Anda di halaman 1dari 46

Edisi Profesi

TerminologiMedis

SarmokoS.Farm,c.Apt FakultasFarmasiUniversitasGadjahMada 2008

Pengantar |1

1
TerminologiMedis Pengantar

Di sampaikan oleh: Dra. Tri Murti Andyani, Apt., SpFRS Rabu, 3 September 2008 Diketik oleh: TIM PSC angkatan 2003, di Edit oleh Sarmoko

TerminologiMedis Terminologimedisdigunakanuntukmemberikejelasandankekhususankomunikasi Katakatamedikdefinisinyasama Komunikasidalamsuatukomunitaspelayanankesehatanbenar&tepat Untukmemahamiterminologimedisdiperlukan2elemendasar: 1. pengetahuantentangfungsidanstrukturtubuh 2. mengetahuiartidariprefiks,akarkata&sufiksyangmenyusunkatamedik Katamedikdisusunoleh: 1. akarkata,misal:namaorgan 2. prefiks,ditambahkandidepanakarkata 3. sufiks,ditambahkansesudahakarkata Contoh: myo / pathy otot penyakit (akarkata) (sufiks) (akarkatabiasanyanamaorgan). Beberapakatabisamempunyaiartilebihdari1akarkata Contoh: Osteo / arthr / itis Tulang sendi inflamasi (akarkata) (akarkata) (sufiks) Artinya:peradanganpadapersendiantulang. PREFIKS Katasifat,kataketerangan Katadepanyangdigunakanuntukmenyatakanhubunganataukondisiakarkata. Contoh: Macro :besar bradi :lambat Micro :kecil tachy :cepat AKARKATA Merupakanbagianpokokdarikatayangmenyampaikanartipokokatausignifikansinya. Artidasarkemudiandimodifikasidengansufiks,prefiksatauakarkatalain. Akarkatayangdigunakanbiasanyamenyatakanorganataubagiandaritubuh.
Sarmoko, S. Farm.

Pengantar |2

SUFIKS Sufiksterdiri darisatuataulebihsuku katayang ditambahkanpada akarkata untukmemodifikasi artinya. Misalalgia :nyeri itis :inflamasi osis :penyakit Contoh:analgetik(pengurangnyeri) An/algia Tidakada/nyeri Anberartitidakada,tapibukantidaksamasekali.Contoh:anuria(urinnyasedkit,bukantidak berurin. Contohlain:apneu(gagalnafas). Apneu(a:tanpa)tidakbernafas/gagalnafas(bukanberartisudahmati) Butuhventilasimekanikventilatoruntukmembantupernafasanpasien. EPONYMS Penyakit khusus, sindrom atau suatu keadaan penyakit dinyatakan dengan nama orang, biasanya yangpertamamengidentifikasipenyakittersebut. Misal:Alzheimersdisease(pikun) Bellspalsy Crohnsdisease(gangguanpadapencernaan,yaituatrofipadaviliusus).Atrofi=a+tropy (tidakberkembang).Akibatdaripenyakitiniyaitumalnutrisi(nutrisiburuk). Malabsorpsiberbedadenganmaldigesti.Penyakitceliacpada anakanakmerupakanpenyebab terpenting dari malabsorpsi pada anak. Penyakit ini ditandai oleh atrofi vili usus halus bagian proksimal. AKHIRANYANGTERKAITDENGANPROSEDURPEMBEDAHAN Suffix Arti Contoh Surgical puncture untuk aspirasi atau Amniocentesis (mengambil cairan centesis menghilangkancairan amnion),thoracentesis Eksisi(menghilangkanataumemotong) ectomy Appendectomy Proses penghilangan, pembebasan, Hemolysis,keratolysis lysis perusakan Fiksasi(mempercepatkeposisiyangtepat) pexy Mastopexy (pengembalian payudarakeposisinormal) Memperbaikidenganpembedahan plasty Renoplasty(hidung) Menjahit rrhaphy Pemeriksaanvisual scopy Microscopy, endoscopy (organ dalam,menggunakanfiberoptic) Formasimembuka stomy Tracheostomy,vagotomy Alatuntukmemotong tome Microtome Insisi(memotongjaringan) tomy Tracheotomy tripsy Lithotripsy penghancuran

Sarmoko, S. Farm.

Pengantar |3

BENTUKKOMBINASI Bentukkombinasi Arti Kelenjar Aden/o Pembuluh Angi/o Appendix Append/o,appendic/o Otak Cerebr/o,enchepal/o Kulit Cutane/o,derm/a,dermat/o Breast Mamm/o,mast/o Syaraf Neur/o Mata Ophthalm/o,optic Telinga Ot/o Tonsil Tonsill/o Pembuluh,vasdeferens Vas/o Angiogram :hasilpemeriksaanpembuluhdarah Dermatologist :ahlidibidangkulit Latihan1 1. Oophorosalpingohysterectomy 2. Colostomy 3. Coloscopy 4. Colopexy 5. Mastectomy 6. Neuroplasty 7. Aniorrhaphy 8. Tonsilectomy 9. Neurotripsy AKHIRANYANGTERKAITDENGANGEJALA&DIAGNOSIS Akhiran Arti Nyeri algia Hernia chele Dilatasi ectasia,ectasis Pembengkakan edema Muntah emesis Keadaan ia,iasis Inflamasi itis Pelunakan malacia Pembesaran megaly Tumor oma Keadaan osis Penyakit pathy Defisiensi penia Ketakutanyangabnormal phobia Prolaps=turun/merosot ptosis Pendarahanyangberlebihan rrhage,rrhagia rrhea mengalir Kataterkait Adenoma Angiogram Appendectomy Enchepalitis Dermatologist Mammography Neurology Ophthalmology Otitis Tonsillitis vascular

Kataterkait Neuralgia Enchepalochele Angiectasia Edema Hyperemesis Pancreolithiasis Appendicitis Osteomalacia Cardiomegaly Carcinoma Neurosis Nephropathy Leucopenia Hydrophobia Prolapsuteri Hemorrhage Rinorrhea, rhinorrhea (pilek),
Sarmoko, S. Farm.

Pengantar |4

otorrhea Cardiorrhexis Rupture=kerusakan rrhexis Bronchospasm Kramp,penyempitan spasm enterostasis Penghentian,kontrol stasis Pancreolithiasis:keadaanditemukannyabatupankreas Carcinoma:tumoryangganas(kanker) Neurosis:keadaangangguanpadasyaraf Leucopenia:kekuranganWBC Prolapsuteri=hysteroptosis:penurunanuterus Ruptureuteri:kerusakanuteruspadawanitahamilsehinggaharusdilakukanbedahCaesar Hemato=darah,oma=tumor Enchepalootak(herniapadaotak) Enchepalochele=pendesakanjaringandiotak stasis = pengehentian/kontrol. Contoh: homeostasis (kontrol), enterostasis (penghentian pada usus). Homeostasis(home/o:keseimbangan,+stasis:mengontrol) =Keadaanequilibriumlingkungantubuhinternal Latihan2 1. Akhiranyangberartitumor(oid,oma,osis,rrhagia) 2. Akhiranyangberartipenyakit(pathy,penia,phobia,ptosis) 3. Perdarahanyangberlebihan(rrhea,rrhage,rrhexis,pathy) 4. Akhiranpeniaberarti(keadaan,defisiensi,ruptura) 5. Akhiranptosisberarti(penyakit,takut,prolaps,penurunan) Pertemuan4 24September2008 Dosen:Fita AKHIRANTAMBAHAN Akhiran Arti Kataterkait Preventable Mampu,bisa able,ible Cardiac,thermal,median ac,al,an,ar,ary,eal,ic, Terkaitdengan ive,tic Enzyme ase Lactase Seseorangmenderita iac Haemophiliac Keadaanatauteori ism Synergism Seseorang ist Therapist Membrane ium Spesialis logist Neurologist Penglihatan opia Diplopia Gula ose Lactose Terkaitataudigambarkan ous Cancerous Keadaanataukondisi y Atrophy Haemophiliac:orangyangmenderitahemofilia
Sarmoko, S. Farm.

Pengantar |5

BENTUKKOMBINASIKHUSUS Akhiran Arti Kataterkait Amylase Zatpati Amyl/o Blepharoptosis Kelopakmata Blephar/o Cardiomegaly Jantung Cardi/o Chirospasm Tangan Chir/o Hypoglicemia Gula Glyc/o Hematemesis Darah Hemat/o Lactation Susu Lact/o Lipid Lemak Lip/o Nephrolithiasis Batu Lith/o Membranemukosa Mucus Muc/o Osteoarthritis Tulang Oste/o Proteinuria Protein Prote/o,protein/o pyrosis Api Pyr/o Chirospasm:krampadatangan Blepharoptosis : kelopak mata turun karena gangguan koordinasi otot pada kelopak mata sehingga kelopak mata tidak bisa mengikuti gerakan bola mata (pada penderita kekurangantiroid) PENGGUNAANAWALAN,AKHIRAN&BENTUKKOMBINASIUNTUKMENULISISTILAHMEDIS Bentukkombinasiuntukwarna Bentukkombinasi Arti Kataterkait Albino Putih Alb/o,albino/o Leukaemia Leuc/o,leuk/o Chlorophyll Hijau Chlor/o Cyanosis Biru Cyan/o Erithrocyt Merah Erythr/o Melancholysendu Hitam Melan/o Xanthophyll Kuning Xanth/o Erythrocytosis:. Xanthosis: Melanoma:tumorpdmelanosit(selpenghasilpigmen) Leukaemia:kankerdarah(WBC>>) BENTUKKOMBINASI&KATATERKAIT Bentukkombinasi Arti Akhiran genic, Permulaan,diproduksioleh Gen/o genesis Pembentukan gram Untukmerekam,rekaman Gram/o graph Alatuntukmerekam graphy Prosesperekaman kinesia,kinesis Pergerakan Kinesi/o
Sarmoko, S. Farm.

Pengantar |6

Log/o Lys/o Malac/o Megal/o Metr/o Path/o Phag/o Phas/o Pleg/o Schiz/o,schis/o,schist/o Scler/o Scop/o Troph/o

Pengetahuan,spesialis Studiataupengetahuantentang Perusakan Prosespenghancuran Mampuuntukmerusak Pelunakan Pembesaran Pengukuran, jaringan uterus, alatuntuk mengukur Prosespengukuran Penyakit Makan,mengunyah,menelan Berkomunikasi Paralysis Terbelah Pengerasan Untukpemeriksaan(alat) Prosespemeriksaanvisual nutrisi

logist logy lysin lysis lytic malacia megaly meter metri pathy phagia, phagic, phagy phasia plegia schisis sclerosis scope scopy trophic trophy

Glucogenesis:pembentukangula Dysphagia:kesulitanmenelan Dyspepsia:kesulitan/gangguandalamsaluranpencernaan Scleritis:inflamasipdsclera Latihan3 1. Electrocardiogram:hasilpemeriksaanjantung 2. Cephalometry:pengukurankepala 3. Ophtalmopathy:penyakitmata 4. Lithogenesis:prosespembentukanbatu 5. Glycolysis:prosespemecahanglukosa 6. Gerontologist:spesialisgeriatric(lansia/geronto) 7. Pathology:ilmutentangterjadinyapenyakit 8. Carcinogen:penginduksi/yangmemulaiterjadinyakanker 9. Dystrophic:gangguannutrisi AWALANTERKAITDENGANJUMLAH&PENGUKURAN Awalan Arti Kataterkait Samadengankosong Tidakada,tanpa Nulli Primitive Pertama Primi Unicycle Satu Mono,uni Carbondioxide Dua Bi,di Tricycle Tiga Tri Quadriplegic Empat Quad,quadri,tetra Semicircle Separuh,sebagian Hemi,semi Multipurpose Beberapa Multi,poly
Sarmoko, S. Farm.

Pengantar |7

Hyperactive Berlebihan,lebihdarinormal Hyper Hypodermic(dibawahkulit) Kurang,dibawahnormal Hypo Macroscopic Besar Macro Microscope Kecil Micro Primipara:kelahiranyangpertama Nullipara:tidakbisamelahirkan Latihan4 1. Primigravida:kehamilanyangpertama(gravida=hamil) 2. Multicelluler:beberapasel 3. Polydipsia:banyakmakan 4. Quadriplegia:kelumpuhanbagiantubuh 5. Hyperlipidemia:kelebihanlemak 6. Microorganisme:organismekecil 7. Multiplesclerosis:terjadibeberapapengerasan 8. hypocalemia:kekurangankalsium 9. Endotracheal:didalamtrachea 10. Postpartum:setelahmelahirkan 11. Exogenous:senyawa2yangberasaldariluartubuh 12. Hypoglossal:dibawahglossal 13. Interselluler:diantarasel 14. Superficial:diatasficial 15. Epidermis:kulitbagianatas AWALANTAMBAHAN Awalan Arti Kataterkait Asymptomatic Tidak,tanpa a,an Antiperspirant Melawan anti,contra Bradycardia Lambat brady Dyslexia Buruk,sulit dys Euthanasia Baik,normal eu Inconsistent Tidakataudidalam in Malnutrisi Buruk mal Paranasal Dekat,disamping,tidaknormal para Perspirasi Melalui,dengan per tachycardia cepat tachy Dyslexia:gangguanSSPpadakoordinasigerakansehinggaterjadigangguandiskoneksigerakan Euthanasia: membunuhdenganbaik(daripadahidupmenderita, untukmengurangipenderitaan. Digunakanuntukpasienyangudahsekarat,biarsakitnyagaksebegituamat) Latihan5 1. Tachycardia:denyutjantungcepat 2. Bradyphasia:komunikasilambat 3. Hypotiroidism:kekurangantiroid 4. Malabsorpsi:gangguanabsorpsi
Sarmoko, S. Farm.

Pengantar |8

5. Hypersekresi:sekresiberlebihan 6. Parathyroid:disekitartiroid 7. Dysphonia:gangguanpengeluaransuara 8. Percutaneus:melaluikulit Parathyroid:ada4kelenjarparathyroid,fungsinyauntukmenjagahomeostasiskalsium AWALANTERKAITDENGANPOSISIATAUARAH Awalan Arti Kataterkait Awayfrom Ab Abduct Toward Ad Addition Sebelum Ante,pre,pro Anteroom Melalui Dia Diameter Keluar,tanpa,awayfrom Aceto,ex,exo Exoskeleton Diatas,pada Epi Apitaph Didalam En,endo Enclose Kurang,dibawah Hypo,sub Hypodermic Diantara Inter Interval Dalam Intra Intramuscular Ditengah Meso Mesoderm Sekitar Per Perimeter Sesudah,behind Post Postdate Behind,backward Retro Retroactive Super,supra Supernormal Diatas,beyond Thanxto:AllahSWT,atasizinMuakumasihbisaberjumpadenganRamadhanhinggaharike7 ini.TerimakasihkpdMbBeEfyangtelahmemberikansoftcopybahankuliahnya,denganitu akhirnyaakubisabayarMOElantarandibisniskankebentukCD.He..he.. Buatteman2PROFESI,September2008 SELAMATDATANG Calonapotekermuda,generasipenerusbangsaberjiwaPancasilanberlandaskanUUD1945. www.moko31.wordpress.com

Sarmoko, S. Farm.

Sistem Pencernaan |9

2
TerminologiMedis SistemPencernaan

Di sampaikan oleh: Dra. Tri Murti Andyani, Apt., SpFRS Rabu, 10 September 2008 Diketik oleh: TIM PSC angkatan 2003, di Edit oleh Sarmoko

Fungsisistempencernaan Pencernaan proses dimana makanan dipecah secara mekanik dan kimia (sepanjang saluran pencernaan) Makanandikunyahmasukesofaguslambungdicernaolehenzimkelenjarpancreas masukduodenumususbesardieksresimelaluianus Empedumembantuabsorbsilemak Kurangmakanataugangguanabsorpsidandistribusimalnutrisi(mal:buruk) Malnutrisi : bisa karena kekurangan nutrisi (asupan gizi berkurang), bisa juga karena terjadi atrofipadaviliusushalussehinggaabsorpsimakanantergangguceliacdisease Atrofi:tidakberkembang Anorexia(an:tanpa,+orexia:nafsumakan) hilangnyanafsumakanterhadapmakanan Statis>penyempitanpadasuatuorgan=berhenti Eg:Enterostatisgangguanaliranmakanan Cholestatic terjadi penyempitan saluran empedu sehingga cairan empedu gak bisa lewat Hyperemesis(hyper:berlebihan,emesis:muntah)kecukupannutrisi??? muntahyangberlebihan Padawanitahamildisebutmorningsicknessatauhyperemesisgravidarum(gravidahamil) Diarrhea(dia:terus,+rrhea:mengeluarkan) Rrhea=mengeluarkancairan,tapibelumtentudarah Kaloyangkeluardarahrrhagia Eg:Rinorrheakeluarcairandarihidung(rino:hidung) Otorrheakeluarcairandaritelinga,berupapus/nanah(oto:telinga) Dehidrasi(de:menghilangkan,+hydr/o:air) outputcairantubuhmelebihiintakecairan Alimentasiprosespenyediaannutrisiuntuktubuh Saluranpencernaan~sistemalimentary

Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 10

Gambarsistempencernaan

Bagiankataterkaitdenganorganpencernaan Bagiankata Arti Bibir Cheil/o Dent/I, dent/o, Gigi Gusimulut&gigi odont/o Lidah Gingiv/o Mulut Gloss/o,lingu/o

Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 11

Latihan1 1. Stomatitismerupakaninflamasipada.. 2. Hypoglossalberarti. 3. Orthodontistberarti.. 4. Gasrtralgiadangastrodyniaberartipadalambung 5. Gastroenterology merupakan ilmu yang mempelajari lambung, usus, dan yg terkait denganstrukturtersebut.Dokterspesialisgastroenterology:. Latihan2 Pasangkanbagiankataberikutini a. anusataurectum 1. cheil/o b. gusi 2. col/o c. usus 3. dent/o d. ususbesar 4. enter/o e. mulut 5. gastr/o f. bibir 6. gingiv/o g. lambung 7. gloss/o h. gigi 8. lingu/o i. lidah 9. proct/o 10. stomat/o Jawaban Latihan1 1. mulut 2.Dibawahmulut 3.ahlipertumbuhantulangdanperkembangangigi 4.Nyeri 5.Gastroenterologist Orto=tulang Orto+odonto+ist Otrhopneu:pneu=nafas:Nyamanbernafaspadaposisitegaklurus(dudukorberdiri) Algia=dynia=nyeri Latihan2 1. F 2.D 3.H 4.C 5.G 6.B 7.I 8.I 9.A 10.E
Sarmoko, S. Farm.

Or/o,stomat/o Esophag/o Gastr/o Intestin/o,enter/o Duoden/o Jejun/o Ile/o Col/o Append/o,appendic/o Cec/o Proct/o Rect/o An/o

Esofagus Lambung Usus Duodenumbagiandariusushalus Jejunum Ileum Colon/ususbesar Appendixbagiandariususbesar Cecum Anus/rectum Rectum Anus

S i s t e m P e n c e r n a a n | 12

Organterkaitdenganpencernaan

Hepar, empedu, pancreas, kelenjar saliva


Menghasilkanbahanyangdibutuhkanuntukpencernaandanabsorbsizatmakanan. Heparmenghasilkanempeduygdigunakanusushalusuntukabsorpsilemak. Cholestatik:terjadi penyumbatan aliran empedu(kemungkinan terjadiobstruksi/penyempitan saluranempedudisebutjaundice/sakitkuning Empedumasukkekandungmepedudandisimpan batuempedudapatterbentukdalamkandungempedu Inflamasidanmembengkakperludihilangkancholecystomy Cholelithiasis Cholelithiasis:keadaandimanaditemukanbatuempedudikandungempedu Cysto(digabungdengannamaorganlain):kandung..(kandungorgantsb) Cysto(berdirisendiri):kandungkemih Cystisis:infeksi/inflamasikandungkemih

Pankreas
Kelenjarpancreasmerupakankelenjarendokrindaneksokrin Endokrin:sekresihormonyaituinsulinygmengaturkadarguladarah Eksokrin:sekresienzimyaitugetahpankreatikuntukpencernaanmakanan Penurunansekresiinsulindiabetesmellitus Diabetesmellitus:terjadihiperglikemia Bisakarenakekuranganinsulin,resistensiinsulinataukekurangantrasporterinsulin. CiriciriDM: Polifagibanyakmakan Polidipsibanyakminum Poliuriabanyakmengeluarkanurin Hyperglycemia(hyper:meningkat,+glyc/o:gula,+emia:darah) Peningkatan kadar gula darah sehingga glukosa yg seharusnya direabsorpsi di tubulus ginjal ada yg keluar bersama urin krn glukosa hidrofil, akibatnya banyak urin yg keluar danpenderitaselaluinginminum Tes gula darah : diberi beban glukosa 75 mg/dL dalam 250 dL air dipuasakan 2 jam diambildarahsaatpuasanormal<126mg/dL Setelahmakan(postprandial)normal<200mg/dL Outputurinemeningkat Polyuria(poly:banyak,+ur/o:urin,+ia:keadaan) Glycosuria(glycos/o:gula,+ur/o,+ia) Dysfungsipancreaslainproduksiinsulinterlalubanyakhypoglicemia Kelenjarsalivaberadadironggamulut Salivadihasilkanolehkelenjarmengandungamylase(amyl/o:pati,+ase:enzyme)

Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 13

Bagiankataterkaitdenganorgantambahanpencernaan Bagiankata Arti Kandungempedu Cholescys/o Hepar Hepat/o Pancreas Pancreat/o Kelenjarsaliva Sial/o Empedu Bil/I,chol/e Mucus Muc/o Nafsumakan orexia Mencerna pepsia Peritoneum/ronggaperut Periton/o Latihan3 1. Terjadinya inflamasi pada appendix, perlu dihilangkan. Kata yg berarti menghilangkan appendix(appendectomy) 2. Kata yang menunjukkan penyakir hepar kronis yg ditandai dengan degenerasi sel hepar (Cyrosis) 3. Empedudihasilkanolehhepar,tetapidisimpandi(cholecysto) 4. Cholangitismerupakaninflamasi(saluranempedu) 5. Inflamasikandungempedudisebut(cholecystisis) 6. Cholelithiasismerupakankeadaanditemukannya(batuempedu)dikandungempedu 7. Batubisajugaterbentukdipancreas.Kataygberartibatupancreas(pankreolithiasis) 8. Eksisibatupancreasdisebut(pancreolithectomy) 9. Saliva diproduksi oleh kelenjar saliva. Sialography adalah pemeriksaan XRay (pada kelenjarsaliva,sialo:kelenjarsaliva) 10. Eupepsia berarti pencernaan yg baik/normal, dyspepsia berarti (eu : normal, dys : gangguan.Dyspepsia:gangguanpadapencernaan) Kataygterkaitdenganprosedurbedah appendectomy =append/o:appendix,+ectomy:eksisi cholecystectomy =cholecyst/o:kandungempedu colostomy =col/o:colon,+stomy:buatan gastrectomy =gastr/o:lambung menghilangkansemuaatausebagianlambung(dipotong) pemotongandibagianantrumantrectomy penyambungan lambung yg sudah dipotong dg duodenum gastroduodenostomy (pemotonganantaralambungdanduodenum) penyambunganlambungygsudahdipotongdengandgjejunumgastrojejunestomy (pemotonganantaralambungdanusushalus) vagostomy pemotongan pada hervus vagus di lambung yg merupakan penghasil asamlambungsehinggasekresiasammenurun. Mulut Cheilitis =cheil/o:bibir,+itis:inflamasi Gingivitis =gingiv/o:gusi Glossitis =gloss/o:lidah Stomatitis =stomat/o:mulut
Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 14

Esophagus Dysphagia =dys:nyeri/sulit,phag/o:makan,+ia:keadaan Sulitmakan/menelan Esophagitis =esophag/o:esophagus Inflamasipadaesophagus Lambung Gastritis =gastr/o:lambung Gastrocele =cele:hernia Penurunanlambung Hernia:terjadiperubahanpadaorgantsb(belumtentuturun) Prolapsuteri:penurunanrahim Benignprostatehyperplasiabukanmerupakanhernia Enchephalocele:herniaotakperubahanposisiotak Bisaterjadikarenagumpalandarahygmendesakposisiotak Hematomahemat/o:darah,+oma:tumorjinak/benjolan Gastroenteritis =enter/o:usus Gastroscopy =scopy:pemeriksaanvisual(dgfiberygdimasukkankedalamlambung) Ulcer =lesimembranmukosa Usus Appendicitis =append/o:appendix,+itis:inflamasi(inflamasiappendix) Colitis =col/o:colon Diverticulitis =diverticul/o:diverticulum/tonjolan2padaususbesar Diverticulosis =keadaan/prosesterbentuknyadiverticulum Duodenalulcer =adanyaulkuspadaduodenum Duodenitis =inflamasipadaduodenum Enterostatis =enter/o:usus,+statis:menghentikan Terjadipenyumbatanpadaususkarenaobstruksi/penyempitan Proctoscopy =proct/o:anus Sigmoidoscopy =pemeriksaancolonsigmoiddengansigmoidoscope Pemeriksaanvisualpadasigmoidcolon Kandungempedu Cholecystisis =cholecyst/o:kandungempedu Cholecystography =graphy:rekaman Cholelithiasis =chol/e:empedu,+lith:batu,+iasis:keadaan Cholestasis =stasis:menghentikan Terjadijaundice/penyakitkuning Hepar Cirrhosis =penyakitheparkronisygditandaidgdegenerasiselhepar Hepatitis =hepat/o:hepar Hepatomegaly =megaly:pembesaran Dysfagiamerupakangjalautamapenyakitesofagus Pirosis adalah gejala penyakit esofagus yg lain (piro : panas, rasanya panas seperti terbakar) Odinofagia dapat disebabkan oleh spasme esofagus yg diakibatkan oleh peregangan akut (odinofagia:nyeriesofagus)
Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 15

Esofagoskopimerupakantindakanpentingpdgangguanesofagus Terdapat2jenisherniahiatus,yaituslidingherniahiatusdanherniahiatusparaesofageal (para: disekitar/menyerupai, hernia hiatus disekitar esofagus). Diagnosis dapat ditegakkan denganradiogramdanendoskopi Paranasal:disekitarhidung Paratyphus:menyerupaityphus

Gambarherniahiatus

Stenosis pylorus atau pilorospasme terjadi bila serat otot disekelilingnya mengalami hipertrofi/perkembanganygberlebihan Gejala perdarahan massif pada tukak peptic dapat mengakibatkan hiperemesis. Anoreksia merupakangejalaygseringtimbul Penderita tukak peptic yg tidka memberikan respon terhadap terapi medik atau mengalami komplikasi dapat dilakukan vagotomy atau gastrostomy (tidak dilakukan eksisi). Untuk mencegah retensi lambung karena vagotomy dapat dilakukan gastrojejunostomyataupiloroplasty(perbaikanpadapiloruslambung) Setelah dilakukan gastrectomy parsial, kontinuitas diperbaiki dengan gastroduodenostomyataugastrojejunostomy Gambarvagotomy

Sarmoko, S. Farm.

S i s t e m P e n c e r n a a n | 16

Gambargastrectomy

Gambargastroduodenostomy

Gambargastrojejunostomy

Malabsorpsi berbeda dengan maldigesti. Penyakit celiac pd anak2 merupakan penyebab terpenting dari malabsorpsi pd anak. Penyakit ini ditandai oleh atrofi vili usus halusbagianproksimal. Divertikulosis merupakan keadaan colon yang ditandai herniasi mukosa membentuk kantongsepertibotol,dandapatterjadidiverculitis.

Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 17

3
TerminologiMedis SistemPernafasan
Di sampaikan oleh: Dra. Tri Murti Andyani, Apt., SpFRS Rabu, 17 September 2008 Diketik oleh: TIM PSC angkatan 2003, di Edit oleh Sarmoko

Respirasidanfungsirespirasi Yaitu: aktivitas beberapa proses yang menyediakan oksigen ke semua sel tubuh dan mengeluarkankarbondioksida. Homeostasis(home/o:keseimbangan,+stasis:mengontrol) Keadaanequilibriumlingkungantubuhinternal. Bernafasinspirasi(in:masuk,+spir/o:bernafas)memasukkanO2 Expirasi(ex:keluar)mengeluarkanCO2 Dyspnea(dys:sulit/nyeri,+pneu:bernafas)sesaknafas/sulitbernafas Apneu(a:tanpa)tidakbernafas/gagalnafas(bukanberartisudahmati) Butuhventilasimekanikventilatoruntukmembantupernafasanpasien Orthopnea(ortho:lurus) Keadaan dimana bernafas tidak nyaman pd semua posisi kecuali duduk tegak atau berdiri Respirasinormal:1216/menit Bradypnea(brady:lambat)pernafasanyanglambat Tachypnea(tachy:cepat)pernafasanyangcepat Hyperpnea(hyper:lebihdarinormal) Peningkatankecepatanrespirasi,pernafasanlebihdalamdarinormal. Spirometer(spir/o:bernafas,+metry:pengukuran) Alat untuk mengukur pernafasan, sehingga bisa diketahui berapa kapasitas vital dari paruparudanberapaudarayangdihembuskan. Parametertingkatkeparahanasma FEP =

FEV1 FVC

Untuk mengetahui/mengukur FEV1 caranya, tarik nafas dalamdalam, kemudian hembuskan! 80%kapasitasparubisadihembuskandenganspirometer FEV1berkurangjikaadagangguannafas/paru Kapasitasvital:volumeterbesaryangdapatdikeluarkansetelahinspirasimaksimum Kapasitasvitalmenuruntandamenurunnyafungsijaringanparu Ketidakmampuanparusebagaifungsiventilasi(acuterespiratoryfailure) Hypoxia(hypo:kurangdarinormal,ox/o:oksigen)kekuranganO2dalamjaringan Hypoxemia kadar O2 dalam darah rendah (kekurangan O2 dalam darah) belum tentu terjadihypoxia Padahypoxiadanhypoxemiaperluventilatoruntukmembantupernafasan Anoxia(an:tidakada) Ventilator(respirasibuatan)untukgagalnafas
Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 18
Bagiankataterkaitdenganrespirasi Bagiankata Arti Keseimbangan Home/o Oksigen Ox/o Bernafas pnea Untukbernafas Spir/o Alveol/o Alveolus Bronch/o,bronchi/o Bronchi Bronchiol/o Bronchiole Laryng/o Larynx Phren/o Diaphragm Pleur/o Pleuro(daripleura:lapisanpelindungdiparuparu) Nas/o,rhin/o Hidung Pharyng/o Pharynx Pneum/o,pneumon/o Paruparu,udara Thorac/o Dada Trache/o Trachea Pulm/o,pulmon/o Paruparu Gambar

Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 19

Padalarynxterdapatpitasuara Diafragmaikutmembantudalampernafasanbaikinspirasimaupunekspirasi
Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 20
Latihan1 Isilahtitiktitikdibawahini. 1. Bronchopneumoniamerupakaninflamasi....................dan...................... 2. Inflamasilarynxdisebut. 3. Laryngitisdapatmengakibatkantidakadanyasuarayangdisebut. 4. Dysphoniaberartikesulitanbicaraataulemahnya.. 5. Laryngitisdapatmenyebabkanrasanyeri.Laryngalgiaadalahpadalarynx Latihan2 Apaartiistilahberikut 1. aphonia : 2. bronchoscopy : 3. paranasal : 4. pharyngeal : 5. pneumocardial :.. 6. pleuritis/pleurisy :.. 7. pneumonia :. Istilahyangterkaitdenganprosedurpembedahan bronchoscopy(scopy:melihat) rhinoplasty(rhin/o:hidung,+plasty:memperbaikidenganpembedahan) thoracocentesis(thorac/o:dada,+centesis:menusuk/mengambilcairan) adacairandilapisanpleurasehinggadilakukanpleurocentesis(efusipleura) tracheostomy(trache/o:trakea,+stomy:lubangbuatan) endotrachealtubedihubungkandenganventilator tracheotomy(tomy:mengiris)agartidakterjadilubang

Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 21

Penyakit,gangguandanistilahdiagnostik asthma :dyspneaparoxysmalyangdisertaiwheezing terjadi kesulitan bernafas yang berulang disertai wheezing karena terjadi sumbatan saluranpernafasan. Paroxysmal :berulang Wheezing :suaraberisikdiparuparu Atelectasis(atel:tidaksempurna,ectasis:pelebaran)pelebarantidaksempurna Pada penyakit yang terkait dengan paruparu, paruparu belum berkembang dengan sempurna,terjadikarenaalveolimasihelastis. Cth : respiratory distress syndrome (RDS) pada anak lahir premature terjadi atelectasis karena produksi surfaktan belum memadai sehingga perkembangan paru belum sempurna. Surfaktandiproduksipadausiakehamilan3437mingguagarparusiapdigunakanuntuk bernafas. Untuk mematangkan paru, agar pembentukan paruparu sempurna dilakukan penundaan kelahiran dengan diberi tokolitik untuk relaksasi uterus yaitu salbutamol ataudexametasondosisrendahsehinggaresikokelahiranprematuredapardicegah. Kalaubayinyasudahlahir,pernafasandibantudenganventilatorataudiberisurfaktan. COPD:chronicobstructivepulmonarydisease(penyakitparuobstruksikronis/PPOK) Prosespenyakityangmenurunkankemampuanparusebagaifungsiventilasi. Emphysema:penyakitparukronisyangditandaipeningkatanukuranalveolidandgkerusakan dindingalveoluskesulitanbernafas Pneumoconiosis(pneum/o:paru,+coni/o:debu,+osis:keadaan/gangguan) Gangguanpadaparukarenadebu(padaparuterdapatbanyakpartikeldebu) Tuberculosis:penyakitinfeksiyangdisebabkanolehMycobacteriumtuberculosis Bronchiectasis(ectasis:pelebaran/dilatasi)pelebaranpadabronkus Angioectasis(angi/o:pembuluhdarah)dilatasipembuluhdarah/vasodilatasi Bagiankatatambahan Bagiankata Arti Tidaksempurna Atel/o Debu Coni/o Lobus Lob/o Kecil ole silika Silic/o
Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 22
Latihan3 Jodohkan 1. Bedahplastikhidung 2. Surgicalpunctureruangdadauntukmenghilangkancairan 3. Insisitracheamelaluileher 4. PemeriksaanXraypadabronchus 5. Pemeriksaanvisualcabangtracheobronchial

a. b. c. d. e. f.

wheeze bronchography bronchoscopy rhinoplasty thoracocentesis tracheostomy

Catetanlagiyukkkk Proses yang merusak kesinambungan pembuluh darah paru dapat menyebabkan hemoptisis (hem/o:darah,ptisis:batuk)batukdarahkarenaadaperlukaanpadapembuluhdarah gejalautamadaripenyakitkardiopulmoneradalahdyspnea dyspnea biasanya dikaitkan dg meningkatnya resistensi elastic paruparu (pneumonia, atelsectasis)ataunonelastic(emphysema,bronchitis,asthma) adaberbagaipenyebabnyeridadaantaralainpleuritis tanda2 pertukaran gas yang kurang memadai antara lain sianosis, hipoksemia dan hipoksia,hiperkapneadanhipokapnea. Sianosis:kebiruanpadakulit/jaringan Hipoksemia : kekurangan O2 pada darah, dilihat dari nilai Hb Hb tinggi (dengan analisis gasdarahbisadilihatnilaiPaO2,pHdarah,paCO2) PaO2:tekananparsialO2padapembuluhdarah(normal8095mmHg) HipoksemiaPaO2rendah(<80mmHg) JikaPaO2rendahO2gakbisakeluarmenujujaringanjaringankekuranganO2 terjadisianosis pHdarahnormal7,357,45 PaCO2:tekananparsialCO2padapembuluhdarah(normal3545mmHg) Bisadiketahuikemampuanventilasipasien(adagangguanataugak) Pada PPOK nilai Pa CO2 tinggi terjadi hypercapnea Pa CO2 > 45 mmHg terjadi hiperventilasi CO2 keluar ke alveolus bahaya, coz akan berpengaruh padapHdarah ProduksiCO2seharusnyaseimbangdgCO2yangdikeluarkan HypocapneaterjadikaloPaCO2rendah(<35mmHg) Pa CO2 merupakan parameter adanya gangguan ventilasi terjadi hypo/hypercapnea PPOK dapat disebabkan karena bronchitis kronik, emphysema paruparu dan asma bronchial Gejalautamabronchitiskronisprosuksimucusberlebihan Bronchiectasis timbul apabila dinding bronchus melemah akibat peradangan kronik pada mukosasertalapisanotot. Bronchiectasis : pelebaran pada bronchus (terjadi kerusakan pada bronchus coz mengalamiinflamasisehinggaototbronchusmelemah) Pada pasien dg cystic fibrosis bisa terjadi inflamasi bronchus sehingga tjd bronchoectasis yangsifatnyapermanent Efusi pleura dapat berupa hidrotoraks, sedangkan hemotoraks tidak digunakan untuk menyatakanefusipleurayangberdarah. Hidrotoraks:terjadipenimbunancairandalamtoraks Pneumotoraksdapatdisebabkankarenatraumatic,spontanatauterapetik.
Sarmoko, S. Farm.

S i s t e m P e r n a f a s a n | 23
Pneumotoraks:adanyaudarapadalapisanpleura Pneumokoniosisdanasbestosisseringdikaitkandenganpenyakitakibatkerja. Pneumoconiosis:adapartikelkecildipleura Asbestosis:partikelkecilberupaasbes

Jawaban Latihan1 1. parudanbronchus 2. laryngitis 3. aphonia 4. kemampuanbicara(kesulitanmengeluarkansuara) 5. sakit Latihan2 1. aphonia :tidakbisamengeluarkansuara 2. bronchoscopy :pemeriksaanbronchus 3. paranasal :deiekitarhidung 4. pharyngeal :terkaitdenganpharynx 5. pneumocardial :terkaitdenganparudanjantung 6. pleuritis/pleurisy :inflamasipadapleura 7. pneumonia :inflamasipadaparu Latihan3 1. D 2.E 3.F 4.B 4.C

Sarmoko, S. Farm.

S i s t e m U r i n e r | 25

4
TerminologiMedis SistemUriner

Di sampaikan oleh: Dra. Tri Murti Andyani, Apt., SpFRS Rabu, 23 Oktober 2008 Diketik oleh: TIM PSC angkatan 2003, di Edit oleh Sarmoko

Tubuhmenghasilkansampahyangdieliminasidenganprosesekskresi 1. Paruparukarbondioksida 2. Sistempencernaansampahpadat 3. Kulitperspirasi 4. Urinasiginjal,ureter,kandungkemihdanurethra(sistemuriner) Fungsiginjal: 1. Reabsorbsiprotein,glukosa 2. Ekskresisampahmetabolisme 3. Metabolisme 4. Mensekresientropoetinyangmenstimulasitulanguntukmemproduksieritrosit

ELIMINASI SAMPAH OLEH GINJAL


Urea (ur/o : urine) produk akhir metabolisme protein. Urea merupakan sampah nitrogen yangterdapatdiurin. Uremiaterdapatureadalamdarah. Hematuria terdapat darah dalam urin, karena terjadi inflamasi pada membran basal glomerulus. Hemodialisis(hem/o:darah) Peritonealdialisis(periton/o:peritoneum,+eal:terkait) Insufficiencyrenal(in:tidak)penurunankemampuanginjaldalammenjalankanfungsinya. Insufficiencyrenalbelumspesifik,belumterjadigagalginjal. Kaloudahberat,dilakukanhemodialisis dengan bantuan mekanik/mesinuntukdifusi sampah di tubuh. Selama hemodialisis terjadi pertukaran zat organik/elektrolit dari dalam darah dengan larutan dialisis berdasarkan perbedaan kadar yang berdifusi melalui membran permeabel. Hemodialisisdilakukanpada: Gagal ginjal terminal yang tidak bisa sembuh, tapi malah memburuk. Yaitu dengan nilai GFR(lajufiltrasiglomerulus)<15ml/menit. Gagal ginjal akut yang masih bisa sembuh/membaik. Hemodialisis dilakukan untuk membantu mengeluarkan sampah metabolisme, setelah ginjal membaik tidak dilakukan hemodialisislagi.
Sarmoko, S. Farm.

S i s t e m U r i n e r | 26

Gambarhemodialisis

Peritoneal dialysis (CAPD) dilakukan melalui membran peritoneal. Terjadi difusi zatzat dalam darahdenganlarutandialisis. Gambarperitonealdialisis

Peritoneal dialysis. A semipermeable membrane richly supplied with small blood vessels lines the peritoneal cavity. With dialysate dwelling in the peritoneal cavity, waste products diffuse from the network of blood vessels intothedialysate.

Urology(ur/o:urinatausaluranurin,+logy:ilmupengetahuan) Yaitu cabang ilmu kedokteran yang mempelajari tractus genitalia pria, tractus uriner wanita danpria. Urologist:orangyangahlidibidangurology
Sarmoko, S. Farm.

S i s t e m U r i n e r | 27

Bagiankatayangterkaitstruktursistemuriner Bentukkombinasi Namastrukturtubuh Kandungkemih Cyst/o Glomerulus Glomerul/o Ginjal Nephr/o,ren/o Pelvisginjal Pyel/o Ureter Ureter/o urethra Utethr/o Gambarsistemuriner

Gambarginjal

Sarmoko, S. Farm.

S i s t e m U r i n e r | 28

Dalam 1 ginjal terdapat 1 juta nefron yang dapat berfungsi dengan baik. Dengan 25% bagian dariginjalsaja,ginjaldapatberfungsidenganbaik/normal.
Sarmoko, S. Farm.

S i s t e m U r i n e r | 29

Didalamnefronterjadifiltrasizatorganikdanelektrolit,yaitupadabagianglomerulus. Adanya gangguan ginjal, dilihat dari nilai GFR, kadar serum kreatinin, dan BUN (blood urea nitrogen). Istilahterkaitdenganprosedurbedah Cystostomy(cyst/o:kandungkemih,+stomy:membuatlubangbaru) Lithotripsy(lith/o:batu,+tripsy:menghancurkan) Nephrolithotomy(nephr/o:ginjal,+tomy:insisi) Nephrostomy Pyelolithotomy(pyel/o:pelvisginjal) Pyelostomy Nephrolithiasis (batu ginjal) bisa dengan lithotripsy, yaitu batu ginjal dihancurkan, baru dikeluarkan dengan urin. Atau dengan nephrolithotomy, tergantung batu ginjalnya dimana. Kalodipelvisdisebutpyelolithotomy(pelvisdibedah). Penyakit,GangguandanIstilahDiagnosik Anuria(an:tanpa,+uria:urine)<100mlurine/hari Tidakmengeluarkanurin. Terjadipenurunanvolumeurine<100ml/hari Normalurinsekitar1,5L/hari Oliguria(oligos:sedikit) Terjadipenurunanvolumeurin100300ml/hari Cystisis(cyst/o:kandungkemih)inflamasipadakandungkemih Cystoceleherniapadakandungkemih(terjadipenurunanposisikandungkemih) Cystoscopypemeriksaanvisualpadakandungkemih Glomerulonephritis (glomerul/o : glomerulus, nephr/o : ginjal) inflamasi pada glomerulus ginjal Neprolithiasis(lith/o:batu,+iasis:keadaan)keadaandimanaterdapatbatuginjal Nephromalacia(malacia:pelunakan)pelunakanpadaginjal Nephromegalyterjadiperbesaranginjal Nephroptosisposisiginjalturun Nephrosis kerusakan pada ginjal, gangguan pada ginjal yang bukan disebabkan oleh inflamasi Gambarnephrolithotomy,pyolithotomy&lithotripsy

Sarmoko, S. Farm.

S i s t e m U r i n e r | 30

Gambarcystocele

Pyelitis(pyel/o:pelvisginjal)inflamasipdpelvis Pyuria(py/o:pus/nanah,+uria:urine)ditemukanpusdalamurin Urinaryincontinence(in:tidak)ketidakmampuanuntukmenahanurindikandungkemih Terjadipadageriatrik Terjadikemunduranfungsiototototdikandungkemih Urinaryretentionketidakmampuanuntukmengosongkankandungkemih URINE Urinalysis:pemeriksaanspesimenurindengantestlaboratorium Urinenormaltanpagula,protein,darah Urineabnormal: Glycosuria(mengandunggula) Proteinuria(mengandungprotein) Hematuria(mengandungdarah) Urinalisisdilakukanuntukpemeriksaanadanyagangguanpadaginjal
Sarmoko, S. Farm.

S i s t e m U r i n e r | 31

Caranya: Urinditampungselama24jam dianalisispH,selyangikutkeluar,proteinyangikutkeluar(proteinuria),glukosayangikut keluar(glukosuria) normalnya,asamamino(protein)danglukosadireabsorpsiditubulusproximal utkmengetahuikadarproteindalamurindilihatpadarekammedisdutinjukkandengan tanda+,++,+++(Tanda+berarti100mg/dl) Jika kadar protein yang keluar bersama urin > 3 gram disebut macroalbuminuria, yang mengindikasikan terjadi gangguan berupa kerusakan/inflamasi pada membran basal glomerulus. Jikakadarproteinyangkeluarbersamaurine<3gramdisebutmicroalbuminuria Pada pasien gagal ginjal, gejala yang kelihatan adalah udem karena pada gagal ginjal terjadi hipoproteinemia (kadar protein rendah) dimana tekanan osmosisnya rendah dan terjadi penumpukancairan(udem). Parametergangguanginjal: Udem Anuria Polyuria Jikafungsiginjalturun,akanterjadigangguandalammenjagakeseimbanganelektrolit. Adanya kerusakan membran glomerulus akan menyebabkan terjadinya hematuria (darah keluarbersamaurin). Bentukkombinasitambahan Bagiankata Arti Albumin Albumin/o Darah Hemat/o,hem/o,emia Peritoneum(dindingperut) Periton/o Suara Son/o Urineatautractusuriner Ur/o Urine Urin/o Urineatauurinasi uria LATIHAN1 Isilahtitiktikberikut. 1. Duabentukkombinasiyangberartiginjal: 2. Nephromegalyberarti.................................darisatuataukeduaginjalnya 3. Bentukkombinasidaripelvisrenal:.. 4. Pyelogramberarti:..................................................................................... 5. Inflamasidaripelvisrenal: 6. Cysticmempunyaiarti: 7. Alatyangdigunakanuntukcystoscopydisebut:.. 8. Pembedahanuntukmemperbaikiureterdisebut:.. 9. Istilahyangmenyatakanadanyasampahnitrogendidarahdisebut:.....
Sarmoko, S. Farm.

S i s t e m U r i n e r | 32

10. Istilahmedikyangmenyatakanadanyadarahdalamurin:. LATIHAN2 Pasangkanlahbentukkombinasidibawahini A. Ginjal 1. Cyst/o B. Kandungkemih 2. Nephr/o C. Urethra 3. Pyel/o D. Ureter 4. Ren/o E. Pelvisginjal 5. Ureter/o 6. Urethr/o LATIHAN3 Tulislahartidariistilahmedisberikutini 1. Cystisis:.. 2. Glomerulonephritis: 3. Polycysticginjal:. 4. Pyelitis:.. 5. Pyuria: 6. Nephromalacia:. 7. Lithotrite:...................................................................... 8. Nephrosonography:. 9. Renal: 10. Cystourethrogram: LATIHAN4 Berikanlahgarisbawahpadajawabanyangbenar 1. Ketidakmampuan untuk mengosongkan kandung kemih disebut (cystisis, inkontinensia, retensiurine,infeksisalurankemih) 2. Tidakadanyaurinasi(anuria,diuresis,pyuria,polyuria) 3. Pemeriksaan dalam kandung kemih menggunakan instrumen khusus melalui urethra (cathetherisasi,cystoscopy,cystostomy,urethrogram) 4. Keadaan degeneratif pada ginjal yang tidak diikuti inflamasi disebut (nephritis, nephromegaly,nephrosis,nephrostomy) 5. Rekaman Xray saluran urin setelah injeksi bahan radioaktif disebut intravena (nephroptosis,nephrosonogram,nephrotomogram,nephrolithotomy) 6. Pembedahan untuk menghancurkan batu (lithotriptor, lithotomy, lithotripsy, nephrolithotomy) 7. Suatu cara untuk membuat lubang ke dalam pelvis ginjal (nephropexy, nephroptosis, nephrostomy,biopsyginjalpc) 8. Padapyelolithotomy,batudihilangkandari(kandungkemih,pelvisginjal,ureter,urethra)

Sarmoko, S. Farm.

S i s t e m U r i n e r | 33

Jawaban: LATIHAN1 1. nephro&rhino 2. pembesaran 3. pyel/o 4. hasilpemeriksaanpelvisginjal 5. pyelitis 6. adanyakantong2berisicairan 7. cystoscope 8. ureteroplasty 9. uremia,azotemia 10. hematuria Pembedahanmelaluidindingperut: a. Laparotomy:mengirisdindingperutdengansayatanlebihluas b. Laparocopy:memotongappendixdengansayatanlebihkecil Azotemia:keadaanuremia Uremia:ureaikutbersirkulasidalamdarah Uremia=azotemia LATIHAN2 1. (B) 2. (A) 3. (E) 4. (A) 5. (D) 6. (C) LATIHAN3 1. Cystisis:inflamasipadakandungkemih 2. Glomerulonephritis:inflamasipadaglomerulus 3. Polycysticginjal:adanyakantong2bebrisicairanpadaginjal 4. Pyelitis:inflamasipdpelvis 5. Pyuria:pusdalamurine 6. Nephromalacia:pelunakanginjal 7. Lithotrite:alatuntukmenghancurkanbatuginjal 8. Nephrosonography:pemeriksaanginjaldengansuara 9. Renal:ginjal 10. Cystourethrogram:hasilpemeriksaankandungkemih&urethra LATIHAN4 1. inkontinensia 2. anuria, 3. cystoscopy.cathether=selang 4. nephrosis 5. 6. lithotripsy 7. nephrostomy. Note : nephropexy (pexy : pengembalian dengan cepat) = mengembalikanposisiginjaldengancepat 8. pelvisginjal
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 35

5
TerminologiMedis SistemReproduksi

Di sampaikan oleh: Dra. Tri Murti Andyani, Apt., SpFRS Rabu, 9 Oktober 2008 Diketik oleh: TIM PSC angkatan 2003, di Edit oleh Sarmoko

Sistemreproduksi Gonad(gon/o:genital/reproduksi) ovariumdantestis Genital berperandalamsekresihormondanproduksiselsperma/telur Organreproduksilakilaki,wanita,external,internal:genitalia Genitaliawanita Gynecology : studi penyakit pada organ reproduksi wanita (pengobatan gangguan reproduksi wanita) Susunanalatreproduksiwanita: Ovarium :memproduksiseltelur Uterin/tubafalopii :yangmembawaseltelurkeuterus Vagina :kanalmelahirkan Organeksternalyagdisebutvulva Sel telur diproduksi oleh ovarium ditransport melalui tuba falopii masuk ke uterus/rahim dibuahiolehsperma Gambaralatreproduksiwanita

Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 36

Urethra wanita lebih pendek daripada lakilaki, sehingga lebih rentan terkena infeksi (misal, padakasusISK) Uter/o:uterus Intrauterine:dalamuterus Extrauterine:diluaruterus Endometrium(endo:dalam,+metr/o:jaringanuterin,+ium:membran) Membranjaringanuterusbagiandalam Padakeadaannormal,endometriumtumbuh/terbentukdalamuterus. Tapi ada endometrium yang terbentuk/tumbuh di luar uterus disebut endometriosis (contohnyapadakandungkemih) Gejalaendometriosis saathaid/menstruasisangatnyeri/sakit Vaginalspeculumdigunakanuntukmemeriksavaginadancervix. Papsmear(papanicolaousmear) untukdeteksiawalkanker(kankercervix) Vaginal speculum dimasukkan ke dalam vagina untuk melihat adanya gangguan dalam saluranreproduksi. Pap smear dilakukan pada wanita usia > 30 tahun dan sebelumnya diperiksa dengan vaginalspeculumdulu. Colpocervical (colp/o : vagina, +cervic/o : cervix, +cal : terkait) terkait dengan vagina dan cervix Menstruasi/menses(men/o:bulan) siklus:2140hari(1bulansekali) Keluarnya cairan tubuh dari uterus pada interval waktu teratur dari masa pubertas sampaimenopause. Pada saat menstruasi terjadi peluruhan dinding/jaringan endometrium yang diikuti pelepasanprostaglandinsehinggamenimbulkanrasanyeri. Amenorrhea(a:tanpa,+men/o:bulan,+rrhea:keluarnya) wanitayangtidakmenstruasi Terjadikarenaovariumtidakmemproduksiseltelur Atau ovarium mampu memproduksi sel telur, tetapi gangguan hormonal (kekuranganhormoneFSH/folliclestimulatinghormone)atauselteluryangdihasilkan tidakmatang(gangguanpematanganseltelur) untukkasusinibisadibantudengan diberihormondariluaruntukpematanganseltelur. Dysmenorrhea(dys:sulit,sakit,nyeri) mensesyangnyeri
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 37

Menorhhagia(rrhagia:pendarahan) Terjadi pendarahan saat menses (darah yang keluar berlebihan, lebih banyak dari biasanya) Metrorrhagia (metr/o : jaringan uterine) pendarahan dari uterus (tidak terkait menses), terjadipadalapisandalamuterustdkterjadisaatmenses Bagiankatayangterkaitsistemreproduksiwanita Bagiankata Arti Cervix Cervic/o Vagina Colp/o,vagin/o Wanita Gynec/o Uterus Hyster/o,uter/o Payudara Mamm/o,mast/o Bulan Men/o Jaringanuterus Metr/o Ovarium Oophor/o,ovar/o Tubafalopii Salping/o vulva Vulv/o Istilahterkaitdenganprosedurbedahgenitaliawanita Colpoplasty(colp/o:vagina,+plasty:memperbaiki) bedahplastikpadavagina Dilasi&Curretage(D&C) Prosedur bedah dengan melebarkan pembukaan cervix sehingga dinding uterus bisa dicurret(aborsi). Dilasi:melebarkanpembukaandindingcervix Hysterectomy(hyster/o:uterus) eksisi/pengangkatanrahim Laparohysterectomy (lapar/o : dinding abdomen) pengambilan rahim melalui insisi pada dindingperut laparoscopy membuatlubangkeciluntukmemasukkanlaparoscope laparotomy insisidindingperut Salpingoectomy(salping/o:tubafalopii,+ectomy:eksisi) eksisitubafalopii salpingooophorectomy(oophor/o:ovarium) eksisitubafalopiidanovarium salphingorrhaphy(rrhaphy:menjahit) kalau yang diambil tuba falopii, ovarium, uterus disebut disebut hysterosalphingo oophorectomy(ampunDJ,susahamatsihistilahnya???Keritingnihyangngetik) Penyakit,gangguandanistilahdiagnostikterkaitgenitaliawanita colpitis(colp/o:vagina,=itis:inflamasi)=vaginitis inflamasipadavagina colpocervicitis:inflamasivaginasampaicervix colposcopy:pemeriksaanvisualpadavagina contraceptive(contra:melawan,konsepsi:kehamilan) Metodeuntukmencegahterjadinyakehamilan caranyamacammacam hormonal(pil,suntik,implant)dannonhormonal(IUD) Kalaumetodesterilisasiada2 TUBECTOMY(forwomen)&VASECTOMY(formen) Endometriosis(endo:dalam,+metr/i:jaringanuterus,+osis:keadaan) Endometritis inflamasipadaendometrium Hysteroptosis(hyster/o:uterus,+ptosis:merosot)=prolapsuteri rahimmerosot
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 38

Oophoritis(oophor/o:ovarium) inflamasipadaovarium Salpingitis(salphing/o:tubafalopii) Oophorosalpingitis inflamasipadatubafalopiidanovarium Obstetric Obstetric:cabangilmukedokteranspesialisperawatanwanitaselamahamildanmenyusui. Obstetrician orangyangahlidibidangobstetric Gestasi:hamil parturitas:melahirkan=natal Antepartum postpartum DMgestasional=DMyangterjadisaatkehamilan Untukmengetahuiriwayatkehamilan G3P3A0=gestasi3x(kehamilan3x) Partus3x(melahirkan3x) Abortus0 Unipara(uni:satu,+para:wanitayangbisamelahirkan) wanitayangmelahirkan1anak Bipara(bi:dua) Nullipara(nulli:tidak) wanitayanggakbisapunyaanak Primipara(primi:pertama) kelahiranyangpertama Prenatal(nat/i:kelahiran) sebelummelahirkan Postnatal sesudahmelahirkan Neonatus(neo:baru) bayibarulahirsampaiusia6minggu Pembagianusia: Neonatus(barulahirsampai6minggu) Bayi Pediatrik/anakanak Remaja(<18tahun) Dewasa(1865tahun) Usialanjut(>65tahun) Bagiankatayangterkaitdenganistilahobstetric Bagiankata Arti Amnion(membranfetus/ketuban) Amni/o Fetus Fet/o Kelahiran Nat/i Wanitayangdapatmelahirkan para Diluar Extra Genital/reproduksi Gon/o Dindingabdomen Lapar/o Rectum Rect/o Suara Son/o Racun Tox/o Tiga Tri Melebihiataudiatas Ultra Kandungkemih Vesic/o,cyst/o Note:Istilahbisadibalikbalikurutannya,contohnya Salphingooophorectomydanoophorosalphingoitis,bisadibolakbalik.Oke????
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 39

Genitaliapria Organreproduksipria: Testes menghasilkansperma Pembuluh/saluranuntuktransportsperma=vasdeferens Vas deferens membawa sperma dari testis ke vesicle disimpan sebelum dikeluarkan Vasectomy : vas deferens diikat (insisi, bukan eksisi) sehingga jumlah sperma yang mencapaivesiclesedikit tidakcukupuntukmembuahiseltelur Kelenjaryangmemproduksicairan=kelenjarprostat Penis Testes memproduksispermadanhormon(testosterone) Ductusdeferens(vasdeferens) membawaspermadaritesteskeurethra Seminalvesicles(semin/o:semen) tempatmenyimpansemensampaidikeluarkan Spermatogenesis(spermat/o:sperma,genesis:produksi) Bagiankatayangterkaitorganreproduksipria Bagiankata Arti Contoh Arti Orchi/o,orchid/o Testis Anorchism Tanpatestis Test/o,testic/o Testis Testicular Yang berhubungan dengan testis Pen/o Penis Prostat/o Prostat prostatometer instrumentformeasuringthe prostate Scrot/o,osche/o Skrotum oscheoma tumorofthescrotum Semin/o semen Inseminate to introduce semen into a woman Spermat/o Sperma oligospermia deficiencyofspermatozoa Urethr/o Urethra Vas/o vas deferens, vasorrhaphy sutureofthevasdeferens alsovessel Epydidim/o epididymis epididymitis inflammationoftheepididymis vesicul/o seminalvesicle vesiculography radiographicstudyofthe seminalvesicles

Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 40

Gambarorganreproduksipria

Istilahterkaitprosedurpembedahanpadagenitaliapria Circumcision : tindakan dengan menghilangkan kulit khatan yang melindungi kepala penis = sunat/khitan Orchidectomy(orchid/o:testes,+ectomy:eksisi) eksisitestis Orchidoplasty pembedahanuntukperbaikantestis Orchidopexy (pexy : fiksasi/pengembalian ke posisi semula) pengembalian testis ke posisi semuladengancepat Transurethralprostatectomy(trans:melalui,+urethr/o:urethra) (TURP) = transurethral resection (TUR) menghilangkan/eksisi bagian dari kelenjar prostat melaluiinsisipadaurethral TURP pembedahanpadapriayangterkenaBPH BPH = Benigh Prostate Hyperplacia hyperplasia/pembesaran kelenjar prostat (terjadi pada priausia>70tahun) GejalaBPH: Sulitmengeluarkankemih/urin bisakomplikasikeginjal Kalaukencingsakit,kadangbisaberdarah BPH kalau belum berat, bisa diterapi dengan obat. Tapi kalau sudah berat diatasi dengan operasiTURP Vasectomy(vas/o:vasdeferens,+ectomy:eksisi) eksisivasdeferens Vasoplasty (vas/o : vas deferens, +plasty : memperbaiki dengan pembedahan): memperbaiki vasdefernsdenganpembedahan Vasorrhapy(vas/o:vasdeferens,+rrhapy:menjahit):menjahitvasdeferens Vasostomy(vas/o:vasdeferens,+stomy:formasimembuka):membukavasdeferens.
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 41

FIGURE 1. Male genitourinary system. The arrows indicate the course of sperm cells through theductsystem. GambarTURP

Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 42

FIGURE 2. Prostate surgery procedures. (A) Transurethral resection of the prostate (TURP). Portionsoftheprostateareremovedatthebladderopening.(B)Transurethralincisionofthe prostate (TUIP). One or two incisions are made in the prostate to reduce pressure on the urethra. SOALSOAL Defineeachofthefollowingwords: 1. seminal __________________________________ 2. testopathy __________________________________ 3. orchialgia __________________________________ 4. epididymectomy __________________________________ 5. prostatic __________________________________ 6. oscheal __________________________________ 7. orchiepididymitis __________________________________ Usetherootorchi/otowriteawordthathasthesamemeaningaseachofthefollowing definitions. 8. surgicalfixationofatestis__________________________________ 9. plasticrepairofatestis__________________________________ 10. incisionofatestis__________________________________ Usetherootspermat/otowriteawordthathasthesamemeaningaseachofthefollowing definitions: 11. aspermformingcell__________________________________ 12. destruction(lysis)ofsperm__________________________________ 13. formation(genesis)ofspermatozoa__________________________________ 14. excessivedischarge(rhea)ofsemen__________________________________ 15. conditionofhavingspermintheurine(uria) __________________________________ Theendingspermiameansconditionofspermorsemen.Addaprefixtospermiato formawordthathasthesamemeaningaseachofthefollowingdefinitions: 16. presenceofbloodinthesemen__________________________________ 17. presenceofpusinthesemen__________________________________ 18. lackofsemen__________________________________ 19. secretionofexcess(poly)semen__________________________________ Writeawordthathasthesamemeaningaseachofthefollowingdefinitions: 20. inflammationofaseminalvesicle__________________________________ 21. excisionofthevasdeferens__________________________________ 22. plasticrepairofthescrotum__________________________________ 23. excisionoftheprostategland__________________________________ 24. radiograph(xray)ofaseminalvesicle__________________________________ 25. surgicalcreationofanopeninginthevasdeferens __________________________________ 26. incisionoftheepididymis__________________________________
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 43

Jawaban: 1. pertainingtosemen(terkaitdengansemen) 2. penyakitpadatestis 3. nyeripadatestis 4. eksisiepidedimis 5. pertainingtoprostat 6. pertainingtoskrotum 7. inflamasipadatestisdanepidedimis 8. orchiopexy 9. orchioplasty 10. orchiotomy 11. spermatocyte 12. spermatolysis 13. spermatogenesis 14. spermatorrhea 15. spermaturia 16. hemospermiaorhematospermia 17. pyospermia 18. aspermia 19. polyspermia 20. vesiculoitis 21. vasectomy 22. oscheoplastyorscrotoplasty 23. prostoectomy 24. vesiculogram 25. vasostomy 26. epididimotomy

ChapterReview51
Matchthefollowingtermsandwritetheappropriatelettertotheleftofeachnumber: _____1.gonad a.coiledtubeonthesurfaceofthetestis _____2.glans b.anymalesexhormone _____3.epididymis c.glandlocatedbelowthebladderinthemale _____4.Androgen d.endofthepenis _____5.prostate e.sexgland _____6.FSH a.excisionoftheductusdeferens _____7.anorchism b.pituitaryhormoneactiveinreproduction _____8.oligospermia c.tumorofthescrotum _____9.vasectomy d.deficiencyofspermatozoa _____10.oscheoma e.absenceofatestis SUPPLEMENTARYTERMS _____11.emission a.narrowingoftheforeskinopening _____12.balanitis b.inflammationoftheglanspenis _____13.hydrocele c.tumorofthetestis _____14.phimosis d.dischargeofsemen _____15.seminoma e.accumulationoffluidinasaclikecavity
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 44

_____16.insemination a.epididymalcyst _____17.coitus b.introductionofsemenintoawomansvagina _____18.genitalia c.sexualintercourse _____19.spermaticcord d.organsofreproduction _____20.spermatocele e.structurethatsuspendsthetestis Fillintheblanks: 21.Thecommonpassageforurineandsemeninthemaleisthe __________________________________. 22.Themalegonadisthe__________________________________. 23.Thesacthatholdsthetestisisthe__________________________________. 24.Thethickfluidthattransportsspermatozoais__________________________________. 25.Themainmalesexhormoneis__________________________________. 26.Orchitisisinflammationofthe__________________________________. 27.orchialgia__________________________________ 28.hemospermia__________________________________ 29.prostatometer__________________________________ 30.vesiculotomy__________________________________ Wordbuilding.Writeawordforeachofthefollowingdefinitions: 31.surgicalcreationofanopeningbetweentwopartsofacut ductusdeferens(donetoreverseavasectomy)__________________________________ 32.stoneinthescrotum__________________________________ 33.surgicalincisionoftheprostate__________________________________ 34.inflammationofaseminalvesicle__________________________________ 35.surgicalfixationofthetestis__________________________________ 36.plasticrepairofthescrotum__________________________________ Writetheadjectiveformofeachofthefollowingwords: 37.semen__________________________________ 38.prostate__________________________________ 39.penis__________________________________ 40.urethra__________________________________ 41.scrotum__________________________________ Wordanalysis.Defineeachofthefollowingwords,andgivethemeaningofthewordparts ineach.Useadictionaryifnecessary. 42.cryptorchidism__________________________________ a.crypt____________________ b.orchid/o____________________ c.ism____________________ 43.vasovesiculitis__________________________________ a.vas/o____________________ b.vesicul/o____________________ c.itis____________________
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 45

Jawaban: 1.e 2.d 3.a 4.b 5.c 6.b 7.e 8.d 9.a 10.c 11.d 12.b 13.e 14.a 15.c 16.b 17.c 18.d 19.e 20.a 21.urethra 22.testis 23.scrotum 24.semen 25.testosterone 26.testis 27.paininthetestis 28.presenceofbloodinthesemen 29.instrumentformeasuringtheprostate 30.incisionoftheseminalvesicle 31.vasovasostomy 32.oscheolith 33.prostatotomy 34.vesiculitis 35.orchiopexy 36.oscheoplasty 37.seminal 38.prostatic 39.penile 40.urethral 41.scrotal 42.sexuallytransmitteddisease 43.benignprostatichyperplasia(hypertrophy) 44.gonococcus 45.prostatespecificantigen 46.transurethralresectionoftheprostate 47.bladderneckobstruction 48.undescendedtestes a.hidden
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 46

b.testis c.conditionof 49.inflammationoftheductusdeferensandseminal vesicle a.vas(ductus)deferens b.seminalvesicle c.inflammation CASESTUDYQUESTIONS Multiplechoice:Selectthebestanswerandwritetheletterofyourchoicetotheleftof eachnumber. _____1.Thetermformalesterilizationsurgeryis: a.herniorrhaphy b.circumcision c.vagotomy d.vasectomy. e.vasovasotomy _____2.Anobliquesurgicalincisionfollowswhatdirection? a.slantedorangled b.superiortoinferior c.lateral d.circumferential e.elliptical _____3.Whentheendsofthevaswerecoagulatedwithelectrosurgery,theywere: a.probed b.dilated c.sealed d.sutured e.clamped _____4.Aurologistisaphysicianwhotreatshealthanddiseaseconditionsofthe: a.malereproductivesystem b.urinarysystem c.digestivesystem d.aandb e.bandc _____5.Apersonwithpainful,bloodtinged,scantyurinationwouldbedescribedwith: a.hematocrit,dyspnea,oliguria b.dystonia,hematuria,oliguria c.dysuria,hematuria,oliguria d.oliguria,hematogenesis,dystonia e.dyspnea,hematuria,polyuria _____6.Anothernamefortheforeskinisthe: a.prepuce b.phimosis c.phallus
Sarmoko, S. Farm.

S i s t e m R e p r o d u k s i | 47

d.glans e.balan _____7.Thecircumferentialincisionsfollowedadirection: a.inferiortothescrotum b.suprapubicandtransverse c.aroundthepenis d.lateraltotheprostate e.medialtotheinguinalcanal Writeatermfromthecasestudieswitheachofthefollowingmeanings: 8.surgicalrepairofaweakabdominalmuscleinthegroinareaonbothsides __________________________________ 9.entrapmentofaloopofbowelinahernia__________________________________ 10.inflammationoftheprostategland__________________________________ 11.withintheurinarybladder__________________________________ 12.inflammationoftheglanspenis__________________________________ 13.narrowingofthedistalopeningoftheforeskin__________________________________ Abbreviations.Definethefollowingabbreviations: 14.BPH_____________________________________ 15.TURP_____________________________________ 16.BNO_____________________________________ 17.UTI_____________________________________ AnswerstoCaseStudyQuestions 1.d 2.a 3.c 4.d 5.c 6.a 7.c 8.bilateralinguinalherniorrhaphy 9.strangulatedhernia 10.prostatitis 11.intravesical 12.balanitis 13.phimosis 14.benignprostatichyperplasia 15.transurethralresectionoftheprostate 16.bladderneckobstruction 17.urinarytractinfection

Sarmoko, S. Farm.

Anda mungkin juga menyukai