koordinasi TindakanPerbaikan: Melakukanrapatrutindan sosialisasi TindakanPencegahan: SosialisasidanKoordinasi TindakanPerbaikan: Membuatformisiankeluhan pelanggan Rapatkoordinasi TindakanPencegahan: SosialisasidanKoordinasi TindakanPerbaikan: Membuatformisiankeluhan pelanggan TindakanPencegahan: SosialisasidanKoordinasi

SosialisaiSAPbelumditempel dandipublikasikanlewatWEB

Stafkhususyangmempersiapkan dokumenmasihbaru

Mencariakarmasalahuntuk nilaimahasiswaCbelum dilakukan

Aktifitasmahasiswatak terprediksi Banyakmahasiswayanginhal Standarnilaiyangterlalu tinggi

Laboratoriumbelummenjadi pusatrisetdeprogramstudi

Peralatanyangkurangmendukung kemampuanSDMyangkurang memadai

Laboratoriumbelummenjadi rolebenchmarkingprodi

Peralatanyangkurangmendukung kemampuanSDMyangkurang memadai

10

BelummelakukanevaluasiPK

EvaluasiPKbelumterjadwal

11

SosialisasiDCMbelumoptimal

Minimnyarealisasidan koordinasi Stafkhususyangmempersiapkan dokumenmasihbaru

12

PengelolaanDCMbelumsesuai

Stafkhususyangmempersiapkan dokumenmasihbaru

13

Dokumenpengendaliankeluhan pelangganbelumtersedia

Stafkhususyangmempersiapkan dokumendanformmasihbaru

14

Evaluasidokumenpengendalian keluhanpelangganbelum tersedia

Formkeluhanbelumtersedia sehinggatidakdapatdilakukan pengukuran

BPM-UII-YOGYAKARTA/2011

Halaman 139 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.113.TemuanDeskriptifKinerjaPeriode2010UnitLab.KonversiEnergiProdiT.Mesin TemuanLab.KonversiEnergi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 KesesuaianSMUdenganlingkupkerja(2) WTke'f'belumadaSMU 2 SosialisasiSMUyangefektif(4) SosialisaibarudilakukanpadasaatKoordinasi padaawalpraktikumdenganasisten 3 Pencapaiansasarandidukungolehdokumenyang sudahdiotorisasi(5) NilaiB;38% 4 EvaluasidantindaklanjutSMUsertakendaladan peluangyangada(6) Belumadaanalisistentangakarmasalah 5 SosialisasiProgramKerjayangefektif(8) BelumdisosialisasikanlewatWEB 6 EvaluasiProgramKerjaRutinunit,kendaladan peluangyangadasertatindaklanjutprogram(11) Notulenmasihditulispadbukucatatankhusus hasilrapat 7 KetersediaanProgrampengembangandalamrangka mendukungSMUyangdidukungolehdokumen terotorisasi(12) BaruadaProgrampengembanganmodul 8 SosialisasiProgramPengembanganyangefektif (13) BelumlewatWeb 9 PelaksanaanprogramPengembanganyangdidukung olehdokumenterotorisasi(14) Programtidakberjalankarenaketerbatasan anggarandanakandiprogramkanlagipadatahun ini 10 Evaluasiprogrampengembangan,kendaladan peluangyangadasertatindaklanjutprogram(15) Belumadaanalisistentangakarmasalah 11 Kesesuaiankompetensiasistenpraktikum(18) NilaiIPKbelum memenuhi;Jumlah peminatkurang 12 Sosialisasijadwalpraktikum(20) BelumLewatWEB 13 SosialisasiSAP(22) Ditempelpadapresensi,belumlewatWEB 14 TingkatKehadiranMahasiswaPraktikum=persentase rataratajumlahmahasiswahadirperperiode= (persentasekehadiranmahasiswasetiapperiode)/ jumlahperiode*100%(28) Belummencapai100% 15 EvaluasidantindaklanjutbiladenganTingkat KehadiranMahasiswaPraktikum95%(29) Belumadapenjelasanakarasalah 16 JumlahMahasiswayangNilaipratikum/pelatihan C(34) 21%JumlahMahasiswayangNilaiPraktikumCper periode30% 17 EvaluasidantindaklanjutbilaJumlahMahasiswa yangNilaipraktikum/pelatihanC(35) Belumadarencanatindaklanjut 18 EvaluasidantindaklanjutbilajumlahMahasiswa yangmengulangPraktikumlebih10%perMata Praktikum(37) Jumlahmahasiswamengulangkurangdari10%, sehinggatidakdilakukanevaluasikhusus 19 PengirimanNilaiPraktikumkeDiv.Akdpaling lambat1minggusebelumyudisium(39) Laboratoriummenggunkanakriteriapenerimaan7 harisebelumyudisium 20 Evaluasidantindaklanjutuntukasistenataudosen

BPM-UII-YOGYAKARTA/2011

Halaman 140 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No. TemuanLab.KonversiEnergi Deskripsi pengampupraktikumdenganNilaiKinerjaAsisten (NKA)3.00(41) NKA>=3,sehinggatidakdilakukanpengukuran KesesuaianSAPdenganMateriPraktikumdalammodul praktikum(42) Adapergantianalatdanharusgantisilabi Pelaporanpenggunaananggaran(43) PelaporanpenggunaananggaranLabdiotorisasi tidaktepatwaktu LaboratoriummenjadiPusatRisetdiProgramStudi (45) Saatinibarusuportuntukperkuliahan Laboratoriummenjadirolemodellab/ benchmarking/rujukandibidangnyamasingmasing (46) Belumadakunjungan KetersediaanPKuntukLab(47) JumlahPKyangtersedia75%sesuaidengan lingkup/proseskerja100% EvaluasiPKmelaluirapatdantindaklanjut evaluasiPKunitdan(bilaperlu)usulanperubahan danataupenambahanPKbaru.(49) Metodepengelolaandokumen(carapengarsipandan penyimpanan)sesuaidenganDCM(52) 75%PengelolaandokumensesuaiDCM99,9% Ketersediaanevaluasikedisiplinankerjaberdasar Tersedianyadaftarpengukurankinerjastaf(54) TidakadaStaff Evaluasidantindaklanjuthasilevaluasi(reward, punishment)(55) Tidakadastaff Ketersediaandokumenpengendaliankeluhan pelanggandansesuaiProsedurMutu(PM)(56) Tidaktersediadokumenpengendaliankeluhan pelanggan Evaluasidantindaklanjuthasilevaluasi terhadapkeluhanyangditerimadenganmengikutiPM (57) Tidaktersediadokumenevaluasi. AnalisisPenyebab RencanaTindakLanjut

21

22

23

24

25

26

27

28

29

30

31

7. FakultasTeknikSipildanPerencanaan. 7.1. UnitKorlabFTSP Hasil kinerja Unit Korlab FTSP secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.114, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasing lab bisa dilihat padatable4.115dan4.116.
Tabel4.114.HasilCapaianKinerjaPeriode2010UnitKorlabProdidiFTSP IndeksKinerjaKorlab No IndikatorKinerja Arsitektur T.Sipil T.Lingkungan Pencapaianprogram/rencanakerjapengembangan 1 4.00 3.00 laboratorium KemampuanKepemimpinanoperasionaldalamhalproses 2 4.00 3.67 koordinasiinternalunitdantindaklanjutRTM 3 4 5 6 7 Prosespenyediaanfasilitaspraktikum Mengukurprosespenggunaandanalab PenerapanProsedurKerja(PK) Tingkatpemahaman,realisasidanevaluasiDCM ProsespengendaliandanevaluasiKeluhanPelanggan 4.00 4.00 4.00 4.00 3.00 3.86 4.00 4.00 4.00 3.00 2.50 3.45 Tidakada korlab

IndeksKinerja

BPM-UII-YOGYAKARTA/2011

Halaman 141 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.115.TemuanDeskriptifKinerjaPeriode2010UnitKorlabT.Arsitektur TemuanKorlabT.Arsitektur AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Ketersediaandokumen Belum ada keseragaman Tindakanperbaikan: pengendaliankeluhan Perluadanyakeseragaman antarlaboratorium pelanggandansesuaidengan antarlabdidalam prosedurmututetapibaru mengendalikankeluhan diterapkansebagian pelanggan Tindakanpencegahan: Managemenpengelolalabyang baikagarkeluhanpelanggan menurun/tidakadakeluhan 2 Evaluasidantindaklanjut PM dengan evaluasi yang Tindakanperbaikan: terhadapkeluhansudahada sudah berjalan yang Perlupenyempurnaansystem tetapitidaksesuaiPM berkaitan dengan keluhan evaluasiatauPMnya belumsesuai disempurnakanagarada kesesuaian Tindakanpencegahan: Pelayananlabyangbaikagar keluhanmenurun/tidakada Tabel4.116.TemuanDeskriptifKinerjaPeriode2010UnitKorlabT.Sipil TemuanKorlabT.Sipil AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 Sosialisasiprogrampengembanganhanya melaluirapat 2 Adaevaluasiprogrampengembangan,namun belummenentukanakarmasalahnya 3 Adarapatkoordinasi,namuntidak terdokumenkandenganbaik 4 44%terkeloladenganbaik 5 Formpengendaliankeluhanevaluasibelum sesuaidenganPM

7.2. UnitLaboratoriumProdiTeknikArsitektur
Hasil kinerja Unit Laboratorium Prodi Teknik Arsitektur secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.117, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untuk masingmasinglabbisadlihatpadatable4.1184.120.
Tabel4.117.HasilCapaianKinerjaPeriode2010UnitLaboratoriumProdiT.Arsitektur IndeksKinerja No IndikatorKinerja 1 2 3 4 5 6 7 8 9 10 11 12 PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPelatihan/Praktikumpendukungmatakuliah PelaksanaanPraktikum/pelatihan ResponsiPraktikum/pelatihan EvaluasiPraktikum/pelatihan KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan Arsitektur Digital 3.67 3.25 3.25 3.82 3.75 3.75 3.57 3.00 3.33 4.00 4.00 3.50 3.57 Perancangan Arsitektur 3.50 3.25 3.00 3.82 3.75 4.00 3.43 2.00 3.33 4.00 4.00 3.50 3.47 Teknologi Bangunan 3.33 3.50 3.25 3.82 3.75 4.00 3.43 3.00 4.00 4.00 4.00 3.50 3.63

IndeksKinerja

BPM-UII-YOGYAKARTA/2011

Halaman 142 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.118.TemuanDeskriptifKinerjaPeriode2010UnitLab.ArsitekturDigitalProdiT.Arsitektur TemuanLab.ArsitekturDigital No. Deskripsi SosialisasiSMU,program kerja,programpengembangan, jadwalbelummelaluiweb 1 AnalisisPenyebab Belummenjadikepentingan sehinggatidakterpantau& terencanakan RencanaTindakLanjut

Ketersediaanjadwal11hari sebelumpraktikum,direncanakan 14harisebelumpraktikum

Kehadiranpraktikummahasiswa 75%

Nilaipraktikum<C41%

Pengirimannilaipraktikum10 harisetelahberakhir

KenaikanKunjunganLab<9% daritahunsebelumnya

EvaluasitidaksesuaidenganPM

TindakanPerbaikan: Membuatwebsiteyangdilink denganarchitecture.uii.ac.id Mengirimkanprogramkerja/ pengembangandanJadualkeBSI UII TindakanPencegahan: Diajukandalamrapatrutin mingguanataupunbulanan SAPdaripengampukuliah TindakanPerbaikan: terlambatdatangnya Mengurangibataswaktu pengumumansehingga7hari sebelumpraktikum TindakanPencegahan: Melayangkansuratkepada pengampumatakuliahlebihawal2 Praktikumtidakbersifat TindakanPerbaikan: independensehinggamahasiswa Membuatusulankejurusanuntuk bisalulusMatakuliahtanpa sistempraktikumyangindependen kelulusanpraktikum TindakanPencegahan: KoordinasiLabKoorlabMata kuliah Kehadiranmahasiswayangkurang TindakanPerbaikan: aktif,sehinggapenguasaan Membuatusulankepadajurusan materimenjadikurang untukpenangananpraktikum TindakanPencegahan: KoordinasiLabKorlab MatakuliahdanJurusanlebih awal Koreksihasilpraktikumdigital TindakanPerbaikan: minimal7harisehinggadengan Mengirimkanusulanperubahan standar3hariadalahtidak bataswaktuminimalBFSM memungkinkan TindakanPencegahan: Dilakukankoordinasi Perbedaanpersepsitentang TindakanPerbaikan: pengunjunglab Meluruskanpresepsitentang pengunjunglab Menyiapkanperlengkapan perlengkapanyangmenunjang TindakanPencegahan: Menyiapkanbukutamudan perlengkapanyangmenyertainya Belumjelas KonsultasikepadaPSMF

BPM-UII-YOGYAKARTA/2011

Halaman 143 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

Tabel4.119.TemuanDeskriptifKinerjaPeriode2010UnitLab.PerancanganArsitekturProdiT.Arsitektur TemuanLab.PerancanganArsitektur AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMU,program SosialisasiSMUdirasadan TindakanPerbaikan: kerja,programpengembangan, dipahamicukupmelaluirapat AkandilakukansosialisasiSMU, jadwalbelummelaluiweb rapatdanditempeltanpaada ProgramKerja,Program keharusanmelaluiweb Pengembangan,jadwalmelaluiweb yangadapadajurusanArsitektur FTSPUII TindakanPencegahan: Diadakanrapatuntuk mempersiapkankonteswebdandi uploadmelaluiwebyangadapada JurusanArsitekturFTSPUII 2 KetercapaianSMU80,6%(sasaran Sasaranmutuke3kurangdari TindakanPerbaikan: mutuke3danke5belum 80%karenaadamahasiswanon Rapatakandiusulkanuntuk tercapai) aktif(presensi0%)dimasukan mahasiswanonaktifdihapuskan dalamperhitunganratarata. daripresensiratarata Sasaranmutuke5kurangdari Sederhanakandankurangiprogram 80%karenaprogram kerjapengembangandisesuaikan pengembanganterlalubanyak dengankemampuandanSDM sehinggatidaksemuaprogram bisadijalankan TindakanPencegahan: Dilakukanrapatuntuk mengevaluasiprogramkerjaagar dapatdilakukantindaklanjutnya 3 Ketercapaianprogramkerja70% ProgramKerjaterlalubanyak TindakanPerbaikan: Dilakukanrapatuntukevaluasi programkerjadanditentukan tindaklanjutnya TindakanPencegahan: Setelahmelakukanpengukuran ketercapaianprogramkerja, dilakukanrapatuntukevaluasi programkerjadanditentukan tindaklanjutnya 4 Ketersediaanjadwal12hari Jadualpraktikumtergantung TindakanPerbaikan: sebelumpraktikum,direncanakan dariSAPmatakuliahyang Diadakanrapatdandiusulkan 14harisebelumpraktikum kadangkadangbarutersedia14 untukSAPmatakuliahminimal21 harisebelumkuliahberlangsung harisebelumpelaksanaankuliah danpraktikum TindakanPencegahan: Diadakanrapatdandiusulkan untukSAPmatakuliahminimal21 harisebelumpelaksanaankuliah dansegeradisusunjadwal praktikumsetelahadaSAPmata kuliah. 5 Kehadiranasisten90% Adaasistenyangtidakhadir TindakanPerbaikan: karenasakitdanadayang Jikaasistentidakhadirharus bersamaandengankegiatan menggantikandenganwaktuyang kuliahasisten lainsesuaidengankesepakatan TindakanPencegahan: Diadakanrapatuntukmenentukan tindaklanjut 6 Kehadiranpraktikummahasiswa Adamahasiswanonaktif TindakanPerbaikan: 61% (kehadiran0%)hanyakeyin Diadakanrapatuntukmeniadakan tanpaikutkuliahmaupun mahasiswanonaktifdalam praktikumakantetapidimasukan perhitunganrataratakehadiran dalamperhitunganratarata praktikummahasiswa kehadiranpraktikummahasiswa TindakanPencegahan: Setwelahdilakukanperhitungan kehadiranpraktikummahasiswa

BPM-UII-YOGYAKARTA/2011

Halaman 144 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.PerancanganArsitektur No. Deskripsi AnalisisPenyebab RencanaTindakLanjut laludicermatimahasiswa mahasiswanonaktifuntuktidak dimasukandalamperhitungan. Adanilaipraktikummahasiswa TindakanPerbaikan: nonaktif(F)yangdimasukan Rapatdanhapuskannilai dalamperhitungannialai mahasiswanonaktif dibawahC TindakanPencegahan: Diadakanrapatuntukmenentukan tindaklanjut Pengirimannilaidilakukan TindakanPerbaikan: secaralangsungdariasistenke Pengirimannilaimelaluikepala dosendalamacararapat laboratoriumsetelahnilai evaluasidanpenyerahannilai dikumpulkandariasistendan bagianekspedisilaboratorium menyerahkannilaikepadadosen dengandisertaibuktidan tanggalpenerimaan TindakanPencegahan: Dilakukanrapatuntukmenentukan tindaklanjut Adaduabuahmodulyang TindakanPerbaikan: seharusnyadireview,namun Dilakukanrapatuntukmenentukan hanyasatumodulyangdireview tindaklanjut karenamodulyanglaintetap samasepertisemester TindakanPencegahan: Diadakanrapatuntukmenentukan sebelumnya tindaklanjut Kunjunganmahasiswake TindakanPerbaikan: laboratoriumsesuaidengan Diadakanrapatuntukmenentukan jadualkegiatanpraktikumyang tindaklanjut relativesamauntuksetiap semesternya.Kunjunganuntuk TindakanPencegahan: Setelahdilakukanrapat keperluanlainsepertidown dilakukantindaklanjutnya loadmaterikuliahatau tindaklanjut ngeprintrelativestabil Belummemahamisistemevaluasi TindakanPerbaikan: yangsesuaidenganPM Mempelajaridanmemahamisistem evaluasiyangsesuaidenganPM TindakanPencegahan: Diadakanrapatuntukmenentukan tindaklanjut

Nilaipraktikum<C24%

PengirimanNilaitanpaada buktitanggalpenerimaan

Reviewmodulolehtenagaahli 50%

10

KenaikanKunjunganLab<9% daritahunsebelumnya

11

EvaluasitidaksesuaidenganPM

Tabel4.120.TemuanDeskriptifKinerjaPeriode2010UnitLab.TeknologiBangunanProdiT.Arsitektur TemuanLab.TeknologiBangunan No. Deskripsi 1 SosialisasiSMU,program kerja,programpengembangan, jadwalbelummelaluiweb AnalisisPenyebab Belummengetahuijika sosialisasiharusmelaluiweb RencanaTindakLanjut

KetercapaianSMU66,6%(sasaran mutuke3danke5belum tercapai)

TindakanPerbaikan: Segeramemunggahsosialisasi SMU,ProgramKerjadanProgram PengembangandanJadwalkeWeb TindakanPencegahan: Memasukkansosialisasikeweb sebagaikegiatanrutinterjadwal Praktikummelekatdalammata TindakanPerbaikan: kuliahdenganbobotnilaiyang RapatkoordinasidenganKorLab tidaksignifikanmenentukan danJurusanuntukevaluasiperan kelulusanmatakuliah,sehingga danbobotpraktikumpadamata membuatanimomahasiswadating kuliah,manajemencontrol rendah,yangmengakibatkan terhadappelaksanaanpraktikum nilaipraktikumrendah danpenilaianakhirmatakuliah, danbilaperlumeninjauulang sasaranmutulab

BPM-UII-YOGYAKARTA/2011

Halaman 145 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.TeknologiBangunan No. Deskripsi AnalisisPenyebab RencanaTindakLanjut TindakanPencegahan: Melakukankoordinasidengan dosenpengampumatakuliahuntuk peningkatanperandosendalam pemantauankehadiranpraktikum danpemberlakukansangsisangsi ketidakhadiranpraktikum TindakanPerbaikan: Meninjauulangrancanganmodel peraga Jadwalulanguntukpelatihan konstruksipadaprogramsemester depan TindakanPencegahan: Cekkesiapanpersonaldan teknologisebelummerencanakan programpenambahanalatperaga Programpelatihantidakperlu mengikutiprogramkaryanyata TindakanPerbaikan: Rapatkoordinasidengankorlab danJurusanuntukevaluasiperan danbobotpraktikumpadamata kuliah,manajemencontrol terhadappelaksanaanpraktikum TindakanPencegahan: Melakukankoordinasidengan dosenpengampumatakuliahuntuk peningkatanperandosendalam pemantauankehadiranpraktikum danpemberlakuansangsisangsi ketidakhadiranpraktikum TindakanPerbaikan: KalibrasibatasnilaiCmelalui rapatkoordinasidenganjurusan. Diperlukanketentuanrangenilai praktikumyangseragamuntuk seluruhLabdiUII TindakanPencegahan: Melakukankoordinasidengan dosenpengampumatakuliahuntuk peningkatanperandosendalam pemantauankehadiranpraktikum danpemberlakuansangsisangsi ketidakhadiranpraktikum TindakanPerbaikan: Bilamungkincriteriaaudit menyesuaikankarakterpraktikum untukmasingmasingLab,paling tidak7harisetelahpraktikum, yangpentingnilaipraktikum tidakterlambatdiserahkanke dosenpengampuuntukpenentuan nilaiakhirmatakuliah(catatan :nilaipraktikumlabTB Arsitekturtidakberdiri sendiri,tetapimenentukannilai akhirmatakuliahyang dipraktikumkan) TindakanPencegahan: Mengingatkanasistenuntuk mengumpulkannilaitepatwaktu danmemberikansangsijika terlambatmengumpulkannilai.

Ketercapaianprogramkerja pengembangan80%

Programpenambahanalatperaga (matakuliahutilitas)belum terlaksana,karenakesulitan teknologipembuatanmodel Programpelatihankonstruksi karenaperubahantemakarya nyata(pengabdianmasyarakat) menyesuaikandengankondisi bencanamerapi

Kehadiranpraktikummahasiswa 71%

Praktikummelekatdalammata kuliahdenganbobotnilaiyang tidaksignifikanmenentukan kelulusanmatakuliah,sehingga membuatanimomahasiswadating rendah

Nilaipraktikum<C53%

Belumadaketentuanbakurange nilaipraktikumyangberlaku untukseluruhLabUII,sehingga ketentuanBatasnilaiCdiLab TBadalah>65,yang kemungkinanterlalutinggiatau Bobotnilaiyangtidak signifikandantidakmenentukan kelulusanmatakuliah,sehingga membuatanimomahasiswadating rendah,yangmengakibatkan nilaipraktikumrendah. KarakterpraktikumdiLab ArsitekturMemerlukanwaktu prosessingnilailebihdari3 hari

PengirimanNilai2minggu setelahpraktikumselesai (standard3hari)

BPM-UII-YOGYAKARTA/2011

Halaman 146 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.TeknologiBangunan No. Deskripsi 7 KenaikanKunjunganLab<9% daritahunsebelumnya AnalisisPenyebab Kunjunganbelumterdatadengan baik,sehinggatidaksemua kunjungantercatat Labbelumbiassebagairole modeluntukLabRiset,dan promosikeluarbelumdilakukan RencanaTindakLanjut TindakanPerbaikan: PendataanLengkapsetiap kunjunganLab MelakukankegiatanpromosiLab TBkeluar TindakanPencegahan: Pendataanlengkapsetiap kunjunganLab MelakukankegiatanpromosiLab TBkeluar Belummendapatkanform TindakanPerbaikan: pengendaliaankeluhansesuaiPM MemintaFormPengendalian KeluhansesuaiPM MemperbaikiFormPengendaliaan KeluhansesuaidenganPM TindakanPencegahan: MenyiapkanFormdanmelakukan pengendaliaankeluhansesuai denganPM

EvaluasitidaksesuaidenganPM

7.3. UnitLaboratoriumProdiTeknikLingkungan Hasil kinerja Unit Laboratorium Prodi Teknik Lingkungan secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.121, sementara untuk hasil temuan secara deskriptif, analisis penyebab dan rencana tindak lanjut untukmasingmasinglabbisadlihatpadatable4.122.
Tabel4.121.HasilCapaianKinerjaPeriode2010UnitLab.KualitasLingkunganProdi.T.Lingkungan No 1 2 3 4 5 6 7 8 9 10 11 12 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDaftarCatatanMutu(DCM) EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan IndeksKinerja 3.00 3.25 3.25 3.40 3.75 4.00 2.70 3.67 4.00 3.75 4.00 4.00 3.56

IndeksKinerja

Tabel4.122.TemuanDeskriptifKinerjaPeriode2010UnitLab.KualitasLingkungan. No 1 TemuanLabKualitas Lingkungan ParameterSMUyang diukur66% AnalisisPenyebab Belumdimasukannyasalahsatu parameterSMUdalampengukuran RencanaTindakLanjut TindakanPerbaikan: Akandilakukanpengukuranterhadap parametertersebut TindakanPencegahan: SemuaparameterSMUsecara periodikakandilakukanpengukuran TindakanPerbaikan: Akandilakukanpengukuranterhadap parametertersebut TindakanPencegahan: SemuaparameterSMUsecara periodikakandilakukanpengukuran

KetercapaianSMU66%

Belumdimasukannyasalahsatu parameterSMUdalamperhitungan

BPM-UII-YOGYAKARTA/2011

Halaman 147 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No 3 TemuanLabKualitas Lingkungan SosialisasiSMU,program kerjabelumdiwebsite AnalisisPenyebab Laboratoriumbelummengetahui ketentuanuntuksosialisasiSMU danprogramkerjadiwebsite RencanaTindakLanjut TindakanPerbaikan: AkanmelaksanakansosialisasiSMU danprogramkerjadalamwebsite TindakanPencegahan: SMUdanProgramKerjasecara periodikdisosialisasikandi website TindakanPerbaikan: Memasukanprogramkerjakalibrasi alatpadaperiodeselanjutnya dimanaterdapatperalatanyang harusdikalibrasi TindakanPencegahan: Padasaatmenyusunprogramkerja, harusdilengkapidenganlaporan kondisisaranadanprasaranalab. TindakanPerbaikan: Mengusulkankembaliprogram tersebutdalamperiodeselanjutnya TindakanPencegahan: Mendiskusikankembaliprogram reorganisasiiniditingkatyang lebihtinggiyaitujurusandan fakultas TindakanPerbaikan: Melakukanrekruitmenasistenjauh lebihawal TindakanPencegahan: Padarapatpersiapanpraktikum dijadwalkanrekruitmenasisten dilakukanlebihawal TindakanPerbaikan: Jadwalpraktikumdisediakansesuai rencanamutu TindakanPencegahan: Melakukanpengecekanpersiapan praktikumsesuairencanamutu TindakanPerbaikan: Masukanmateripraktikumdalam daftarhadir TindakanPencegahan: Dilakukanpengecekanterhadap daftarhadirsebelumdimulainya kegiatanpraktikum TindakanPerbaikan: Melakukanevaluasiterhadap mahasiswayangtidakhadir praktikum TindakanPencegahan: Melakukanpemeriksaanterhadap kehadiranmahasiswapadasetiap sesipraktikum TindakanPerbaikan: Melakukanevaluasiterhadap keaktifanmahasiswapraktikum TindakanPencegahan: Memberikanpenjelasankepada mahasiswapadasaatbriefing praktikumtentangsistempenilaian darikegiatanpraktikum

Ketercapaianprogram kerjarutin80%

Salahsatuprogramkerja kalibrasiperalatantidakdapat dilakukandikarenakanbelumada peralatanlabyangmasa kalibrasinyahabis

Ketercapaianprogram kerjarutin75%

Salahsatuprogramyaitu reorganisasilabbelum terlaksanasepenuhnya dikarenakanmasihsulitnya sinkronisasistrukturLab sesuaiISO17025dengansistem diUII

Ketersediaanasisten<7 hari

Waktuseleksiyangagaklama menyebabkanpengumumanasisten menjadiagaklambat

Ketersediaanjadwal belumtepatwaktu

Laboratoriumbelum mengendalikanjadwal pelaksanaanpraktikum

Materipraktikumdi daftarhadirbelumada

Laboratoriumbelummemahami carapembuatandaftarhadir yangbaik

Kehadiranmahasiswa< 100%

Beberapamahasiswatidak mengikutiseluruhkegiatan praktikum

10

Nilai<C=28%

Mahasiswayangmendapatkan nilai<Cdisebabkantidak mengikutipretestdantidak mengumpulkanlaporan

BPM-UII-YOGYAKARTA/2011

Halaman 148 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

No 11 TemuanLabKualitas Lingkungan Notulenpembahasannilai tidakada,tapisudah dilaksanakan AnalisisPenyebab Pembahasannilaisudah dilaksanakantapibelumditulis RencanaTindakLanjut TindakanPerbaikan: Menulispembahasannilaipada notulenrapat TindakanPencegahan: HasilPembahasanRapatselalu ditulisdalamnotulenrapat Mekanismepenyerahannilai TindakanPerbaikan: Mengusulkankepadajurusanuntuk belumada menetapkanmekanismepenyerahan nilai TindakanPencegahan: Setiapnilaipraktikumyang diserahkankebagianakademik harusdilaporkankelaboratorium Belummembuatsistempengukuran TindakanPerbaikan: NKA Membuatkuisioneruntukpenilaian NKA TindakanPencegahan: Setiapselesaipraktikumharus dilakukanpengukuranNKA Mahasiswayangmelakukan TindakanPerbaikan: penelitiandilaboratorium Meningkatkanjumlahmahasiswayang berfluktuasisetiapsemesternya melakukanpenelitiandi laboratoriumdenganmembuatdesain grandpenelitian TindakanPencegahan: Mempromosikanfasilitaslabuntuk kegiatanpenelitiankepada mahasiswadandosen DCMbelumdiusulkankeBPM TindakanPerbaikan: MengusulkanDCMkeBPM TindakanPencegahan: Semuadokumensistemmutudicek dandilakukanotorisasi

12

Labtidakmengetahui tidaktahuPenyerahan Nilaiolehdosenke Bagianakademik

13

NKAbelumdiukurdan tidakdievaluasi

14

Kenaikanuntukriset 12,5%

15

DCMbelumdiotorisasi olehBPMbaruolehunit


BPM-UII-YOGYAKARTA/2011 Halaman 149 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

7.4. UnitLaboratoriumProdiTeknikSipildanPerencanaan Hasil kinerja Unit Laboratorium Prodi Teknik Sipil dan Perencanaan secara kuantitatif dalam bentuk indeks kinerja bisa dilihat pada table 4.123, sementara untukhasiltemuansecaradeskriptif,analisispenyebabdanrencanatindaklanjut untukmasingmasinglabbisadlihatpadatable4.1244.131
Tabel4.123.HasilCapaianKinerjaPeriode2010UnitLab.ProdiT.Sipil IndeksKinerjaLaboratorium No 1 2 3 4 5 6 7 8 9 10 11 12 IndikatorKinerja PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDCM EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan IndikatorKinerja No 1 2 3 4 5 6 7 8 9 10 11 12 PencapaianSasaranMutuUnit(SMU) Pencapaianprogramkerjarutin Pencapaianprogramkerjapengembangan PersiapanPraktikum PelaksanaanPraktikum ResponsiPraktikum EvaluasiPraktikum KinerjaLab PenerapanProsedurKerjauntukLab Pemahaman,realisasidanevaluasiDCM EvaluasiKedisiplinanKerja PengendaliandanevaluasiKeluhanPelanggan Tabel4.123.HasilCapaianKinerjaPeriode2010UnitLab.ProdiT.Sipil(Lanjutan) IndeksKinerjaLaboratorium Komputasi 3.50 3.50 3.50 3.70 4.00 4.00 3.78 4.00 4.00 4.00 4.00 2.00 3.66 Mekanika Rekayasa 3.17 3.50 3.25 3.50 4.00 4.00 4.00 3.00 3.55 Mekanika Tanah 3.33 3.50 3.00 4.00 4.00 4.00 4.00 4.00 4.00 3.75 4.00 4.00 3.80 Rekayasa Transportasi 3.17 0.00 0.00 3.80 3.75 3.75 3.90 4.00 4.00 4.00 4.00 4.00 3.20 Bahan Konstruksi Teknik 2.00 3.00 3.25 3.27 4.00 4.00 3.89 4.00 4.00 4.00 4.00 4.00 3.62 Hidrolika 3.17 3.50 3.33 3.80 3.75 3.75 3.90 4.00 4.00 4.00 4.00 4.00 3.77 IlmuUkur Tanah 3.33 4.00 3.25 3.80 4.00 4.00 4.00 4.00 3.33 4.00 4.00 4.00 4.00 Jalan Raya 3.17 3.50 3.33 3.80 3.75 3.75 3.90 4.00 4.00 4.00 4.00 4.00 3.77

IndeksKinerja

IndeksKinerja

Tabel4.124.TemuanDeskriptifKinerjaPeriode2010UnitLab.BahanKonstruksiTeknikProdi.T.Sipil TemuanLab.BahanKonstruksiTeknik AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukurnamunkurang sesuaidenganlingkupkerjalaboratorium (50%74%). 2 SosialisasiSMU,ProgramKerjabelum menggunakanweb. 3 Belumtersediadokumenkualifikasi asisten. 4 Belumtersediadokumenpemeriksaan peralatan. Tabel4.125.TemuanDeskriptifKinerjaPeriode2010UnitLab.HidrolikaProdi.T.Sipil TemuanLab.Hidrolika AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukurnamunkurang sesuaidenganlingkupkerjalaboratorium (50%74%).

BPM-UII-YOGYAKARTA/2011

Halaman 150 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

2 SosialisasiSMU,ProgramKerjabelum menggunakanweb. Tabel4.126.TemuanDeskriptifKinerjaPeriode2010UnitLab.IlmuUkurTanahProdi.T.Sipil TemuanLab.IlmuUkurTanah AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukurnamunkurang sesuaidenganlingkupkerjalaboratorium (50%74%). 2 SosialisasiSMU,ProgramKerjabelum menggunakanweb. 3 SasaranMututelahterukurnamunkurang sesuaidenganlingkupkerjalaboratorium (50%74%) 4 Belumdilakukanevaluasiprogramkerja. 5 SosialisasiSMU,ProgramKerjabelum menggunakanweb.

Tabel4.127.TemuanDeskriptifKinerjaPeriode2010UnitLab.JalanRayaProdi.T.Sipil TemuanLab.JalanRaya AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMU,program Belumadaprosedurbagaimana TindakanPerbaikan: kerja,programpengembangan, menguploadkeweb Mengusulkankejurusanuntuk jadwalbelummelaluiweb memfasilitasi 2 Ketercapaiansasaranmutu80% Sasaranmutuperludirevisi TindakanPerbaikan: Merevisisasaranmutu 3 KetersediaanJadwalpraktikum TindakanPerbaikan: kurangdari14hari DiluarkendaliLab,tergantung MenguuslkanperbaikanSAPke darimasaKeyIndanSAP dosenkoordinator 4 Penyerahannilaiakhirasisten Nilaiyangdiberikanasistenke TindakanPerbaikan: tidaktepatwaktu Labdimungkinkanberbeda Labmendapatkancopynilaidari waktunyadenganyangdiberikan asisten didosen 5 NKAAsisten85% Kurangpengalaman TindakanPerbaikan: Pelatihanyanglebihintensif 6 Pengendaliandanevaluasi LabbelummendapatkanPMuntuk TindakanPerbaikan: keluhansesuaidenganPM pengendaliankeluhan LabakanmintaPMuntuk pengendaliankeluhan Tabel4.128.TemuanDeskriptifKinerjaPeriode2010UnitLab.KomputasiProdi.T.Sipil TemuanLab.Komputasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SosialisasiSMU,ProgramKerja, Belumadaprosedurbagaimana TindakanPerbaikan: ProgramPengembangan,Jadwal menguplodkeweb MengusulkankeJurusanuntuk belummelaluiweb mengfasilitasi 2 Ketercapaiansasaranmutu80% SasaranMutuperludirevisi TindakanPerbaikan: Merevisisasaranmutu 3 Ketersediaanjadwalpraktikum DiluarkendaliLab,tergantung TindakanPerbaikan: kurangdari14hari darimasaKeyindanSAP MengusulkanperbaikanSAPke dosenkoordinator 4 Penyerahannilaiakhirasisten Nilaiyangdiberikanasistenke TindakanPerbaikan: tidaktepatwaktu Labdimungkinkanberbeda Labmendapatkancopinilaidari waktunyadenganyangdiberikan asisten dosen 5 NKAAsisten85% Kurangpengalaman TindakanPerbaikan: Pelatihanyanglebihintensif 6 Pengendaliandanevaluasi LabbelummendapatkanPMuntuk TindakanPerbaikan: keluhansesuaidenganPM mengendalikankeluhan LabakanmenintaPMuntuk pengendaliankeluhan Tabel4.129.TemuanDeskriptifKinerjaPeriode2010UnitLab.MekanikaRekayasaProdi.T.Sipil TemuanLab.MekanikaRekayasa AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukur namunkurangsesuaidengan lingkupkerjalaboratorium (50%74%).

BPM-UII-YOGYAKARTA/2011

Halaman 151 dari 152

LAPORAN HASIL AUDIT MUTU INTERNAL KINERJA UNIT & PROGRAM STUDI 2010

TemuanLab.MekanikaRekayasa AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 2 SosialisasiSMU,ProgramKerja belummenggunakanweb. Tabel4.130.TemuanDeskriptifKinerjaPeriode2010UnitLab.MekanikaTanahProdi.T.Sipil TemuanLab.MekanikaTanah AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukur namunkurangsesuaidengan lingkupkerjalaboratorium (50%74%). 2 Belumadaprogramkerjatahun 2010. Tabel4.131.TemuanDeskriptifKinerjaPeriode2010UnitLab.RekayasaTransportasiProdi.T.Sipil TemuanLab.RekayasaTransportasi AnalisisPenyebab RencanaTindakLanjut No. Deskripsi 1 SasaranMututelahterukurnamun kurangsesuaidenganlingkupkerja laboratorium(50%74%) 2 Belumadaprogramkerjatahun 2010.

BPM-UII-YOGYAKARTA/2011

Halaman 152 dari 152