Anda di halaman 1dari 15

PRAKTIKUM FARMASETIKA TERAPAN ASMA

Disusun oleh : Kelompok L/III 1. 2. 3. 4. 5. Theresia Ita P. Tri Wijaya Ningsih Yandini Yulia Dewi Qomarina Yuliana (1041011148) (1041011153) (1041011162) (1041011167) (1041011168)

SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI SEMARANG 2013

I.

RESEP
Dokter Rahmawati, Sp. Paru2 SIP : 1568/DKK/04.371/04.02/II/2012 Alamat : Jl. Untung Suropati 478 Semarang tlp. 7612377 Praktek: jam 17.00 20.00 Semarang, 9 Desember 2013 R/ Birofec MDI I S 2 semprot bila sesak Aminofilin tb 1 Dexamethasone tb 1 Loraladin tb1 mf pulv da in cp dtd no. XV

R/

Pro : Ny. Sumi Umur : 56 tahun Alamat :

Obat tersebut tidak boleh diganti tanpa sepengetahuan dokter

II. PERMASALAHAN A. KELENGKAPAN RESEP Kurang alamat pasien Tidak terdapat tanda tangan dokter

B. HARGA RESEP 1. Perhitungan harga 1. Birotec MDI Harga satuan PPN 10% Laba 1 Harga jual = Rp 136.246,= Rp 136.246,- x 1,1 = Rp 149.870,= Rp 149.870,- x 1,15 = Rp 172.351,= Rp 172.351,- + Rp 1.000,= Rp 173.351,- ~ Rp 173.400,2. ObatRacikan a. Aminofilin (1 box isi 1000tablet) Harga per tablet = 1tab/1000tab x Rp 90.000,= Rp 90,-/tablet x 15 = Rp 1350,PPN 10% Laba 15% b. = Rp 1350,- x 1.1 = Rp 1485,- x 1.15 = Rp 1485,= Rp 1707,-

Dexamethason (1 box isi 1000tablet) Harga per tablet = 1tab/1000tab x Rp 55.000,= Rp 55,-/tablet x 15 = Rp 825,PPN 10% Laba 15% = Rp 825,- x 1.1 = Rp 907,- x 1.15 = Rp 907,= Rp 1043,-

c.

Loratadin (1 box isi 100tablet) Harga per tablet = 1tab/100tab x Rp 41.000,= Rp 410,-/tablet x 15 = Rp 6150,PPN 10% Laba 15% = Rp 6150,- x 1.1 = Rp 6765,- x 1.15 = Rp 6765,= Rp 7779,-

Jumlah Harga = Rp 1707,- + Rp 1043,- + Rp 7779,= Rp 10531,- ~ Rp 10550,-

Harga Jual

= Rp 10550,- + Rp 2.500,= Rp 13050,-

Total harga seluruh

= Rp 173400,- + Rp 13050,= Rp 186450,-

C. KETERANGAN OBAT 1. AMINOFILIN Komposisi: Tiap tablet mengandungaminofilin 200 mg Cara KerjaObat: Aminofilinmerupakanturunanmetilxantin mempunyaiefekbronkodilatordenganjalanmelemaskanototpolosbronkus. Indikasi: Menghilangkan&mencegahgejala-gejalaasma&bronkhospasme reversibel yang berhubungandenganbronkhitiskronis&emfisema. EfekSamping: Gastrointestinal, misalnya :mual, muntah, diare. Susunansarafpusat, misalnya :sakitkepala, insomnia. Kardiovaskuler, misalnya :palpitasi, takikardi, aritmiaventrikuler. Pernafasan, misalnya : tachypnea. Rash, hiperglikemia yang bersifat yang

Kontraindikasi: Tidakdianjurkanuntukanakberusiakurangdari 12 tahun. Hipersensitifterhadapaminofilinaataukomponenobat. Penderitatukaklambung, diabetes.

Dosis: Dewasa : 1 tablet 3 kali sehari. Anak-anak 6 12 tahun : tablet 3 kali sehari. Ataumenurutpetunjukdokter.

2.

DEXAMETHASONE Indikasi : Obatinidigunakansebagai glucocorticoid khususnya; untuk anti inflamasi, pengobatanrheumatik arthritis danpenyakit collagen lainnya, alergi dermatitis dll. penyakitkulit, penyakitinflamasipadamasadankondisi lain dimanaterapi

glucocorticoid bergunalebihmenguntungkansebagaipenyakit leukemia tertentudan lymphomas daninflamasipadajaringanlunakdan anemia hemolytica. KontraIndikasi Dexamethasone Harsentidakbolehdiberikanpadapenderita herpes simplex padamata; tuberkuloseaktif, peptic ulcer

aktifataupsikosiskecualidapatmenguntungkanpenderita. Jangandiberikanpadawanitahamilkarenaakanterjadihypoadrenalismpadabayi dikandungnyaataudiberikandengandosis yang serendah-rendahnya. EfekSamping Pengobatan yang berkepanjangandapatmengakibatkanefekkatabolik steroid yang

sepertikehabisan protein, osteoporosis danpenghambatanpertumbuhananak. Penimbunangaram, air dankehilangan

potassium jarangterjadibiladibandingkandenganbeberapa glucocorticoid lainnya Penambahannafsumakandanberatbadanlebbihseringterjadi. Dosis : Dewasa : 0,5 mg - 10 mg per hari Oral : (rata2 1,5 mg - 3 mg per hari). 5 mg - 40 mg per hari. untuk keadaan yang darurat diberikan intra vena atau intra muskular. Dosis i.m. diberikantiap 6 jam untuk mendapatkan efek yang Anak2 : maksimum. 0,08 mg - 0,3 mg/kg berat badan/hari dibagi dalam 3 atau 4 dosis.

Parenteral :

Interaksi Obat : Insulin, hipoglikemik oral : menurunkanefekhipoglikemik Phenythoin, phenobarbital, efedrin : meningkatkan clearance metabolik dari deksametason; menurunkan kadar steroid dalam darah dan aktifitas fisiologis.

Antikoagulansia oral : meningkatkan atau menurunkan waktu protrombin. Diuretik yang mendepresi kalium : meningkatkan resiko hipokalemia. Glikosida kardiak: meningkatkan reesiko aritmia atau toksisitas digitalis sekunder terhadap hipokalemia.

Antigen untuk tes kulit : menurunkan reaksivitas. Imunisasi : menurunkan respon antibodi. Perhatian :

Kekurangan adrenocortical sekunder yang disebabkan oleh pengobatan dapat dikurangi dengan mengurangi dosis secara bertahap.

Ada penambahan efek Corticosteroid pada penderita dengan hypothyroidism dan cirrhosis.

3.

LORATADIN Indikasi: Loratadineefektifuntukmengobatigejala-gejala yang berhubungandenganrinitisalergi, sepertipilek, bersin-bersin, rasa gatalpadahidungserta rasagataldanterbakarpadamata. Selainituloratadinejugamengobatigejalagejalasepertiurtikariakronikdangangguanalergipadakulitlainnya. KontraIndikasi: Hipersensirifterhadaploratadine. Komposisi: Tiap tablet mengandung 10 mg loratadine. Cara KerjaObat: Loratadinemerupakansuatuantihistamintrisiklik acting), yang bekerjacukuplang (long -H1

mempunyaiselektifitastinggipadareseptorhistamin

periterdantidakmenimbulkanefeksedasiatauantikolinergik. PeringatandanPerhatian:

Karenaefekpemakaianloratadineselamakehamilanbelumdiketahuisecarapasti,

makaloratadinediberikanpadawanitahamilhanyanilamanfaatnyalebihbesardariresikon yaterhadapjanin. - Hati-hatipemakaianloratadinepadapasiendengangangguanhatidangagalginjal. - Loratadinesebaiknyatidakdiberikanpadaibumenyusuikarenadieksekresikanmelalui air susu. - Pemberianloratadinepadaanak-anak di bawah 12 tahunkeamanannyabelum diketahuidenganpasti. EfekSamping: Loratadinetidakmemperlihatkanefeksamping yang secaraklinisbermakna, karena rasa mual, lelah, sakitkepala, mulutkeringjarangdilaporkan.Frekuensiefek-

efekinipadaloratadinemaupun placebo tidakberbedasecarastatistik. InteraksiObat: Pemberianloratadinebersamaalkoholtidakmemberikanefekpotensiasiseperti terukurpadapenampilanpsikomotor. Pemberianloratadinebersamaeritromisin, ketokonazol&simetidinedapatmenghambatmetabolismeloratadine. Cara Penyimpanan: Simpanpadasuhu 2 - 30 derajatCelcius. Kemasan: Loratadine 10 mg tablet, kotak 5 strip @ 10 tablet. yang

4.

BIROTEC MDI Kandungan Mengandung Fenoterol HBr 0,2 mg . Indikasi

Asma bronkial, bronkitis obstruktif, emfisema, asma disebabkan suatu gerakan olahraga dan kelainan bronkopulmonari Kontra Indikasi Kardiomiopati obstruksi hipertrofi, takiaritmia. Efek Samping

Tremor halus pada otot rangka, gugup, sakit kepala, pusing, takikardi, palpitasi, batuk, iritasi lokal; mual, muntah, berkeringat, otot lemah, mialgia, kram otot. Perhatian DM yang tak terkontrol, infark miokard yang belum lama terjadi, penyakit jantung oganik atau vaskular yang berat, hipertiroid. Hamil trimester 1, laktasi. Penggunaan jangka panjang dievaluasi untuk adanya terapi tambahan dengan antiinflamasi. Monitor kadar kalium serum. Dosis Episode asma akut 1x semprot, jika belum ada perbaikan setelah 5 manit, berikan dosis ke 2. Jika serangan asma tidak dapat diatasi dengan 2 semprot, dosis mungkin perlu ditambah. Pencegahan asma yang mungkin dipicu oleh aktivitas fisik 1-2 semprot, maks: 8 semprot/hr. Asma bronkial dan keadaan lain dengan penyempitan sal nafas yang reversibel bila diperlukan pengulangan dosis, 1-2 semprot untuk tiap pemberian, maks 8 semprot/hr. Interaksi Efek diperkuat oleh obat ?-adrenergik, antikolinergik, derivat xantin. Penurunan efek yang serius dapat terjadi jika diberikan bersama penyekat . Perhatian khusus bila obat diberikan bersama dengan MAOI, antidepresan trisiklik. Inhalasi dari anaestesi hidrokarbon terhalogenasi dapat meningkatkan kerentanan terhadap efek KV oleh agonis ?. Kemasan Inhaler 100 mcg/semprot x 200 semprot x 10 ml x 1 Cara penggunana inhaler 1. 2. Bukalahpenutupujung inhaler lalukocok inhaler dengankuat. Genggam inhaler seperticontohpadagambar.

Tarikdanhembuskannafassecaraperlahan.

3. Pegang inhaler di depanmulutdengankepalaagakmenengadah.Tempatkanujung inhaler di dalammulut di ataslidahdantutup inhaler denganbibirAnda. Mulailahmenariknafasperlahandantekan inhaler 1 kali bersamaandenganmenariknafasperlahansedalam-dalamnya.

4. TahannafasAndaselama 10 detikatauselamamungkin yang Andasanggup, sebelummenghembuskannafasperlahanuntukmemastikanseluruhobatmasukkesalurann afas.

5. Jikadoktermenyarankanlebihdari 1 kali pemakaian inhaler, makatunggulah 1 menitsebelumkembalimengocok inhaler danmengulangilangkahpadapoin 2,3,dan 4. 6. Setelahselesai, berkumurlahdahuludengan air hangat. 7. Cucidanbersihkanujung inhaler dengan air hangattiaphari. Penting untuk Anda ketahui!

Simpan inhaler pada suhu sejuk, kering, terhindar dari cahaya dengan mulut inhaler menghadap ke bawah.

Jangan hentikan penggunaan inhaler atau mengubah dosis tanpa berkonsultasi dengan dokter.

Konsultasikan pada dokter bila Anda akan mengkonsumsi obat-obatan lain. Laporkan pada dokter bila pengobatan tidak efektif. Jangan sembarangan menggunakan inhaler melebihi dosis yang diberikan dokter.

Efek samping seperti meningkatnya detak jantung, gemetar, dan pusing umum terjadi. Bila efek samping tidak tertahankan segera laporkan pada dokter atau apoteker.

D. 1.

PERHITUNGAN DOSIS DOSIS AMINOFILIN D1x = 225 mg D1h= 3 x 225 mg= 675 mg DM 1x = 225 mg DM 1 hr = 450 mg D/DM 1 x = 225 mg/225 mg x 100 % = 100 % DM 1 x/DM 1 hr = 675 mg/ 450 mg x 100% = 150%

2.

DOSIS LORATADIN D1x = 10 mg D1h= 3 x 10 mg= 30 mg DM 1x = 10mg DM 1 hr = 10mg D/DM 1 x = 10mg/10 mg x 100 % = 100 % DM 1 x/DM 1 hr = 30 mg/ 10 mg x 100% = 300%

3.

DOSIS DEXAMETHASONE D1x = 0,5mg D1h= 3 x 0,5 mg= 1,5mg DM 1x = 0,125mg = 0,25 mg DM 1 hr = 0,5 mg D/DM 1 x =0,5 mg/0,25 0,125 mg x 100 % = 200 - 400 % DM 1 x/DM 1 hr = 1,5 mg/ 0,5 mg x 100% = 300%

III. PERMASALAHAN DAN PENYELESAIAN PERMASALAHAN 1. Tidak tercantum harga birotec MDI 2. Pasien menderita penyakit gagal ginjal dan pasien termasuk golongan geriatri. 3. Dosis yang diberikandoktermelebihirentangdosisterapi.

PENYELESAIAN 1. 2. Konfirmasi mengenai harga obat ke PBF Karena pasien tersebut menderita gagal ginjal dan termasuk geriatri sehingga untuk pemakaian obat perlu dipantau. 3. Dosis obat yang diberikan diturunkan karena melebihi dosis terapi.

IV.

KIE 1. Pengguanaan inhaler ( birotec MDI ) digunakan saat terjadi serangan asma yang mendadak dan untuk asma yang akut. 2. Pasien sebaiknya diberikan secara jelas atau keluarga pasien mengenai cara penggunaan inhaler yang benar. 3. 4. 5. 6. Pasien dianjurkan untuk menjaga kesehatan tubuhnya agar tidak terlalu lelah. Mengurangi aktifitas fisik yang terlalu banyak. Pasien dianjurkan terapi pernafasan. Obat diminum hanya terjadi serangan.

V. ETIKET 1. Resep Non Racikan


APOTEK SEHAT SUKACITA SIA : 123/456/SIA/17.09/BPPT/V/2015 Apoteker : Theresia Ita PS S1., Apt SIPA : 0536/SIPA/BPPT/2009 Jl. Kangguru no 12 (024) 567890

No.1

Semarang, 12-12-2013 Ny Suni 2 kali semprot bila asma

2. ResepRacikan
APOTEK SEHAT SUKACITA SIA : 123/456/SIA/17.09/BPPT/V/2015 Apoteker : Theresia Ita PS S1., Apt SIPA : 0536/SIPA/BPPT/2009 Jl. Kangguru no 12 (024) 567890

No.2

Semarang, 12-12-2013 Ny Suni 3x sehari 1 kapsul Bila sesak

VI. COPY RESEP

APOTEK SEHAT SUKACITA SIA : 123/456/SIA/17.09/BPPT/V/2015 Apoteker : TheresiaIta PS S1., Apt SIPA : 0536/SIPA/BPPT/2009 Jl. Kangguru no 12 (024) 567890
COPY RESEP Namadokter TglPenulisanresep Pro Usia : Dr. Rahmawati, SP. Paru-paru : 9 Desember 2013 : NySumi : 56 tahun

R/Birotec S 2 semprotbilasesak R/ Aminofilin 1 tab Dexamethasone 1 tab Roraladin 1 tab mf. Pulv da in cap dtd No XV S .3 dd 1 bilasesat

det

det

Semarang ,12 Desember2013

Pcc

VII. DAFTAR PUSTAKA Tjay, Rahardja. 2007. Obat-Obat Penting. Jakarta : Gramedia ISFI. 2008. ISO Farmakoterapi. Jakarta : ISFI Penerbit ISFI. 2011. ISO Indonesia Volume 45. Jakarta : ISFI Penerbit Obatmerah.16mb.com/2012/07/aminofilin/ Ahli-farmasi.blogspot.com/2012/01/dexamethasone.html

KESIMPULAN Obat Aminofilin mempunyai efek samping salah satunya adalah insomnia. Hal itu tidak perlu dikhawatirkan selama dalam penggunaan jangka pendek, bila perlu dan dosis yang sesuai. Pada etiket, penulisan Harap Pengulangan tidak perlu dicantumkan. Pertolongan pertama pada penderita asma sebaiknya inhaler. Nafas buatan kurang begitu menolong karena tidak bersifat bronkodilatasi sehingga kemana-kemana penderita harus membawa inhaler sendiri untuk jaga-jaga bila asma menyerang. Pada kasus ini untuk terapi pengobatan asma, diutamakan menggunakan obat Birotec daripda obat oral karena pasien menderita gagal ginjal.