Anda di halaman 1dari 63

LAPORAN KELOMPOK TUTORIAL BLOK PSIKIATRI SKENARIO 2 Depresi

Kelompok A2 :

Aisah Kusumaning A. Aulia Muhammad Fikri Egtheastraqita C. Fitri Febrianti R. Nisau Luhtfi Nur A. Sausan Hana Maharani Arga Scorpianus Chendy Endriansa Itqan Ghozali Septian Sugiarto

(G0011009) (G0011045) (G0011081) (G0011 095) (G0011151) (G0011193) (G0011035) (G0011059) (G0011119) (G0011195)

Tutor :Dwi Rahayu, dr. PROGRAM STUDI PENDIDIKAN DOKTER FAKULTAS KEDOKTERAN UNIVERSITAS SEBELAS MARET 2013

BAB I PENDAHULUAN

A. Latar Belakang Skenario Depresi

Ny. S, usia 28 tahun, ibu rumah tangga, datang ke puskesmas bersama suaminya dengan keluhan kurang lebih 1 bulan tidak bisa tidur, tidak ada nafsu makan, sering menyendiri di kamar. Bila diajak bicara, pasien menjawab dengan suara pelan. Dari alloanamnesis diketahui bahwa pasien pernah mengalami gangguan serupa kurang lebih 1 tahun yang lalu dan sembuh sendiri setelah 9 bulan. Dari pemeriksaan status mental didapatkan hipoaktif, remming, mood depresi, afek menyempit, dan insight (tilikan diri) derajat 5.

B. Tujuan Pembelajaran

1. Mahasiswa mengetahui macam-macam gangguan arus pikiran. 2. Mahasiswa mengetahui macam-macam gangguan mood, afek dan mekanisme gangguan mood dari segi neurokimiawi. 3. Mahasiswa mengetahui hubungan keluhan satu tahun yang lalu dengan keluhan yang dialami sekarangoleh pasien pada skenario. 4. Mahasiswa mengetahui fisiologi, faktor pencetus gangguan tidur yang terkait gangguan psikiatri, dan patofisiologi gangguan tidur. 5. Mahasiswa mengetahui tentang overview manik dan bipolar. 6. Mahasiswa mengetahui etiologi depresi. 7. Mahasiswa mengetahui epidemiologi depresi. 8. Mahasiswa mengetahui patofisiologi depresi yang terkait dengan skenario. 9. Mahasiswa mengetahui gejala, episode, dan tipe depresi. 1

10. Mahasiswa mengetahui interpretasi hasil pemeriksaan status mental pada skenario. 11. Mahasiswa mengetahui pemeriksaan mental dan pemeriksaan penunjang yang terkait dengan skenario. 12. Mahasiswa mengetahuipenatalaksanaan depresi. 13. Mahasiswa mengetahui pencegahan depresi. 14. Mahasiswa mengetahui apakah kepribadian dapat diubah dan cara yang dilakukan bila dapat diubah pada kasus depresi.

BAB II DISKUSI DAN TINJAUAN PUSTAKA

A. Seven Jump 1. Langkah I:Membaca skenario dan memahami pengertian beberapa istilah dalam skenario Dalam skenario ini istilah yang kami klarifikasi antara lain : a. Hipoaktif: suatu keadaan menurunnya aktivitas motorik dan kognitif seperti pada retardasi psikomotorik; proses pikir yang jelas lambat, pembicaraan dan gerakan. b. Remming: suatu keadaan di mana arus hubungan yang terjadi menjadi lambat sebagai akibat dari adanya kesedihan seperti yang terjadi dalam keadaan depresi. Terjadi hambatan dalam pengucapan kata-kata dalam kalimat. c. Mood depresi: perasaan sedih yang bersifat psikopatologis. Keadaan mood yang berkisar antara susah atau tidak gembira tahap rendah sampai ke kemurungan yang nyata dan keputusasaan; pada tingkat yang ekstrim biasanya disertai pesimisme yang mencolok dan kurangnya harapan masa depan. d. Afek menyempit: : menggambarkannuansaekspresiemosi yang terbatas. Intensitas dan keluasandariekspresiemosinyaberkurang, yang dapatdilihatdariekspresiwajah dan

bahasatubuh yang kurangbervariasi (Nuhriawangsa, 2011). e. Insight (tilikan diri) derajat 5: menerima bahwa pasien sakit dan disebabkan oleh perasaan irasional atau gangguan tertentu pada diri pasien sendiri tanpa menerapkan pengetahuan tersebut untuk pengalaman masa depan (Susilohati dkk., 2013).

2. Langkah II: Menetapkan/mendefinisikan permasalahan Permasalahan yang kami tetapkan di skenario ini adalah sebagai berikut : a. Apa saja macam-macam gangguan arus pikiran? b. Apa saja macam-macam gangguan mood, afek, dan mekanisme gangguan mood dari segi neurokimiawi? c. Bagaimanahubungan keluhan satu tahun yang lalu dengan keluhan yang dialami sekarangoleh pasien pada skenario? d. Bagaimana fisiologi, faktor pencetus gangguan tidur yang terkait gangguan psikiatri, dan patofisiologi gangguan tidur?

e. Bagaimana overview manik dan bipolar? f. Apa saja etiologi depresi? g. Bagaimana epidemiologi depresi? h. Bagaimanapatofisiologi depresi yang terkait dengan skenario? i. Apa saja gejala, episode, dan tipe depresi? j. Bagaimana interpretasi hasil pemeriksaan status mental pada skenario? k. Apa saja pemeriksaan mental dan pemeriksaan penunjang yang dilakukan terkait dengan skenario? l. Bagaimana penatalaksanaan depresi? m. Bagaimana pencegahan depresi? n. Apakah kepribadian dapat diubah dan cara yang dilakukan bila dapat diubah pada kasus depresi?

3. Langkah III : Analisis Masalah Pada langkah ini kami membuat pernyataan sementara pada beberapa permasalahan yang kami temukan pada langkah sebelumnya.

1.

Macam-macam Gangguan Proses Berpikir Gangguan proses berpikir itu meliputi proses pertimbangan (judgement), pemahaman (comprehension), dan ingatan serta penalaran (reasoning). Proses berpikir yang normal mengandung arus idea, simbol dan asosiasi yang terarah kepada tujuan dan yang dibangkitkan oleh suatu masalah atau tugas dan yang menghantarkan kepada suatu penyelesaian yang berorientasi kepada kenyataan. Berbagai macam faktor mempengaruhi proses berpikir itu, umpamanya faktor somatik (gangguan otak, kelelahan), faktor psikologik (gangguan emosi, psikosis),dan faktor sosial (kegaduhan dan keadaan sosial yang lain) yang sangat mempengaruhi perhatian atau konsentrasi si individu. Kita dapat membedakan tiga aspek proses berpikir, yaitu: bentuk pikiran, arus pikiran, dan isi pikiran, ditambah dengan pertimbangan. Gangguan bentuk pikiran, dalam kategori ini termasuk semua penyimpangan dari pemikiran rasional, logis, dan terarah kepada tujuan.

1. Dereisme atau pikiran dereistik titik berat pada tidak adanya sangkut paut terjadi antara proses mental individu dan pengalamannya yang sedang berjalan. Proses mentalnya tidak sesuai dengan atau tidak mengikuti kenyataan, logika atau pengalaman. Umpamanya seorang kepala kantor pemerintah pernah mengatakan: Seorang pegawai negeri dan warga negara yang baik harus kebal koru psi, biarpun gajinya tidak cukup, biarpun keluarganya menderita; bila tidak tahan, silahkan keluar atau seorang lain lagi : Kita harus memberantas perjudian dan pelacuran, karena hal-hal itu merupakan exploitation de Ihomme par Ihomme adalah homo homini lupus adalah machiavellisme, karena itu kita harus mengikis habis segala bentuknya, tanpa kecuali. 2. Pikiran otistik : menandakan bahwa penyebab distorsi arus asosiasi ialah dari dalam pasien itu sendiri dalam bentuk lamunan, fantasi, waham atau halusinasi. Cara berpikir seperti ini hanya akan memuaskan keinginannya yang tak terpenuhi tanpa memperdulikan keadaan sekitarnya; hidup dalam alam pikirannya sendiri. Kadangkadang istilah ini dipakai juga untuk pikiran dereistik. 3. Bentuk pikiran yang non-realistik: bentuk pikiran yang sama sekali tidak berdasarkan kenyataan, umpamanya: menyelidiki sesuatu yang spektakuler/ revaolusioner bila ditemui; mengambil kesimpulan yang aneh serta tidak masuk akal. (Merupakan gejala yang menonjol pada skizofermia hebefrenik di samping tingkah-laku kekanakkanakan). Dibedakan dari pikiran dereistik dan otistik, tetapi kadang-kadang ketiga gangguan bentuk pikiran ini dijadikan satu dengan salah satu istilah itu. Gangguan arus pikiran, yaitu tentang cara dan lajunya proses asosiasi dalam pemikiran, yang timbul dalam berbagai jenis: 1. Perseverasi : berulang-ulang menceritakan suatu idea, pikiran atau tema secara berlebihan. Penulis pernah mendengar seorang pasien berkata: Nanti besok saya pulang, ya saya sudah kangen rumah, besok saya sudah berada di rumah sudah makan enak di rumah sendiri, ya pak dokter, satu hari lagi saya nanti sudah bisa tidur di rumah, besok ayah akan datang mengambil saya pulang.. 2. Asosiasi longgar : mengatakan hal-hal yang tidak ada hubungannya satu sama lain umpamanya Saya mau makan. Semua orang dapat berjalan. Bila extrim, maka akan terjadi inkoherensi.

Asosiasi yang sangat longgar dapat dilihat dari ucapan seorang penderita seperti berikut ini: . Saya yang menjalankan mobil kita harus membikin tenaga nuklir dan harus minum es krim 3. Inkoherensi : gangguan dalam bentuk bicara, sehingga satu kalimatpun sudah sukar ditangkap atau diikuti maksudnya. Suatu waham yang aneh mungkin diterangkan secara incoherent. Inkoherensi itu boleh dikatakan merupakan asosiasi yang longgar secara extrim. Penulis pernah menerima surat yang isinya antara lain sebagai berikut: saya minta di janji, tidur, lahir dengan pakaian lengkap untuk anak saya satu atau lebih menurut pengadilan Allah dengan suami jodohnya yang menyinggung segala percobaan 4. Kecepatan bicara : untuk mengutarakan pikiran mungkin lambat sekali atau sangat cepat. 5. Benturan (blocking): jalan pikiran tiba-tiba berhenti atau berhenti di tengah sebuah kalimat. Pasien tidak dapat menerangkan kenapa ia berhenti. 6. Logorea: banyak bicara, kata-kata dikeluarkan bertubi-tubi tanpa kontrol, mungkin coherent ataupun incoherent. 7. Pikiran melayang (flight of ideas): perubahan yang mendadak lagi cepat dalam pembicaraan sehingga suatu idea yang belum selesai diceritakan sudah disusul lagi oleh ide yang lain. Umpamanya seorang pasien pernah bercerita sebagai berikut: Waktu saya datang ke rumah sakit Kakak saya baru mendapat rebewes, lalu untuk saya pakai kemeja biru, hingga pak dokter menanyakan bila sudah makan 8. Asosiasi bunyi (clang association): mengucapkan perkataan yang mempunyai persamaan bunyi, umpamanya pernah didengar: Saya mau makan di Tarakan, seakan-akan berantakan. 9. Neologisme : membentuk kata-kata baru yang tidak dipahami oleh umum, misalnya: saya radiltu, semua partimun. 10. Irelevansi: isi pikiran atau ucapan yang tidak ada hubungannya dengan pertanyaan atau dengan hal yang sedang dibicarakan.

11. Pikiran berputar-putar (circumstantiality): menuju secara tidak langsung kepada ide pokok dengan menambahkan banyak hal yang remeh-remeh yang menjemukan dan yang tidak relevan. 12. Main-main dengan kata-kata: menyajak (membuat sajak) secara tidak wajar. Umpamanya pernah penulis menerima sajak yang antara lain berbunyi: Wahai jagoku yang tersembunyi Meskipun kau jago Tanpa kau hatiku sunyi Tanpa kau hatiku mewangi. 13. Afasia: mungkin sensorik (tidak atau sukar mengerti bicara orang lain) atau motorik (tidak dapat atau sukar berbicara), sering kedua-duanya sekaligus dan terjadi karena kerusakan otak.

Gangguan isi pikiran dapat terjadi baik pada isi pikiran non-verbal, maupun pada isi pikiran yang diceriterakan, misalnya: 1. Kegembiraan yang luar biasa atau ekstasi (ecstasy) dapat timbul secara mengambang pada orang yang normal selama fase permulaan narkosa (anestesia umum). Boleh juga disebabkan oleh Narkotika (feeling high atau fligh sebagai logat para narkotik) atau kadang-kadang timbul sepintas lalu pada skizofrenia. Semua mengatakan bahwa isi pikiran mereka itu tidak dapat diceriterakan. 2. Fantasi : ialah isi pikiran tentang suatu keadaan atau kejadian yang diharapkan atau diinginkan, tetapi dikenal sebagai tidak nyata. Fantasi yang kreatif menyiapkan si individu untuk bertindak sesudahnya; fantasi dalam lamunan merupakan pelarian bagi keinginan yang tidak dapat dipenuhi. Pada psedologia fantastika (pseudologia fantastica) orang itu percaya akan kebenaran fantasinya secara intermittent dan selama jangka waktu yang cukup lama untuk bertindak sesuai dengan itu. 3. Fobi : rasa takut yang irasional terhadap sesuatu benda atau keadaan yang tidak dapat dihilangkan atau ditekan oleh pasien, biarpun diketahuinya bahwa hal itu irasional adanya. Fobi itu dapat mengakibatkan kompulsi, umpamanya fobi kotor atau fobi kuman menimbulkan kompulsi cuci-cuci tangan. Ini perlu dibedakan

dari kecemasan yang mengambang (free-floating anxiety) atau kecemasan terhadap keadaan umum, misalnya takut akan jatuh sakit, takut gagal dalam usahanya. Adapun fobi itu bermacam-macam, diantaranya 1) Agorafobi 2) Ailurofobi : terhadap ruang yang luas : terhadap kucing

3) Akrofobi : terhadap tempat yang tinggi 4) Algofobi : terhadap perasaan nyeri 5) Astrafobi : terhadap badai, Guntur, kilat 6) Bakteriofobi : terhadap kuman

7) Eritrofobi : terhadap mukanya akan menjadi merah 8) Hematofobi 9) Kankerofobi 10) Klaustrofobi : terhadap darah : terhadap penyakit kanker (cancerophobia) : terhadap ruangan yang tertutup

11) Misofobi : terhadap kotoran dan kuman 12) Monofobi : terhadap keadaan sendirian 13) Niktofobi : terhadap kegelapan 14) Okholofobi 15) Panfobi : terhadap keadaan ramai dengan banyak orang

: terhadap segala sesuatu

16) Patofobi : terhadap penyakit 17) Pirofobi : terhadap api

18) Sifilofobi : terhadap penyakit sifilis 19) Xenofobi : terhadap o rang asing 20) Zoofobi : terhadap binatang

4. Obsesi : isi pikiran yang kukuh (persistent) timbul, biarpun tidak dikehendakinya, dan diketahuinya bahwa hal itu tidak wajar atau tidak mungkin, umpamanya: bahwa anaknya sedang sakit keras atau bahwa seorang wanita menjadi hamil karena perbuatannya. Obsesi itu dapat mengakibatkan kompulsi, umpamanya obsesi barangnya hilang menyebabkan kompulsi membuka-buka lemari untuk melihat kalau berangnya masih ada di dalamnya. 5. Preokupasi: pikiran terpaku hanya pada sebuah ide saja, yang biasanya berhubungan dengan keadaan yang bernada emosional yang kuat. Ini belum

merupakan, tetapi dapat menjadi obsesi. Umpamanya preokupasi dengan ujian, anak yang sakit, atau perjalanan yang akan dilakukan. 6. Pikiran yang tak memadai (inadequate) : pikiran yang eksentrik, tidak cocok dengan banyak hal, terutama dalam pergaulan dan pekerjaan seseorang. 7. Pikiran bunuh diri (suicidal thoughts/ideation): mulai dari kadang-kadang memikirkan hal bunuh diri sampai terus menerus memikir akan cara bagaimana ia dapat membunuh dirinya. 8. Pikiran bubungan (ideas of reference): pembicaraan orang lain, benda-benda atau sesuatu kejadian dihubungkannya dengan dirinya, umpamanya burung bersiul dianggapnya sebagai sebuah berita baginya, atau temannya memakai kemeja yang berwarna merah diartikannya bahwa teman itu sedang marah kepadanya. (pasien mungkin sadar, bahwa pikirannya itu tidak masuk akal). 9. Rasa terasing (alienasi): perasaanbahwa dirinya sudah menjadi lain, berbeda, asing, umpamanya heran siapakah dia itu sebenarnya; rasanya ia berbeda sekali dari orang lain; heran kenapa orang lain sudah berbeda, menjadi asing, aneh. Ini dibedakan dari pikiran isolasi sosial dan dari amnesia. 10. Pikiran isolasi sosial (social isolation): rasa terisolasi, tersekat, terkunci, terpencil dari masyarakat; rasa ditolak, tidak disukai oleh orang lain; rasa tidak enak bila berkumpul dengan orang lain; lebih suka menyendiri. Ini dibedakan dari menarik diri yang menunjukkan tingkah laku dan dari isolasi sebagai mekanisme pembelaan psikologik. 11. Pikiran rendah diri: merendahkan, menghinakan dirinya sendiri, menyalahkan dirinya tentang suatu hal yang pernah atau tidak pernah dilakukannya 12. Merasa dirugikan oleh orang lain: mengira ataumenyangka ada orang lain yang telah merugikannya, sedang mengambil keuntungan dari dirinya atau sedang mencelakakannya 13. Merasa dingin dalam bidang sexual: acuh-tak-acuh tentang hal sexual; kegairahan sexual berkurang secara umum (hiposexualitas). Ini dibedakan dari gangguan potensi sexual dan dari impotensia dan frigiditas 14. Rasa salah: sering mengatakan bahwa ia telah bersalah. Ini bukanlah waham dosa.

15. Pesimisme: mempunyai pandangan yang suram mengenai banyak hal dalam hidupnya. 16. Sering curiga: mengutarakan ketidakpercayaannya kepada orang lain. Ini bukan waham curiga. 17. Waham: keyakinan tentang suatu isi pikiran yang tidak sesuai dengan kenyataannya atau tidak scocok dengan intelegensi dan latar belakang kebudayaannya, biarpun dibuktikan kemustahilan hal itu. Waham itu banyak jenisnya, diantaraya: 1) Waham kejaran: umpamanya pasien yakin bahwa ada orang atau komplotan yang sedang mengganggunya atau bahwa ia sedang ditipu, dimatai-matai atau kejelekannya sedang dibicarakan orang banyak. 2) Waham somatik atau hipokhondrik: keyakinan tentang (sebagian) tubuhnya yang tidak mungkin benar, umpamanya bahwa ususnya sudah busuk, otaknya sudah cair, ada seekor kuda di dalam perutnya. 3) Waham kebesaran: yakni bahwa ia mempunyai kekuatan, pendidikan, kepandaian atau kekayaan yang luar biasa, umpamanya bahwa dialah Ratu Adil, dapat membaca pikiran orang lain, mempunyai puluhan atau mobil. 4) Waham keagamaan: waham dengan tema keagamaan 5) Waham dosa: keyakinan bahwa ia telah berbuat dosa atau kesalahan yang besar, yang tidak dapat diampuni atau bahwa ia bertanggung jawab atas suatu kejadian yang tidak baik, misalnya kecelakaan keluarga, karena pikirannya yang tidak baik. 6) Waham pengaruh: yakin bahwa pikirannya, emosi atau perbuatannya diawasi atau dipengaruhi oleh orang lain atau suatu kekuasaan yang aneh. 7) Waham nihilistic: yakin bahwa dunia ini sudah hancur atau bahwa ia sendiri dan/atau orang lain sudah mati. 8) Tingkah laku yang dipengaruhi oleh waham: karena waham, maka ia berbuat atau bertingkah laku demikian. (Ada juga waham kelompok, seperti pada folie a deux, yaitu kelompok 2 orang berwaham yang sama; folie a trios, 3 orang dan sebagainya).

10

18. Kekhawatiran yang tidak wajar tentang kesehatan fisiknya: takut kalau-kalau kesehatan fisiknya tidak sesuai lagi dengan keadaan badannya yang sebenarnya. Termasuk baik prihatin tentang sebuah organ, maupun tentang beberapa organ tubuhnya (seperti pada nerosa hipokhondrik).

Gangguan pertimbangan ada hubungannya dengan keadaan mental yang menghindari kenyataan yang menyakitkan. Pertimbangan ialah kemampuan

mengevaluasi keadaan serta langkah yang dapat diambil, alternatif yang dapat dipilih, atau kemampuan menarik kesimpulan yang wajar berdasarkan pengalaman. Bila langkah atau kesimpulan yang diambil itu sesuai dengan kenyataan seperti yang dinilai dengan ukuran orang dewasa yang matang, maka pertimbangan itu utuh, baik atau bermoral adanya. Sebaliknya jika langkah atau kesimpulan itu tidak cocok dengan kenyataan, maka pertimbangan itu terganggu, kurang baik atau abnormal adanya. Dalam pemilihan alternatif mungkin juga orang itu sering keliru, bimbang atau tidak puas dengan pilihannya. Gangguan ini dapat timbul dalam keadaan sebagai berikut: 1. Dalam hubungan keluarga; dalam keluarga inti atau keluarga luas, umpamanya tidak insaf bahwa tingkah-lakunya mengganggu keluarganya 2. Dalam hubungan sosial lain: umpamanya merasa dirinya dirugikan atau dialangalangi secara terus menerus. 3. Dalam pekerjaan: misalnya harapan yang tidak realistic mengenai pekerjaannya. 4. Dalam rancangan untuk hari kemudiannnya: pasien tidak mempunyai rancangan apapun (atau bagaimanakah pertimbangannya tentang rancangan yang ada padanya) (Maramis, 2009).

11

2.

Fisiologi, Faktor Pencetus Gangguan Tidur yang Terkait Gangguan Psikiatri, dan Patofisiologi serta Macam-macam Gangguan Tidur a. Fisiologi Tidur Tidur merupakan salah satu cara melepaskan kelelahan jasmani dan mental. Dengan tidur semua keluhan hilang atau berkurang dan akan kembali mendapatkan tenaga serta semangat untuk menyelesaikan persoalan yang dihadapi. Semua makhluk hidup mempunyai irama kehidupan yang sesuai dengan beredarnya waktu dalam siklus 24 jam. Irama yang seiring dengan rotasi bola dunia disebut sebagai irama sikardian. Pusat kontrol irama sikardian terdapat pada ventral hipothalamus. Bagian susunan saraf pusat yang mengadakan kegiatan sinkronisasi terletak pada substansia ventrikulo retikularis medula oblongata yang disebut sebagai pusat tidur. Bagian susunan saraf pusat yang menghilangkan sinkronisasi (desinkronisasi) terdapat pada rostral medula oblongata, disebut sebagai pusat penggugah atau aurosal state. Tidur dibagi dua tipe, yaitu tipe Rapid Eye Movement (REM) dan tipe Non Rapid Eye Movement. Fase awal tidur didahului oleh fase NREM yang terdiria tas empat stadium, lalu diikuti oleh fase REM. Keadaan tidur normal antara fase NREM dan REM terjadi secara bergantian antara 4 7 kali siklus semalam. Bayi baru lahir total tidur 16 20 jam/hari, anak-anak 10 12 jam/hari, ekmudian menurun 9 10 jam/hari pada umur diatas 10 tahun dan kira-kira 7 7,5 jam/hari pada orang dewasa.

Tipe NREM dibagi menjadi empat stadium, yaitu: 1. Tidur stadium satu Fase ini merupakan fase antara terjaga dan awal tidur. Fase ini didapatkan kelopak mata tertutup, tonus otot berkurang dan tampak gerakan bola mata ke kanan dan ke kiri. Fase ini berlangsung 3 5 menit dan mudah sekali dibangunkan. Gambaran EEG biasanya terdiri dari campuran , , dan kadang gelombang dengan amplitudo yang rendah. Tidak didapatkan adanya gelombang sleep spindle dan kompleks K. 2. Tidur stadium dua

12

Pada fase ini didapatkan bola mata berhenti bergetak, tonus otot masih berkurang, tidur lebih dalam dari pada fase pertama. Gambaran EEG terdiri dari gelombang simetris. Terlihat adanya gelombang sleep spindle, gelombang verteks dan kompleks K. 3. Tidur stadium tiga Fase ini tidur lebih dalam dari fase sebelumnya. Gambaran EEG terdapat lebih banyak gelombang simetris antara 25 50% serta tampak gelombang sleep spindle. 4. Tidur stadium empat Merupakan tidur yang dalam dan sukar dibangunkan. Gambaran EEG didominasi oleh gelombang sampai 50%, tampak gelombang sleep spindle. Fase tidur NREM ini berlangsung antara 70 100 menit, setelah itu akan masuk fase REM. Pada waktu REM jam pertama prosesnya berlangsung lebih cepat dan menjadi lebih intens dan panjang saat menjelang pagi atau bangun. Pola tidur REM ditangai dengan adanya gerakan bola mata yang cepat, tonus otot yang sangat rendah, apabila dibangunkan hampir semua orang akan dapat menceritakan mimpinya, denyut nadi bertambah dan pada laki laki terjadi ereksi penis, tonus otot menunjukkan relaksasi yang dalam. Pola tidur REM berubah sepanjang kehidupan seseorang seperti periode neonatal mencapai 50% dari waktu total tidur. Periode neonatal ini pada EEGnya masuk fase REM tanpa melewati fase NREM stadium 1 4. Pada usia 4 bulan pola berubah sehingga presentasi total tidur REM berkurang sampai 40%. Hal ini sesuai dengan kematangan sel-sel otak. Kemudian akan masuk ke fase awal tidur yang didahului fase NREM. Fase REM pada dewasa muda terdistribusi sebagai berikut: NREM (75%) yaitu stadium 1 (5%), stadium 2 (45%), stadium 3 (12%), stadium 4 (13%) dan REM (25%). Keadaan jaga atau bangun sangat dipengaruhi oleh sistem ARAS (Ascending Reticulary Activity System). Aktifitas ARAS ini sangat dipengaruhi oleh

neurotransmitter seperti sistem serotoninergik, noradrenergik, kolinergik, dan histaminergik.

13

a.

Sistem serotoninergik Hasil serotoninergik sangat dipengaruhi oleh hasil metabolisme asam amino tryptophan. Dengan bertambahnya jumlah tryptophan, maka jumlah serotonin yang terbentuk juga meningkat dan akan menyebabkan keadaan mengantuk. Bila pembentukan serotonin terhambat maka orang tersebut terjaga. Menurut beberapa peneliti lokasi sistem serotoninergik terbanyak terletak di nukleus raphe dorsalis batang otak. Sehingga terdapat hubungan antara aktifitas nukleus raphe dorsalis dengan fase REM.

b.

Sistem adrenergik Neuron-neuron yang terbanyak mengandung norepinefrin terletak di nukleus cereleus batang otak. Kerusakan neuron pada nukleus cereleus sangat

mempengaruhi penurunan atau hilangnya REM tidur. c. Sistem kolinergik Stimulasi jalur kolinergik memberikan gambaran EEG seperti orang terjaga. Gangguan aktifitas kolinergik menyebabkan pemendekan fase REM. d. Sistem histaminergik Pengaruh histamin sangat sedikit mempengaruhi tidur e. Sistem hormon Pengaruh hormon dalam siklus tidur adalah dengan mempengaruhi sekresi neurotransmitter norepinefrin, dopamin dan serotonin yang mengatur mekanisme tidur/bangun. Hormon yang berpengaruh adalah ACTH, GH, TSH dan LH (Japardi, 2010). b. Faktor Pencetus Gangguan Tidur Terkait Gangguan Psikiatrik Menurut Japardi (2010) dalam Handbook of Psychiatry, gangguan tidur yang berhubungan dengan gangguan psikiatri, yaitu gangguan mental psikosis, anxietas, gangguan afektif, panik (nyeri hebat), dan alkohol. Sedangkan menurut Harvard Health Mental Letter (2009), gangguan psikiatrik yang mencetuskan gangguan tidur, antara lain: a. Depresi: Penelitian yang menggunakan metode dan populasi yang berbeda memperkirakan bahwa 65 % sampai 90 % dari pasien dewasa dengan depresi berat,

14

dan sekitar 90 % dari anak-anak dengan gangguan ini, mengalami beberapa jenis masalah tidur. Kebanyakan pasien dengan depresi mengalami insomnia, tetapi sekitar satu dari lima orang menderita obstructive sleep apnea. Masalah tidur mempengaruhi hasil pengobatan bagi pasien dengan depresi. Penelitian melaporkan bahwa pasien dengan depresi yang terus mengalami insomnia cenderung kurang merespon pengobatan dibandingkan mereka yang tanpa masalah tidur. Bahkan pasien yang suasana hatinya membaik dengan terapi antidepresan pun lebih berisiko mengalami kekambuhan depresi di kemudian hari. b. Gangguan bipolar : Penelitian pada populasi yang berbeda melaporkan bahwa 69 % sampai 99 % dari pasien mengalami insomnia atau melaporkan kurangnya kebutuhan tidur selama episode manik dari gangguan bipolar.Sedangkan dalam penelitian lain pada depresi bipolar melaporkan bahwa 23 % sampai 78 % dari pasien mengalami tidur berlebihan (hipersomnia) , sementara yang lain mungkin mengalami insomnia atau susah tidur. c. Gangguan kecemasan: Masalah tidur mempengaruhi lebih dari 50 % dari pasien dewasa dengan gangguan kecemasan umum (Generalized Anxiety Disorder [GAD]), yang umumnya terjadi pada pasien dengan gangguan stres pasca -trauma ( Post Traumatic Stress Disorder [PTSD]), dan dapat terjadi pada gangguan panik , gangguan obsesif-kompulsif , dan fobia. Gangguan ini juga sering terjadi pada anak dan remaja. Suatu penelitian tidur di laboratorium menemukan bahwa anak-anak dengan gangguan kecemasan membutuhkan waktu lebih lama untuk tertidur, dan tidur kurang nyenyak dibandingkan dengan kelompok kontrol anak-anak yang sehat. d. Attention Deficit Hyperactivity Disorders (ADHD): Berbagai masalah tidur mempengaruhi 25 % sampai 50 % anak dengan ADHD. Masalah umum yang terjadi termasuk sulit tidur, durasi tidur yang lebih pendek, dan tidur gelisah. Gejala-gejala ADHD dan kesulitan tidur tumpang tindih begitu banyak sehingga sulit untuk menguraikannya secara terpisah.

c. Patofisiologi Gangguan Tidur

15

Keadaan jaga atau bangun sangat dipengaruhi oleh sistim ARAS (Ascending Reticulary Activity System). Bila aktifitas ARAS ini meningkat orang tersebut dalam keadaan tidur. Aktifitas ARAS menurun, orang tersebut akan dalam keadaan tidur. Aktifitas ARAS ini sangat dipengaruhi oleh aktifitas neurotransmiter seperti sistem serotoninergik, noradrenergik, kholonergik, histaminergik. Sistem serotonergik Hasil serotonergik sangat dipengaruhi oleh hasil metabolisma asam amino trypthopan. Dengan bertambahnya jumlah tryptopan, maka jumlah serotonin yang terbentuk juga meningkat akan menyebabkan keadaan mengantuk/tidur. Bila serotonin dari tryptopan terhambat pembentukannya, maka terjadikeadaan tidak bisa tidur/jaga. Menurut beberapa peneliti lokasi yang terbanyak sistem serotogenik ini terletak pada nukleus raphe dorsalis di batang otak, yang mana terdapat hubungan aktifitas serotonis dinukleus raphe dorsalis dengan tidur REM. Sistem Adrenergik Neuron-neuron yang terbanyak mengandung norepineprin terletak di badan sel nukleus cereleus di batang otak. Kerusakan sel neuron pada lokus cereleus sangat mempengaruhi penurunan atau hilangnya REM tidur. Obat-obatan yang mempengaruhi peningkatan aktifitas neuron noradrenergik akan

menyebabkan penurunan yang jelas pada tidur REM dan peningkatan keadaan jaga. Sistem Kholinergik Sitaram et al (1976) membuktikan dengan pemberian prostigimin intra vena dapat mempengaruhi episode tidur REM. Stimulasi jalur kholihergik ini, mengakibatkan aktifitas gambaran EEG seperti dalam keadaan jaga. Gangguan aktifitas kholinergik sentral yang berhubungan dengan perubahan tidur ini terlihat pada orang depresi, sehingga terjadi pemendekan latensi tidur REM. Pada obat antikolinergik (scopolamine) yang menghambat pengeluaran kholinergik dari lokus sereleus maka tamapk gangguan pada fase awal dan penurunan REM. Sistem histaminergik Pengaruh histamin sangat sedikit mempengaruhi tidur Sistem hormon

16

Pengaruh hormon terhadap siklus tidur dipengaruhi oleh beberapa hormon seperti ACTH, GH, TSH, dan LH. Hormon hormon ini masing-masing disekresi secara teratur oleh kelenjar pituitary anterior melalui hipotalamus pathway. Sistem ini secara teratur mempengaruhi pengeluaran neurotransmiter norepinefrin, dopamin, serotonin yang bertugas menagtur mekanisme tidur dan bangun (Japardi, 2010). d. Macam-macam gangguan tidur 1. Insomnia Insomnia, yaitu kurangnya atau menurunnya kemampuan untuk tidur, yang terdiri dari insomnia awal (initial insomnia), yaitu sulit jatuh tidur, insomnia pertengahan (middle insomnia) kesulitam tidur sepanjang malam dan kalau bisa tidur, terbangun sulit untuk tidur lagi, insomnia akhir (terminal late) dan bangun terlalu awal (pagi). 2. Parasomnia Parasomnia adalah suatu kelainan yang disebabkan kejadia perilaku atau psikologis abnormal yang muncul di kala tidur, tahapan tertentu, atau transisi fase tidurterjaga. Parasomnia lebih umum terjadi pada anak-anak dan tidak selalu menandakan adanya masalah psikologis atau psikiatris yang signifikan. Jenis-jenis parasomnia : - Tidur jalan - Makan sambil tidur - Terror tidur - Gangguan soal tidur 3. Tidur Apnea Tidur apnea adalah suatu kondisi dimana terjadinya penghetian napas disaat tidur. Tidur apnea sangat umum terjadi, layaknya diabetes yang lazim menimpa orang dewasa. 4. Narkolepsi Kelainan tidur ini secara umum ditandai munculnya keinginan tidur di sinag hari secara tak terkendali. Penderita sering kali jatuh tertidur di sembarang waktu dan tempat, juga terjadi berulang kali dalam sehari. Narkolepsi adalah kelainan

17

neourologis (yang menyerang otak dan syaraf) kronis yang melibatkan system saraf pusat tubuh. Gejala-gejala narkolepsi antara lain : - Katalepsi, yaitu mengalami serangan tiba-tiba, hilangnya kelenturan otot temporal pada tubuh. 5. Paralisis tidur Paralisis tidur adalah fungsi alamiah tubuh yang menyebabkan penderitanya mengalami kelumpuhan di kala tidur. Dulunya dikenal dengan nama The Old Hag Syndrome. Mereka yang mengalami fenomena ini kadang merasa ketakutan karena mengira sedang diserang oleh setan. Zaman dulu, ada kepercayaan kalau fenomena ini diakibatkan oleh "Old Hag" atau "Penyihir" yang sedang menduduki dada korban.

3.

Macam-macam Gangguan Mood dan Afek Mood didefinisikansebagai alamperasaan atau suasanaperasaan yang bersifat internal.Ekspresieksternaldari lama mood disebutafek, atau mood 5 eksternal yang

display.Sejak

dalamliteraturpsikiatri kuranglebihdalam

terganggudisebutgangguanafektif.Tetapi,

tahunterakhir, paling yang

gangguanafektifinidiubahnamanyadengangangguan utamadalamgangguanmoodiniadalah mood yang

mood.Yang menurunatautertekan

disebutdepresi, dan mood yang meningkat atauekspansif yang disebut mania (manik).Baik mood yang menurunatauterdepresidan mood yang

meningkatbersifatgradual,suatu kontinuitas darikeadaan normal ke bentuk yang jelas-jelaspatologik.Padabeberapaindividugejalagejalanyabisadisertaidenganciripsikotik.

a. TandadanGejalaDepresi Depresiadalahkeadaanemosional sangat,perasaanbersalah, yang ditandaikesedihan orang yang lain,

tidakberharga,

menarikdiridari

kehilanganminatuntuktidur dan seks sertahal-halmenyenangkanlainnya.Orang yang depresimungkin:

18

-Sulitkonsentrasi, bicaranyapelan, kata-kata monoton, suarapelan -Memilihuntuksendiriandanberdiamdiri; ataujustrutidakbisadiam -Sulitmenemukansolusipermasalahan Tandadangejaladepresimungkinbervariasibergantungusia, anak-anak yang depresiseringkalimenunjukkankeluhansomatis, sepertisakitperutatausakitkepala, sedangkan orang dewasa yang

depresiseringkalimudahlupadanmudahterdistruksi. Gejala-gejalaringandapatberupapeningkatandarikesedihanatau sedanggejala-gejalaberatdikaitkandengansindromgangguan terlihatberbedasecarakualitatifdariproses danmembutuhkanterapispesifik. Gangguandepresiseringdijumpai.Prevalensiselamakehidupanpadawanita 10%25% danpadalaki-laki 5%-12%.Walaupundepresilebihseringpadawanita, relasi mood normal yang normal

bunuhdirilebihseringpadalaki-lakiterutamausiamudadantua.

b. Klasifikasi Mood Gangguan mood berbedadalamhalmanifestasiklinik, perjalananpenyakit, genetik, danresponspengobatan.Kondisiinidibedakansatusama lain berdasarkan: (1) adatidaknya mania (bipolar atau unipolar); (b) beratringannyapenyakit (mayor atau minor); (c) Maka, mayor : kondisimedikataupsikiatrik diklasifikasikan depresi mayor lain

sebagaipenyebabgangguan. (I) Gangguan mood

sebagaiberikut: dan/ atautandamania

tandagejalamanik.Gangguan

Bipolar

I(manik-depresi)

padamasalaluatausaatini ( denganatautanpaadanyadepresiatauriwayatdepresi). Gangguan Bipolar II hipomaniadandepresi GangguanDepresi mayor Mayor-

mestiadasaatiniataupernahada. hanyadepresiberatsaja. (II) Gangguan mood

spesifiklainnya.

Depresi

minor

dan/ataugejala

gejaladantanda-tandamanik.Gangguandistimia

depresisaja.Gangguansiklotimia depresidanhipomaniksaatataubarusajaberlalu (secaraterusmenerusselama 2 tahun).

19

(III) Gangguan mood akibatkondisimedikumumdangangguan mood akibatzat. (IV) Gangguanpenyesuaiandengan mood depresi:depresi yang disebabkanoleh stresor.

c. Diagnostik Formal Gangguan Mood Menurut DSM IV-TR Depresimerupakansuatusindrom yang ditandaidengansejumlahgejalaklinik yang manifestasinyabisaberbedapadamasing-masingindividu.Diagnostic and Statistical Manual of yang Mental Disorders (DSM-IV) diagnosis

merupakansalahsatuinstrumen

dipakaiuntukmenegakkan

depresi, selain PPDGJ-III (ICD-X) yang digunakan di seluruh RSJ Indonesia.Bilamanifestasigejaladepresimunculdalambentuk berkaitandengan mood (sepertimurung, sedih, keluhan yang

putusasa),

diagnosis

depresidenganmudahdapatditegakkan.Tetapi, bilagejaladepresimunculdalamkeluhanpsikomotoratausomatiksepertimalasbeke rja, lamban, lesu, nyeriuluhati, sakitkepalaterusmenerus, adanyagejaladepresi yang melatarbelakangiseringtidakterdiagtnosis.Ada diagnosis depresi, masalah yang

jugadapatmenutupi alkoholatau

misalnyaindividupenyalahgunaan untukmengatasidepresi,

NAPZA

ataudepresimunculdalambentukgangguanperilaku.

d. Diagnosis Depresi (Depresi Mayor/ Unipolar) - Minimal 2 minggukehilanganminatdankesenangan serta mood depresif. Minimal muncul 4 diantarasimptom additional berikutini, yaitu:

gangguantidurdannafsumakan, hilangenergi, worthlessness, suicidal thought, dansulit Subclinical depression: individu yang konsentrasi. simtomnyakurangdari 5,

memilikikesulitandalamfungsipsikologis Depresi 2-3 kali lebihseringpadawanitadaripadapria;

lebihseringterjadipadagolonganekonomibawah dan dewasamuda - Depresicenderungmunculberulang pada 80 % penderitamengalami episode lain

20

e. Diagnosis Gangguan Bipolar - Gangguan Bipolar I: episode mania/ campuran, terdapatsimtom mania dandepresi. Episode mania disini minimal muncul 3 simtom additional (4 simtomjika mood hanyairritable). -Gangguan bipolar lebihjarangmunculdaripadadepresi mayor

- Rata-rata onset: umur 20an, seimbangantarapriadanwanita.

f. GangguanMoodKronik Jangkapanjang, minimal 2 tahun,

belumcukupmengganggufungsisosialdanpekerjaan. Ada 2 jenis: a. Gangguan cyclothymic b. Periodedepresidanhipomaniaberulang. selamahipomaniaself-esteemmeningkat. Selamadepresipasienmerasainadekuat, Menarikdiri,

tidurterlaluseringatauterlalusebentar, sulitkonsentrasi, danjarangberbicara.

g. Gangguan Mood danDepresi Individu yang

depresilebihsedikitmenunjukkanekspresiwajahpositifdanmengalamiemosimeny enangkan. - Gangguankecemasanbiasanyamunculbersamaandengandepresi.

h. Teori Psikoanalisis tentang Depresi Teoripsikodinamikaklasikmengenaidepresidari danparapengikutnyameyakinibahwadepresimewakilikemarahan Freud yang

diarahkankedalamdirisendiridanbukanterhadap orang-orang yang dikasihi.Rasa marahdapatdiarahkankepada diri setelahmengalamikehilangan yang

sebenarnyaatauancamankehilangandari orang-orang yang dianggappentingini (Neviddkk., 2005). 21

Menurutpandanganini,

gangguan

bipolar

mewakilidominansi ego

yang dan

berubah-ubahdarikepribadianindividuantara

superego.Dalamfasedepresi, superego adalahdominan, memproduksikesadaran yang berlebihanataskesalahan-

kesalahandanmembanjiriindividudenganperasaanbersalahdanketidakberhargaan (Neviddkk., 2005). Model psikodinamikaterbaru lebihterfokuspadaisu-isu yang

berhubungandenganperasaan individual akan self-worth atau self-esteem. Suatu model, yang disebut model self-focusing, proses

mempertimbangkanbagaimanamengalokasikan

atensimerekasetelahsuatukehilangan (kematian orang yang dicintai, kegagalan personal, dll). Menurut model ini, orang yang

mudahterkenadepresimengalamisuatuperiode self-examination (self-focusing) yang intenssetelahterjadinyasuatukehilanganataukekecewaan yang

besar.Merekamenjaditerpakupadapikiranpikiranmengenaiobjekatautujuanpenting yang

hilangdantetaptidakdapatmerelakanharapanakanentahbagaimanacaramendapatk annyakembali (Neviddkk, 2005).

i. Macam-macammood Mood eutimia: adalah suasana perasaan dalam rentang normal, yakni individu mempunyai penghayatan perasaan yang luas dan serasi dengan irama hidupnya Mood hipotimia: adalah suasana perasaan yang secara pervasif diwarnai dengan kesedihan dan kemurungan. Individu secara subyektif

mengeluhkan tentang kesedihan dan kehilangan semangat. Secara obyektif tampak dari sikap murung dan perilakunya yang lamban Mood disforia: menggambarkan suasana perasaan yang tidak

menyenangkan. Seringkali diungkapkan sebagai perasaan jenuh, jengkel, atau bosan. 22

Mood hipertimia: suasana perasaan yang secara perfasif memperlihatkan semangat dan kegairahan yang berlebihan terhadap berbagai aktivitas kehidupan. Perilakunya menjadi hiperaktif dan tampak enerjik secara berlebihan.

Mood eforia: suasana perasaan gembira dan sejahtera secara berlebihan. Mood ekstasia: suasana perasaan yang diwarnai dengan kegairahan yang meluap luap. Sering terjadi pada orang yang menggunakan zat psikostimulansia

Aleksitimia: adalah suatu kondisi ketidakmampuan individu untuk menghayati suasana perasaannya. Seringkali diungkapkan sebagai kedangkalan kehidupan emosi. Seseorang dengan aleksitimia sangat sulit untuk mengungkapkan perasaannya .

Anhedonia: adalah suatu suasana perasaan yang diwarnai dengan kehilangan minat dan kesenangan terhadap berbagai aktivitas kehidupan.

Mood kosong: adalah kehidupan emosi yang sangat dangkal,tidak atau sangat sedikit memiliki penghayatan suasana perasaan. Individu dengan mood kosong nyaris kehilangan keterlibatan emosinya dengan kehidupan disekitarnya. Keadaan ini dapat dijumpai pada pasien skizofrenia kronis.

Mood labil:suasana perasaan yang berubah ubah dari waktu ke waktu. Pergantianperasaandarisedih, cemas, marah, eforia, munculbergantian, dan takterduga. Dapatditemukan pada gangguanpsikosisakut.

Moodiritabel: mudahmarah

suasanaperasaan dan

yang

sensitif,

mudahtersinggung, yang

seringkalibereaksiberlebihanterhadapsituasi

tidakdisenanginya. j. Macam-macam afek Afekadalahemosiatauperasaan yang

ditunjukkanolehpasiendandapatdiamatioleh orang lain, jadimerupakangejala

23

yang objektif yang dapatdilihatpadasaatpemeriksaanpsikiatrik. Berbedadengan mood yang merupakanpengalamansubjektif yang

dilaporkanolehpasien.Macam-macamafek,antara lain: a). Afekserasi Afek yang normal dimanasuasanaemosionalserasidengangagasan,

pikiranataupembicaraan.Individudenganafekserasimemilikitingkahlakudaneksp resi yang sesuaidengansuasanaemosionalnya. b). Afektidakserasi Afek yang tidaksesuaiantarasuasanaemosionaldengangagasan, yang

pikiranataupembicaraan

menyertainya.Individudenganafekinitingkahlakudanekspresinyatidaksesuaiden gansuasanaemosionalsepertitertawadisaatsedih. c). Afektumpul Suatugangguanafek yang manifestasinyadalampengurangan yang yang

beratdariintensitassuasanaperasaan ditampilkan.Individudenganafekiniekspresiperasaannyasangatkurang. d). Afekterbatas Penguranganintensitassuasanaperasaan

yang

tidakbegituberatdibandingkandenganafektumpul, tetapijelaspengurangannya. e). Afekdatar Afek yang tidakadaatauhampirtidakadanyasetiaptandapernyataanafektif, suaratidakberubah (monoton), wajahtidakbergerak, responafektifbenar-

benartidakada,biasanyaterdapatpadaskizofrenia. f). Afeklabil Perubahansuasanaperasaanemosional yang cepatdanmendadak yang

tidakadahubungannyadenganrangsangandariluar.Afekberubahdengancepatantar aberbagaikeadaanemosionalumpamanyadarimengangis-tertawa-marah (Nuhriawangsa, 2011).

24

k. Mekanisme gangguan mood dari segi neurokimiawi Terdapat peran neurotransmitter serotonin pada gangguan mood. Serotonin disintesa dari asam amino esensial tryptophan dalam 2 tahap enzimatis. Plasma tryptophan masuk blood brain barier secara aktif dengan melalui large neutral amino acid trasporter protein.perubahan fungsi serotonergik otak menunjukkan perubahan fungsi tubuh dan perilaku yang merupakan gejala klinis utama dari depresi, sepert nafsu akan, tidur, fungsi seksual, sensitivitas nyeri, temperatur tubuh, dan irama sirkadian. Pelepasan serotonin hampir konstan sepanjang hari dan mereda selama tidur REM (Rapid Eye Movement). Pelepasan serotonin neuron elatif konstan namun responsif terhadap stres (Maramis, 2009). Penemuan penelitian yang paling konsisten adalah korelasi antara penurunan 5-HIAA (5-Hydroxy-Indole Acetic Acid), metabolit

serotonindengan impulsivitas, agresi dan suiside dengan kekerasan. Studi postmortem menemukan pengurangan jumlah SERT (Serotonin Transporter) di kortex frontalis orban bunuh diri dan di hipokampus dan kortex occipital pasien depresi. Studi lain melaporkan adanya 5-HT1A di dorsal raphe dan median raphe pada korban bunuh diri. Penelitian lain menemukan peningkatan reseptor 5-HT2 platelet darah pada pasien depresi atau bunuh diri (Maramis, 2009). Berdasarkan banyak data dapat disimpulkan bahwa kelainan patologis utama pada gangguan mood mungkin berada dalam saraf dari sirkuit otak yang membawahi emosi. Neuron ini tidak dapat mentolerasi peurnan serotonin dan modulasi noreepinefrin serta dopamin (Maramis, 2009).

4. Langkah IV : Menginventarisasi secara sistematik berbagai penjelasan yang didapatkan pada langkah III Dari hasil langkah II kami menyimpulkan bahwa keluhan pada pasien berupa depresi berulang dengan episode kini berat non psikotikdi mana pasien pernah mengalami gangguan serupa kurang lebih 1 tahun yang lalu.

25

5. Langkah V : Merumuskan tujuan pembelajaran LO yang belum terjawab antara lain : a. Bagaimana hubungan keluhan satu tahun yang lalu dengan keluhan yang dialami sekarang oleh pasien pada skenario? b. Bagaimana overview manik dan bipolar? c. Apa saja etiologi depresi? d. Bagaimana epidemiologi depresi? e. Bagaimana patofisiologi depresi yang terkait dengan skenario? f. Apa saja gejala, episode, dan tipe depresi? g. Bagaimana interpretasi hasil pemeriksaan status mental pada skenario? h. Apa saja pemeriksaan mental dan pemeriksaan penunjang yang dilakukan terkait dengan skenario? i. Bagaimana penatalaksanaan depresi? j. Bagaimana pencegahan depresi? k. Apakah kepribadian dapat diubah dan cara yang dilakukan bila dapat diubah pada kasus depresi?

6. Langkah VI : Belajar mandiri Langkah ini kami lakukan untuk mencari LO yang belum terjawab dan mempersiapkan diskusi pada pertemuan kedua tutorial

7. Langkah VII : Melaporkan, membahas dan menata kembali informasi baru yang diperoleh

1. Hubungan Keluhan Satu Tahun yang Lalu dengan Keluhan yang Dialami Sekarang oleh Pasien pada Skenario a. Gangguan Tidur dan Nafsu Makan Gangguan tidur merupakan salah satu gejala depresi. Pengukuran polisomnografi tidur menunjukan peningkatan sleep-onset latency, peningkatan aktivitas fase REM, peningkatan aktivitas EEG frekuensi cepat, dan penurunan aktivitas EEG slow-wave pada tahap non-REM (Germain, 2004).

26

Menggunakan fluorodeoxyglucose (FDG) positron emission tomography (PET), dilakukan pengukuran metabolisme otak dengan mengukur metabolisme glukosa otak. Orang depresi memiliki metabolisme glukosa otak total yang lebih tinggi daripada orang sehat pada tahap non-REM. Ini mendukung hipotesis overarousal pada orang depresi. Hipofrontalitas yang terjadi pada saat sadar mungkin mencegah reduksi aktivitas otak dari sesaat sebelum tidur hingga tahap non-REM. Pada orang normal, ada reduksi yang signifikan pada aktivitas otak di daerah kortikal selama tahap non-REM. Penurunan aktivitas kortikal tahap sebelum tidur sampai non-REM pada orang normal dikatakan sebagai penyebab restorasi fungsi kognitif selama tidur. Sedangkan pada orang depresi, kegagalan untuk menurunkan aktivitas kortikal terutama di daerah frontal dikatakan sebagai penyebab kelainan tidur dan tidur yang nonrestoratif (tidak segar) (Germain, 2004). Gangguan tidur pada orang depresi dapat berasal dari fungsi abnormal region yang berperan untuk memulai dan mempertahankan tahap non-REM. Selama transisi antara sadar sampai tahap non-REM, aktivitas neuronal diturunkan pada area yang menyebabkan arousal seperti locus coeruleus, raphe nuclei, dan tuberomammilary nucleus. Selama tahap itu juga neuron thalamocortical mengalami hiperpolarisasi. Area yang menyebabkan tidur terlokalisasi di preoptic hypothalamus menunjukkan peningkatan aktivitas selama tahap itu. Pada orang sehat, tahap non-REM ditandai dengan penurunan aktivitas metabolik dan aliran darah ke mesencephalic brainstem, thalamus, dan basal forebrain. Pada orang depresi gangguan tidur dikarenakan aktivitas abnormal pada struktur itu (Germain, 2004). Percobaan yang dilakukan oleh Germain et al menunjukkan hasil bahwa orang depresi menunjukkan penurunan yang kecil metabolisme glukosa regional di region frontal, parietal dan temporal, dan dorsomedial thalamus. Penemuan ini menunjukkan bahwa depresi dikarakteristikkan dengan deaktivasi kortikal dan thalamus yang kecil. Tetapi pada metabolisme seluruh bagian otak tidak menunjukkan peningkatan metabolisme dibandingkan orang sehat. Namun dengan kegagalan untuk menunjukkan penurunan aktivitas di daerah thalamus dan anterior forebrain serta aktivitas metabolic yang tetap di dorsomedial thalamus dan area yang berkaitan baik dengan prefrontal dan parietal cortices dapat menjadi penyebab tetapnya aktivitas metabolik frontal dan

27

parietal tahap non-REM pasien depresi. Deaktivasi frontal dan thalamus umumnya menyebabkan insomnia (Germain, 2004). Studi yang dilakukan oleh Bixler et al, mencari hubungan antara excessive daytime sleepness (EDS) dengan sleep apnea. Menggunakan metode cohort dilakukan pengukuran terhadap keluhan EDS. Subjek diambil acak (N=16.583) dengan rentang umur 20-100 tahun. Selanjutnya subjek (N=1.741) secara acak dilakukan pemeriksaan lebih lanjut di laboratorium tidur selama satu malam. Kemudian dilakukan evaluasi simultan terhadap faktor risiko yang luas terhadap terjadinya EDS di populasi umum. Hasilnya adalah pengobatan terhadap depresi yang sedang dilakukan memiliki hubungan yang paling kuat. Hal ini tidak berubah saat dilakukan kontrol dengan penggunaan obat antidepresan. Jadi hasilnya mendukung peranan depresi sebagai faktor risiko mayor di populasi umum. Perhitungan menunjukkan depresi sebagai faktor risiko yang paling signifikan untuk terjadinya EDS, diikuti oleh faktor risiko lain yaitu indeks massa tubuh, durasi tidur, diabetes, merokok, dan terakhir adalah sleep apnea. Keeratan hubungan depresi dengan EDS berkurang seiring dengan peningkatan umur. EDS sangat sering pada umur muda (<30 tahun) dan umur sangat tua (>75 tahun) (Bixler,2005). Review yang dilakukan oleh Chorney et al, menunjukkan banyak sumber yang menyebutkan hubungan yang erat antara depresi dengan gangguan tidur. Literatur dan sumber diambil dari database komputer dan bibliografi artikel yang relevan. Tujuan review adalah mengumpulkan dan mengevaluasi hubungan antara tidur, kecemasan, dan depresi pada anak dan menyediakan rekomendasi untuk penelitan di kemudian hari. Hasilnya banyak penelitian tentang hubungan gangguan tidur dengan kecemasan dan depresi, gejala penyakitnya banyak yang saling tumpang tindih antara depresi, kecemasan, dan tidur. Hubungan antara tidur dengan depresi lebih kuat daripada dengan kecemasan. Hubungan yang kuat ini ditemukan pada anak-anak, remaja, dan dewasa. Hasil penelitian dari beberapa literatur antara lain: (1). Anak dan remaja yang mengalami depresi mayor menunjukkan gejala insomnia yang signifikan. (2). Anak yang depresi mengalami masalah dengan sleep onset, bangun secara tiba-tiba, dan hipersomnia. (3). Remaja yang mengalami depresi menunjukkan gangguan tidur yang tinggi. (4). Hubungan yang kuat antara gangguan tidur dan depresi umum terjadi pada

28

orang dewasa. (5). Hubungan menjadi lebih kuat ketika anak berkembang menjadi remaja dan dewasa. (6) (Chorney, 2008). b. Fisiologi Tidur Normal Tidur normal memiliki empat tahapan mulai dari sesaat sebelum tidur sampai bermimpi, tiap tahap memiliki gelombang berbeda. Gelombang ini diukur dengan alat encephalogram (EEG). Pada saat orang akan bersiap tidur, gelombang alfa 8-12 Hz akan menyela gelombang tinggi-frekuensi rendah-voltase yang menandai active wakefulness (keadaan bangun aktif). Setelah itu, ketika orang tertidur, ada transisi yang tiba-tiba ke periode EEG tidur tahap 1. EEG tidur tahap 1 adalah sinyal tinggi-frekuensi rendah-voltase yang mirip tetapi lebih lamban dibanding yang tampak pada keadaan bangun aktif (Pinel, 2009). Ada peningkatan gradual pada voltase EEG dan penurunan pada frekuensi EEG ketika orang itu beranjak dari tidur tahap 1 ke tahap 2,3,4. Oleh sebab itu, EEG tidur tahap 2 memiliki amplitudo yang sedikit lebih tinggi dan frekuensi yang lebih rendah dibandingkan EEG tahap 1. EEG tidur tahap 3 didefinisikan oleh keberadaan gelombang delta, gelombang EEG paling lamban dengan frekuensi 1-12 Hz yang muncul sekali-sekali, sementara EEG tidur tahap 4 didefinisikan sebagai predominasi gelombang delta. Begitu subjek mencapai tidur tahap 4, mereka bertahan di tahap itu selama waktu tertentu, dan kemudian mundur kembali melalui tahap-tahap tidur sampai ke tahap 1. akan tetapi, ketika mereka kembali ke tahap 1, segala sesuatunya tidak persis sama dengan yang pertama. Periode pertama EEG tahap 1 selama sebuah tidur malam (initial stage 1 EEG) tidak ditandai oleh perubahan elektromiogradik atau elektrookulografik yang tajam sementara peride EEG tahap 1 berikutnya (emergent stage 1 EEG) disertai Rapid Eye Movement (REM) dan oleh hilangnya ketegangan otot batang tubuh. Ini merupakan tahap terjadinya mimpi (Pinel, 2009). Setelah siklus EEG tidur yang pertama (dari tahap 1-4 mundur lagi ke emergent stage), sepanjang malam dihabiskan maju mundur melalui tahap itu. Tiap siklus cenderung berlangsung 90 menit. Ketika malam semakin larut, semakin banyak waktu yang dihabiskan di emergent stage, dan semakin kurang waktu di tahap lain khususnya tahap 4. Aksi fisiologis lainnya seperti aktivitas serebral (konsumsi oksigen, penembakan neural) meningkat ke tingkat bangun, peningkatan aktivitas saraf

29

otonom: tensi, denyut nadi, respiration rate. Otot anggota badan bergerak terkejatkejat, ereksi klitoral dan penis pada tingkat tertentu (Pinel, 2009).

c. Gangguan Tidur Tidur adalah proses yang dibutuhkan otak untuk berfungsi secara tepat. Keseriusan dari gangguan tidur tidak diketahui oleh masyarakat umum karena mereka menganggap hal ini tidak berbahaya. International Classification of Sleep

Disorders(ICSD) merupakan klasifikasi paling lengkap untuk gangguan tidur dan sering digunakan. DSM-IV memasukkan banyak klasifikasi dari ICSD (Stores, 2003). Pasien dengan depresi mayor, 95% memiliki gangguan tidur menurut kriteria EEG. Perubahan tidur yang berhubungan dengan depresi termasuk gangguan secara umum dan arsitektural. Perubahan secara umum terdiri dari peningkatan latensi tidur, sering terbangun, dan terbangun terlalu awal di pagi hari diikuti kesulitan untuk melanjutkan tidur. Perubahan makroarsitektural termasuk pergeseran pusat slowwavesleep (SWS) dari NREM-REM pertama ke siklus selanjutnya, latensi REM biasanya juga memendek. Analisis mikroarsitektural menunjukkan peningkatan densitas gerakan mata, terutama awal periode tidur (Stores,2003).

d. Penyebab Gangguan Tidur (Depresi) Gangguan tidur dapat disebabkan oleh banyak hal atau bersifat holistik. Hal yang mempengaruhi adalah biopsikososial yaitu dari faktor genetik, psikologis, dan lingkungan. Sehingga bisa dikatakan penyebabnya sangat kompleks dan memerlukan investigasi yang cermat. Namun pada tulisan ini hanya akan dibahas salah satu penyebab gangguan tidur yaitu depresi. Etiologi depresi yang dapat dihubungkan dengan gangguan tidur

adalahterganggunya neurotransmiter serotonin. Serotonin berperan dalam pengontrolan afek, agresivitas, tidur, dan nafsu makan. Neuron serotoninergik berproyeksi dari nucleus rafe dorsalis batang otak ke korteks serebri, hipotalamus, ganglia basalis, septum, dan hipokampus. Proyeksinya ke tempat-tempat ini mendasari keterlibatannya pada gangguan psikiatrik. Ada sekitar 14 reseptor serotonin, namun satu transmiter saja dapat memberikan efek ke seluruh otak. Percobaan yang dilakukan pada tikus menunjukkan

30

gangguan pada 5-ht7 dapat mengurangi perilaku depresif dan penurunan durasi REM (Amir, 2004). Gangguan regulasi hormon dapat menyebabkan depresi yaitu CorticalHypothalamic-Pituitary-Adrenal Cortical Axis (CHPA). Mekanisme normalnya adalah adanya pengalaman buruk sehari-hari akan dicatat dalam korteks serebri dan sistem limbik sebagai stresor. Bagian otak ini akan mengirim pesan ke tubuh untuk mempersiapkan diri mengatasi stresor tersebut. Target organnya adalah kelenjar adrenal. Kelenjar ini akan mensekresikan kortisol untuk mempertahankan hidup. Kortisol berfungsi dalam mengatur tidur, nafsu makan, fungsi ginjal, sistem imun, dan semua faktor penting dalam kehidupan. Kadar kortisol turun pada saat malam sebelum tidur, sedangkan pada saat bangun pagi akan meningkat sehingga kita bisa bangun dengan segar. Peningkatan kortisol akan menyebabkan mekanisme umpan balik ke hipotalamus untuk mengurangi sekresi Corticotrophin Releasing Hormone (CRH) dan ke kelenjar hipofisis anterior untuk mengurangi sekresi Adenocorticotrophin Hormone(ACTH). Sistem CRH merupakan sistem yang paling terpengaruh oleh stresor yang dialami seseorang pada awal kehidupannya. Stresor yang berulang akan menyebabkan peningkatan sekresi CRH dan penurunan sensitivitas reseptor CRH adenohipofisis. Sehingga pada akhirnya sekresi kortisol juga terganggu. Stresor pada awal kehidupan ini dapat menyebabkan perubahan yang menetap pada sistem neurobiologik atau dapat membuat jejak pada sistem saraf yang berfungsi merespon stresor tersebut. Akibatnya seseorang akan rentan terhadap stresor dan risiko penyakit yang berkaitan dengan stresor menjadi meningkat. Salah satunya depresi pada saat dewasa (Amir, 2004).

e. Gangguan Tidur sebagai Penyebab Depresi Review yang dilakukan oleh Chorney et al, pada banyak sumber menunjukkan hasil yang sama yaitu peningkatan risiko depresi. Hubungan antara tidur dengan depresi lebih kuat daripada gangguan mood lainnya. Hubungan yang kuat ditemukan pada hampir seluruh kategori umur. Hasil penelitian dari beberapa literatur antara lain: (1) Remaja yang kurang tidur menunjukkan tingkat depresi yang tinggi (2). Orang dewasa dengan gangguan tidur hampir memiliki risiko dua kali menjadi depresi (3). Salah satu studi menunjukkan bahwa anak yang mengalami gangguan tidur memiliki peningkatan risiko

31

mengalami depresi atau kecemasan. Hasil itu juga mendukung studi selanjutnya yang menyatakan bahwa 73% anak depresi diawali dengan insomnia atau hipersomnia (Chorney, 2008).

f. Hubungan Gangguan Tidur dan Nafsu Makan dengan Faktor Biologi Depresi Beberapa penelitian menunjukkan bahwa terdapat kelainan pada amin biogenik, seperti: 5 HIAA (5-Hidroksi indol asetic acid), HVA (Homovanilic acid), MPGH (5 methoxy-0-hydroksi phenil glikol), di dalam darah, urin dan cairan serebrospinal pada pasien gangguan mood. Neurotransmiter yang terkait dengan patologi depresi adalah serotonin dan epineprin. Penurunan serotonin dapat mencetuskan depresi, dan pada pasien bunuh diri, beberapa pasien memiliki serotonin yang rendah. Pada terapi despiran mendukung teori bahwa norepineprin berperan dalam patofisiologi depresi (Kaplan, 2010). Norepinefrin memiliki fungsi mengatur fungsi pernafasan, pikiran, persepsi, daya penggerak, fungsi kardiovaskuler, tidur dan bangun. Serotonin berfungsi mengatur tidur, bangun, libido, nafsu makan, perasaan, agresi persepsi nyeri, koordinasi dan penilaian. Abnormalitas pada kedua neurotransmitter tersebut dapat menyebabkan gangguan tidur dan nafsu makan. Selain itu aktivitas dopamin pada depresi adalah menurun. Hal tersebut tampak pada pengobatan yang menurunkan konsentrasi dopamin seperti Respirin, dan penyakit dimana konsentrasi dopamin menurun seperti parkinson, adalah disertai gejala depresi. Obat yang meningkatkan konsentrasi dopamin, seperti tyrosin, amphetamine, dan bupropion, menurunkan gejala depresi (Kaplan, 2010).

g. Depresi berulang Dari skenario pasien mengalami depresi berulang. Berdasarkan PPDGJ III, gejalagejala depresi sebagai berikut: Gejala utama

- Afek depresif - Kehilangan minat dan kegembiraan - Berkurangnya energi yang menuju meningkatnya keadaan mudah lelah Gejala lainnya

- Konsentrasi dan perhatian berkurang

32

- Harga diri dan kepercayaan diri berkurang - Gagasan tentang rasa bersalah dan tidak berguna - Pandangan masa depan yang suram dan pesimistis - Gagasan atau perbuatan yang membahayakan diri atau bunuh diri - Tidur terganggu - Nafsu makan berkurang Pasien yang mengalami sekurangnya dua episode depresi diklasifikasikan dalam DSM IV sebagai menderita gangguan depresi berat berulang. Masalah utama dalam mendiagnosis episode rekuren gangguan depresif adalah memutuskan kriteria apa yang digunakan untuk menandakan resolusi masing-masing periode. Dua variabel adalah derajat resolusi gejala dan lamanya resolusi. Tiap episode depresi yang jelas dipisahkan oleh sekurangnya periode dua bulan, di mana selama periode itu pasien tidak memiliki gejala depresi yang bermakna. Kriteria diagnostik untuk Gangguan Depresif Berulang menurut DSM-IV: Adanya episode depresif tunggal Episode depresif tidak lebih baik diterangkan oleh gangguan skizoafektif, dan tidak

bertumpang tindih dengan skizofrenia, gangguan skizofreniform, gangguan delusional, atau gangguan psikotik yang tidak ditentukan. Tidak pernah terdapat episode manik, episode campuran, atau episode hipomanik. Jika semua kriteria memenuhi diagnosis suatu episode depresi, tentukan status klinis: - Ringan, sedang, atau berat, dengan atau tanpa gejala psikotik - Kronis - Dengan ciri katatonik - Dengan ciri melankolik - Dengan ciri atipikal - Dengan onset pasca persalinan Jika tidak semua kriteria memenuhi diagnosis suatu episode depresi berat, tentukan status klinis: - Remisi sebagian, remisi penuh - Kronik

33

- Dengan ciri katatonik - Dengan ciri melankolik - Dengan ciri atipikal - Dengan onset pasca persalinan Sebutkan: - Penentu perjalanan longitudinal (dengan atau tanpa pemulihan interepisode) - Dengan pola musiman Sedangkan, pedoman diagnostik untuk Gangguan Depresif Berulang (F33) menurut PPDGJ III: Gangguan ini tersifat dengan episode berulang dari:

- Episode depresi ringan (F32.0) - Episode depresi sedang (F32.1) - Episode depresi berat (F32.2 dan F32.3) Episode masing-masing rata-rata lamanya sekitar 6 bulan, akan tetapi frekuensinya lebih jarang dibandingkan dengan gangguan bipolar. Tanpa riwayat adanya episode tersendiri dengan peninggian afek dan hiperaktivitas

yang memenuhi kriteria mania (F30.1 dan F30.2). Namun kategori ini tetap harus digunakan jika ternyata ada episode singkat dari peninggian afek dan hiperaktivitas ringan yang memenuhi kriteria hipomania (F30.0) segera sesudah suatu episode depresif (kadang-kadang tampaknya dicetuskan oleh tindakan pengobatan depresi). Pemulihan keadaan biasanya sempurna di antara episode, namun sebagian kecil pasien

mungkin mendapat depresi yang akhirnya menetap, terutama pada usia lanjut (untuk keadaan ini, kategori ini harus tetap digunakan). Episode masing-masing, dalam berbagai tingkat keparahan, seringkali dicetuskan oleh

peristiwa kehidupan yang penuh stress atau trauma mental lain (adanya stress tidak esensial untuk penegakan diagnosis). Pedoman diagnostik Gangguan Depresif Berulang, Episode Kini Ringan (F33.0): Kriteria untuk gangguan depresif berulang (F33.-) harus dipenuhi, dan episode

sekarang harus memenuhi kriteria untuk episode depresif sedang (F32.1); dan

34

Sekurang-kurangnya dua episode telah berlangsung masing-masing selama minimal 2

minggu dengan sela waktu beberapa bulan tanpa gangguan afektif yang bermakna. Karakter kelima: F33.00 Tanpa gejala somatik

F33.01 Dengan gejala somatik Pedoman diagnostik Gangguan Depresif Berulang, Episode Kini Sedang (F33.1): 3 Kriteria untuk gangguan depresif berulang (F33.-) harus dipenuhi, dan episode Sekurang-kurangnya dua episode telah berlangsung masing selama minimal 2 minggu

sekarang harus memenuhi kriteria untuk episode depresif ringan (F32.0); dan

dengan sela waktu beberapa bulan tanpa gangguan afektif yang bermakna. Karakter kelima: F33.10 Tanpa gejala somatik

F33.11 Dengan gejala somatik Pedoman diagnostik Gangguan Depresif Berulang, Episode Kini Berat tanpa Gejala Psikotik (F33.2): 3 Kriteria untuk gangguan depresif berulang (F33.-) harus dipenuhi, dan episode

sekarang harus memenuhi kriteria untuk episode depresif berat tanpa gejala psikotik (F32.2); dan Sekurang-kurangnya dua episode telah berlangsung masing-masing selama minimal 2

minggu dengan sela waktu beberapa bulan tanpa gangguan afektif yang bermakna. Pedoman diagnostik Gangguan Depresif Berulang, Episode Kini Berat dengan Gejala Psikotik (F33.2): 3 Kriteria untuk gangguan depresif berulang (F33.-) harus dipenuhi, dan episode

sekarang harus memenuhi kriteria untuk episode depresif berat dengan gejala psikotik (F32.3); dan Sekurang-kurangnya dua episode telah berlangsung masing-masing selama minimal 2

minggu dengan sela waktu beberapa bulan tanpa gangguan afektif yang bermakna.

Pedoman diagnostik Gangguan Depresif Berulang, Kini dalam Remisi (F33.4): 3 Kriteria untuk gangguan depresif berulang (F33.-) harus pernah dipenuhi di masa

lampau, tetapi keadaan sekarang seharusnya tidak memenuhi kriteria untuk episode depresif dengan derajat keparahan apapun atau gagguan lain apapun dalam F30-F39; dan

35

Sekurang-kurangnya dua episode telah berlangsung masing-masing selama minimal 2

minggu dengan sela waktu beberapa bulan tanpa gangguan afektif yang bermakna

2. Overview Manik dan Bipolar a. Manik Manik adalah peningkatan suasana perasaan yang ditunjukkan dengan sikap yang meluap-luap, flight of ideas, peninggian harga diri, dan gagasan kebesaran. Diagnosis episode manik: a). Periode mood yang meninggi, ekspansif atau mudah tersinggung secara persisten, selama minimal 1 minggu b). Tiga atau lebih gejala berikut yang menetap: harga diri yang melambung/kebesaran, penurunan kebutuhan tidur, lebih banyak bicara, flight of ideas, perhatian mudah beralih, peningkatan aktivitas atau agitasi psikomotor, terlibat dalam aktivitas menyenangkan tetapi mempunyai kemungkinan tinggi yang menyakitkan/membahayakan.

b. Bipolar Ada dua tipe: 1. Bipolar I : episode manik/hipomanik dengan riwayat

manik/hipomanik/depresi/campuran 2. Bipolar II: episode depresi dengan riwayat manik/hipomanik Etiologi: 1. Faktor biologis: ketidakseimbangan antara amin biogenik (norepinefrin dan serotonin) 2. Faktor genetik: kembar monozigot (33 90%), kembar dizigot (25%), 50% pasien bipolar mempunyai orang tua dengan gangguan mood 3. Faktor psikososial Patogenesis:

36

- Gangguan bipolar I biasanya didahului dengan gangguan depresi (75% pada wanita dan 67% pada laki-laki) - Rekuren dengan interval antar episode 6 9 bulan - Episode manik yang tidak diobati berlangsung 3 bulan

3. Etiologi depresi Kaplan menyatakan bahwa faktor penyebab depresi dapat secara buatan dibagi menjadi faktor biologi, faktor genetik, dan faktor psikososial. a. Faktor biologi Beberapa penelitian menunjukkan bahwa terdapat kelainan pada amin biogenik, seperti: 5 HIAA (5-Hidroksi indol asetic acid), HVA (Homovanilic acid), MPGH (5 methoxy-0-hydroksi phenil glikol), di dalam darah, urin dan cairan serebrospinal pada pasien gangguan mood. Neurotransmiter yang terkait dengan patologi depresi adalah serotonin dan epineprin. Penurunan serotonin dapat mencetuskan depresi, dan pada pasien bunuh diri, beberapa pasien memiliki serotonin yang rendah. Pada terapi despiran mendukung teori bahwa norepineprin berperan dalam patofisiologi depresi (Kaplan, 2010). Selain itu aktivitas dopamin pada depresi adalah menurun. Hal tersebut tampak pada pengobatan yang menurunkan konsentrasi dopamin seperti Respirin, dan penyakit dimana konsentrasi dopamin menurun seperti parkinson, adalah disertai gejala depresi. Obat yang meningkatkan konsentrasi dopamin, seperti tyrosin, amphetamine, dan bupropion, menurunkan gejala depresi (Kaplan, 2010). Hipotalamus merupakan pusat pengaturan aksis neuroendokrin, menerima input neuron yang mengandung neurotransmiter amin biogenik. Pada pasien depresi ditemukan adanya disregulasi neuroendokrin. Disregulasi ini terjadi akibat kelainan fungsi neuron yang mengandung amin biogenik. Sebaliknya, stres kronik yang mengaktivasi aksis

Hypothalamic-Pituitary-Adrenal (HPA) dapat menimbulkan perubahan pada amin biogenik sentral. Aksis neuroendokrin yang paling sering terganggu yaitu adrenal, tiroid, dan aksis hormon pertumbuhan. Aksis HPA merupakan aksis yang paling banyak diteliti (Landefeld et al, 2004). Hipersekresi CRH merupakan gangguan aksis HPA yang sangat fundamental pada 37

pasien depresi. Hipersekresi yang terjadi diduga akibat adanya defek pada sistem umpan balik kortisol di sistem limpik atau adanya kelainan pada sistem monoaminogenik dan neuromodulator yang mengatur CRH (Kaplan, 2010). Sekresi CRH dipengaruhi oleh emosi. Emosi seperti perasaan takut dan marah berhubungan dengan Paraventriculer nucleus (PVN), yang merupakan organ utama pada sistem endokrin dan fungsinya diatur oleh sistem limbik. Emosi mempengaruhi CRH di PVN, yang menyebabkan peningkatan sekresi CRH (Landefeld, 2004). Pada orang lanjut usia terjadi penurunan produksi hormon estrogen. Estrogen berfungsi melindungi sistem dopaminergik negrostriatal terhadap neurotoksin seperti MPTP, 6 OHDA dan

methamphetamin. Estrogen bersama dengan antioksidan juga merusak monoamine oxidase (Unutzer dkk, 2002). Kehilangan saraf atau penurunan neurotransmiter. Sistem saraf pusat mengalami kehilangan secara selektif pada sel sel saraf selama proses menua. Walaupun ada kehilangan sel saraf yang konstan pada seluruh otak selama rentang hidup, degenerasi neuronal korteks dan kehilangan yang lebih besar pada sel-sel di dalam lokus seroleus, substansia nigra, serebelum dan bulbus olfaktorius (Lesler, 2001). Bukti menunjukkan bahwa ada ketergantungan dengan umur tentang penurunan aktivitas dari noradrenergik, serotonergik, dan dopaminergik di dalam otak. Khususnya untuk fungsi aktivitas menurun menjadi setengah pada umur 80-an tahun dibandingkan dengan umur 60-an tahun (Kane dkk, 1999). b. Faktor Genetik Penelitian genetik dan keluarga menunjukkan bahwa angka resiko di antara anggota keluarga tingkat pertama dari individu yang menderita depresi berat (unipolar) diperkirakan 2 sampai 3 kali dibandingkan dengan populasi umum. Angka keselarasan sekitar 11% pada kembar dizigot dan 40% pada kembar monozigot (Davies, 1999). Oleh Lesler (2001), Pengaruh genetik terhadap depresi tidak disebutkan secara khusus, hanya disebutkan bahwa terdapat penurunan dalam ketahanan dan kemampuan dalam menanggapi stres. Proses menua bersifat individual, sehingga dipikirkan kepekaan seseorang terhadap penyakit adalah genetik. c. Faktor Psikososial

38

Menurut Freud dalam teori psikodinamikanya, penyebab depresi adalah kehilangan objek yang dicintai (Kaplan, 2010). Ada sejumlah faktor psikososial yang diprediksi sebagai penyebab gangguan mental pada lanjut usia yang pada umumnya berhubungan dengan kehilangan. Faktor psikososial tersebut adalah hilangnya peranan sosial, hilangnya otonomi, kematian teman atau sanak saudara, penurunan kesehatan, peningkatan isolasi diri, keterbatasan finansial, dan penurunan fungsi kognitif (Kaplan, 2010) Sedangkan menurut Kane, faktor psikososial meliputi penurunan percaya diri, kemampuan untuk mengadakan hubungan intim, penurunan jaringan sosial, kesepian, perpisahan, kemiskinan dan penyakit fisik (Kane, 1999). Faktor psikososial yang mempengaruhi depresi meliputi: peristiwa kehidupan dan stressor lingkungan, kepribadian, psikodinamika, kegagalan yang berulang, teori kognitif dan dukungan sosial (Kaplan, 2010). Peristiwa kehidupan dan stresor lingkungan. Peristiwa kehidupan yang menyebabkan stres, lebih sering mendahului episode pertama gangguan mood dari episode selanjutnya. Para klinisi mempercayai bahwa peristiwa kehidupan memegang peranan utama dalam depresi, klinisi lain menyatakan bahwa peristiwa kehidupan hanya memiliki peranan terbatas dalam onset depresi. Stressor lingkungan yang paling berhubungan dengan onset suatu episode depresi adalah kehilangan pasangan (Kaplan, 2010). Stressor psikososial yang bersifat akut, seperti kehilangan orang yang dicintai, atau stressor kronis misalnya kekurangan finansial yang berlangsung lama, kesulitan hubungan interpersonal, ancaman keamanan dapat menimbulkan depresi (Hardywinoto, 1999). Beberapa ciri kepribadian tertentu yang terdapat pada individu, seperti kepribadian dependen, anankastik, histrionik, diduga mempunyai resiko tinggi untuk terjadinya depresi. Sedangkan kepribadian antisosial dan paranoid (kepribadian yang memakai proyeksi sebagai mekanisme defensif) mempunyai resiko yang rendah (Kaplan, 2010). Faktor psikodinamika. Berdasarkan teori psikodinamika Freud, dinyatakan bahwa kehilangan objek yang dicintai dapat menimbulkan depresi (Kaplan, 2010). Dalam upaya untuk mengerti depresi, Sigmud Freud sebagaimana dikutip Kaplan (2010) mendalilkan suatu hubungan antara kehilangan objek dan melankolia. Ia menyatakan bahwa kekerasan yang dilakukan pasien depresi diarahkan secara internal karena identifikasi dengan objek yang hilang.

39

Freud percaya bahwa introjeksi mungkin merupakan cara satu-satunya bagi ego untuk melepaskan suatu objek, ia membedakan melankolia atau depresi dari duka cita atas dasar bahwa pasien terdepresi merasakan penurunan harga diri yang melanda dalam hubungan dengan perasaan bersalah dan mencela diri sendiri, sedangkan orang yang berkabung tidak demikian. Kegagalan yang berulang. Dalam percobaan binatang yang dipapari kejutan listrik yang tidak bisa dihindari, secara berulang-ulang, binatang akhirnya menyerah tidak melakukan usaha lagi untuk menghindari. Disini terjadi proses belajar bahwa mereka tidak berdaya. Pada manusia yang menderita depresi juga ditemukan ketidakberdayaan yang mirip (Kaplan, 2010). Adanya interpretasi yang keliru terhadap sesuatu, menyebabkan distorsi pikiran menjadi negatif tentang pengalaman hidup, penilaian diri yang negatif, pesimisme dan keputusasaan. Pandangan yang negatif tersebut menyebabkan perasaan depresi (Kaplan, 2010).

4. Epidemiologi Depresi Insidensi dari gangguan depresi mayor di Amerika mencapai 20% pada laki laki dan 12% pada perempuan. Berdasarkan laporan dari Klerman dan Gershon menyatakan bahwa terjadi peningkatan yang progresif pada insidensi depresi mayor dalam 70 tahun terakhir (Klerman, 1988; Gershon et al, 1987). Pada tahun 2010 berdasarkan laporan dari Centers of Disease Control and prevention (CDC) dari 235.067 orang diadapatkan 9% mempunyai kriteria depresi, dan sekitar 3,4% memiliki gejala depresi mayor (CDC, 2010). Wanita memiliki faktor resiko yang lebih tinggi dalam kejadian depresi, 14,8% wanita menderita depresi sedangkan pada pria hanya sekitar 9,8%. Berdasarkan penelitian colaborative dari World Health Organization (WHO) ditemukan kesamaan gejala di berbagai negara didunia yang berbeda kebudayaan seperti Canada, Iran, Jepang, dan Swiss (CDC, 2010). Berikut adalah data epidemiologi Depresi berdasarkan faktor-faktor resiko : Insiden dan prevalensi. Gangguan depresi berat, paling sering terjadi, dengan prevalensi seumur hidup sekitar 15%. Perempuan dapat mencapai 25%. Sekitar 10% di perawatan primer dan 15% dirawat di rumah sakit. Pada anak sekolah didapatkan prevalensi sekitar 2%. Pada usia remaja didapatkan prevalensi 5% dari komunitas memiliki gangguan depresif berat (Elvira, 2010).

40

Jenis kelamin. Perempuan dua kali lipat lebih besar daripada laki-laki. Diduga adanya perbedaan hormon, pengaruh melahirkan, perbedaan stressor psikososial antara lakilaki dan perempuan, dan model perilaku yang dipelajari tentang ketidakberdayaan (Elvira, 2010). Menurut TheNational Institute of Mental Health (NIMH) depresi biasanya lebih banyak terjadi pada perempuan dibandingkan dengan laki-laki. Hal tersebut terjadi karena dipengaruhi oleh hormon. Biasanya depresi juga terjadi pada rata-rata umur 32 tahun. Depresi tidak dipengaruhi oleh asal suku. Usia. Rata-rata usia sekitar 40 tahun-an. Hampir 50% awitan diantara usia 20-50 tahun. Gangguan depresi berat dapat timbul pada masa kanak atau lanjut usia. Data terkini menunjukkan gangguan depresi berat diusia kurang dari 20 tahun. Mungkin berhubungan dengan meningkatnya pengguan alkohol dan penyalahgunaan zat dalam kelompok usia tersebut (Elvira, 2010). Status perkawinan. Paling sering terjadi pada orang yang tidak mempunyai hubungan interpersonal yang erat atau pada mereka yang bercerai atau berpisah. Wanita yang tidak menikah memiliki kecenderungan lebih rendah untuk menderita depresi dibandingkan dengan yang menikah namun hal ini berbanding terbalik untuk laki-laki (Elvira, 2010). Faktor sosioekonomi dan budaya. Tidak ditemukan korelasi antara status sosioekonomi dan gangguan depresi berat. Depresi lebih sering terjadi di daerah pedesaan dibanding daerah perkotaan (Elvira, 2010).

5. Patofisiologi Depresi yang Terkait dengan Skenario Teori patofisiologi depresi: 1. The Biogenic Amine Hypothesis (Hipotesis Amina Biogenik) Teori Amina Biogenik menyatakan bahwa depresi disebabkan karena kekurangan (defisiensi) senyawa monoamin, terutama : noradrenalin dan serotonin. Karena itu, menurut teori ini depresi dapat dikurangi oleh obat yang dapat meningkatkan ketersediaan serotonin dan noradrenalin, misalnya MAO inhibitor atau antidepresan trisiklik. Namun, teori ini tidak dapat menjelaskan fakta mengapa onset obat-obat antidepresan umumnya lama (6-8 minggu), padahal obat-obat tadi bisa meningkatkan ketersediaan neutrotransmiter secara cepat. Muncullah hipotesis sensitivitas reseptor.

41

2. Hipotesis Sensitivitas Reseptor Teori : depresi merupakan hasil perubahan patologis pada reseptor, yang diakibatkan oleh terlalu kecilnya stimulasi oleh monoamin. Saraf post-sinaptik akan berrespon sebagai kompensasi terhadap besar-kecilnya stimulasi oleh neurotransmiter. Jika stimulasi terlalu kecil saraf akan menjadi lebih sensitif (supersensitivity) atau jumlah reseptor meningkat (up-regulasi). Jika stimulasi berlebihan saraf akan mengalami desensitisasi atau down-regulasi. Obat-obat antidepresan umumnya bekerja meningkatkan neurotransmiter , meningkatkan stimulasi saraf dan menormalkan kembali saraf yang supersensitif. Proses ini membutuhkan waktu dan menjelaskan mengapa aksi obat antidepresan tidak terjadi secara segera dan cepat. 3. Hipotesis permisif Menurut teori ini: kontrol emosi diperoleh dari keseimbangan antara serotonin dan noradrenalin. Serotonin memiliki fungsi regulasi terhadap noradrenalin yaitu menentukan kondisi emosi depresi atau manik. Teori ini mempostulatkan : kadar

serotonin yang rendah dapat menyebabkan(permit) kadar noradrenalin menjadi tidak normal yang dapat menyebabkan gangguan mood. Jika kadar serotonin rendah dan noradrenalin rendah akan mengakibatkan depresi . Jika kadar serotonin rendah,

noradrenalin tinggi maka akan muncul gejala manik. Menurut hipotesis ini, meningkatkan kadar 5-HT akan memperbaiki kondisi sehingga tidak muncul bakat gangguan mood. 4. Dysregulation hypothesis Gangguan depresi dan psikiatrik disebabkan oleh ketidateraturan neurotransmiter, antara lain : Gangguan regulasi mekanisme homeostasis Gangguan pada ritmik sirkadian Gangguan pada sistem regulasi sehingga terjadi penundaan level neurotransmiter

untuk kembali ke baselin (Maramis, 2009).

6. Gejala, Episode, dan Tipe Depresi a. Gejala depresi Gejala Utama (pada derajat ringan, sedang dan berat) :

42

1. Afek depresi 2. Kehilangan minat dan kegembiraan, dan 3. Berkurangnya energi yang menuju meningkatnya keadaan mudah lelah (rasa lelah yang nyata sesudah kerja sedikit saja) dan menurunnya aktivitas. Gejala lainnya : a. Konsentrasi dan perhatian kurang b. Harga diri dan kepercayaan diri berkurang c. Gagasan tentang rasa bersalah dan tidak berguna d. Pandangan masa depan yang suram dan pesimistis e. Gagasan atau perbuatan membahayakan diri atau bunuh diri f. Tidur terganggu g. Nafsu makan berkurang Untuk episode depresif dari ketiga tingkat keparahan tersebut diperlukan masa sekurangkurangnya 2 minggu untuk penegakan diagnosis, akan tetapi periode lebih pendek dapat dibenarkan jika gejala luar biasa beratnya dan berlangsung cepat. Kategori diagnosis episode depresif ringan, sedang dan berat hanya digunakan untuk episode untuk episode tunggal (yang pertama). Episode depresif berikutnya harus diklasifikasikan di bawah salah satu diagnosis gangguan depresif berulang (PPDGJ III, 2001). b. Episode depresi Depresi ringan: terdapat minimal 2 dari 3 gejala utama + minimal 2 gejala lain Depresi sedang: terdapat minimal 2 dari 3 gejala utama+ minimal 3 (sebaiknya 4) gejala lain Depresi berat: terdapat 3 gejala utama + minimal 4 gejala lain, dengan / tanpa gejala psikotik (PPDGJ III,2001). c. Tipe depresi Tipe Depresi 1. Episode depresi 2. Depresi berulang Definisi Depresi yang baru pertama kali muncul Depresi yang muncul kemudian dan sebelumnya memiliki riwayat berulang

43

3. Gangguan afektif bipolar

Depresi yang didapat sekarang, sebelumnya ada riwayat manik.

4. Skizoafektif tipe depresif (Skizodepresif) 5. Depresi yang menyertai

Depresi yang bersama-sama dengan gejala psikotik yang nyata Gangguan mental organik Gangguan medik umum

7. Interpretasi Hasil Pemeriksaan Status Mental pada Skenario Hipoaktif (hipokinesis) Hipoaktif merupakan suatu keadaan menurunnya aktivitas motorik dan kognitif seperti pada retardasi pikomotorik. Proses pikir, pembicaraan, dan gerakan juga menjadi lambat. Hipoaktif dapat dijumpai pad pasien yang sedang mengalami depresi (Nuhriawangsa, 2011). Remming Remming merupakan suatu keadaan dimana arus hubungan yang terjadi menjadi lambat sebagai akibat dari adanya kesedihan seperti yang terjadi dalam keadaan depresi. Terjadi hambatan pengucapan kata-kata dalam kalimat yang dibicarakan pasien. Remming juga dapat disebabkanoleh pengaruh dari annxietas dan preokupasi atau berbagai gangguan otak termasuk sindroma prefrontal dan paska kontusio serta delirium (Nuhriawangsa, 2011). Mood Depresi Mood adalah keadaaan suasana hati yang menetap dan subjektif yang dilaporkan oleh pasien, bersifat lebih menetap dan lebih fleksibel dalam jangka waktu tertentu. Mood dapat diartikan juga sebagai suatu suasana hati yang dialami seseorang dalam dirinya, tidak termasuk ekpresi keluar dari suasana hati yang ada dalam diri orang tersebut. Ciri khas mood adalah bentuk emosi yang digambarkan dalam ekspresi sedih, susah, senang, gembira, marah, cemas, dan lain-lain (Nuhriawangsa, 2011). Mood depresi (dalam arti sempit) merupakan perasaan sedih yang bersifat psikopatologis. Keadaan mood yang berkisar antara susah atau tidak gembira tahap rendah sampai ke kemurungan yang nyata dan keputusasaan. Pada tingkat yang ekstrim biasanya

44

disertai pesimisme yang mencolok dan kurangnya harapan masa depan. Keadaan mental atau emosi pasien berada di bawah normal, tipe melankolik yang sedang, berperangai murung dan muram (Nuhriawangsa, 2011). Afek Menyempit Afek adalah suasana perasaan emosional yang terkait pada objek, gagasan, atau pikiran, termasuk yang dirasakan dalam hati dan manifestasi keluarnya. Emosi atau perasaan yang ditunjukkan oleh pasien dapat diamati oleh orang lain sehingga merupakan gejala yang objektif (tanda) yang dapat dilihat pada saat pemeriksaan psikiatrik (Nuhriawangsa, 2011). Pada afek menyempit (constricted), terdapat pengurangan intensitas suasana perasaan yang tidak begitu berat dibandingkan dengan afek tumpul, tetapi pengurangan yang terjadi cukup jelas (Nuhriawangsa, 2011). Insight (Tilikan Diri) derajat 5 Tilikan adalah kemampuan seseorang untuk memahami sebab sesungguhnya dan arti dari suatu situasi (termasuk di dalamnya dari gejala itu sendiri) (Nuhriawangsa, 2011). Dalam arti luas, tilikan sering disebut sebagai wawasan diri, yaitu pemahaman seseorang terhadap kondisi dan situasi dirinya dalam konteks realitas sekitarnya. Dalam arti sempit merupakan pemahaman pasien terhadap penyakitnya. Tilikan terganggu artinya kehilangan kemampuan untuk memahami kenyataan obyektif akan kondisi dan situasi dirinya. Tilikan diri derajat 5 menandakan pasien menyadari penyakitnya dan faktor-faktor yang berhubungan dengan penyakitnya namun tidak menerapkan dalam perilaku praktisnya.

8. Pemeriksaan Status Mental dan Pemeriksaan Penunjang yang Terkait dengan Skenario a. Pemeriksaan Status Mental Episode Depresif :

Deskripsi umum : Retardasi psikomotor menyeluruh merupakan gejala yang paling umum, walaupun agitasi psikomotor juga sering ditemukan khususnya pada pasien lansia. Secara klasik, seorang pasien depresi memiliki postur yang membungkuk tidak terdapat pergerakan spontan, pandangan mata yang putus asa dan memalingkan pandangan.

Mood, afek dan perasaan : Pasien tersebut sering kali dibawa oleh anggota keluarganya atau teman kerjanya karena penarikan sosial dan penurunan aktifitas secara menyeluruh.

45

Bicara : Banyak pasien terdepresi menunjukkan suatu kecepatan dan volume bicara yang menurun, berespon terhadap pertanyaan dengan kata tunggal dan menunjukkan yang lambat terhadap suatu pertanyaan.

Gangguan Persepsi : Pasien terdepresi dengan waham atau halusinasi dikatakan menderita episode depresi berat dengan ciri psikotik. Waham sesuai mood pada pasien terdepresi adalah waham bersalah, memalukan, tidak berguna, kemiskinan, kegagalan, kejar, dan penyakit somatik terminal.

Pikiran : Pasien terdepresi biasanya memiliki pandangan negatif tentang dunia dan dirinya sendiri. Isi pikiran mereka sering kali melibatkan perenungan tentang kehilangan, bersalah, bunuh diri, dan kematian. Kira kira 10% memiliki gejala jelas gangguan berpikir, biasanya penghambatan pikiran dan kemiskinan isi pikiran.

Sensorium dan Kognisi : Daya ingat, kira kira 50 70% dari semua pasien terdepresi memiliki suatu gangguan kognitif yang sering kali dinamakan pseudodemensia depresif, dengan keluhan gangguan konsentrasi dan mudah lupa.

Pengendalian Impuls : Kira kira 10 15% pasien terdepresi melakukan bunuh diri dan kira kira dua pertiga memiliki gagasan bunuh diri. Resiko meninggi untuk melakukan bunuh diri saat mereka mulai membaik dan mendapatkan kembali energi yang diperlukan untuk merencanakan dan melakukan suatu bunuh diri (bunuh diri paradoksikal / paradoxical suicide).

Reliabilitas : Semua informasi dari pasien terlalu menonjolkan hal yang buruk dan menekankan yang baik. Episode Manik :

Deskriksi Umum : Pasien manik adalah tereksitasi, banyak bicara, kadang kadang mengelikan dan sering hiperaktif. Suatu waktu mereka jelas psikotik dan terdisorganisasi, memerlukan pengikatan fisik dan penyuntikan intra muskular obat sedatif.

Mood, afek dan perasaan : Pasien manik biasanya euforik dan lekas marah. Mereka memiliki toleransi frustasi yang rendah, yang dapat menyebabkan perasaan kemarahan dan permusuhan. Secara emosional adalah labil, beralih dari tertawa menjadi lekas marah menjadi depresi dalam beberapa menit atau jam.

Bicara : Pasien manik tidak dapat disela saat mereka bicara dan sering kali rewel dan penganggu bagi orang orang disekitarnya. Saat keadaan teraktifitas meningkat

46

pembicaraan penuh gurauan, kelucuan, sajak, permainan kata kata dan hal hal yang tidak relefan. Saat tingkat aktifitas meningkat lagi, asosiasi menjadi longgar, kemampuan konsentrasi menghilang, menyebabkan gagasan yang meloncat loncat (flight of idea), gado gado kata dan neologisme. Pada kegembiraan manik akut pembicaraan mungkin sama sekali inkoheren dan tidak dapat membedakan dari pembicaraan skizofrenik.

Gangguan Persepsi : Waham ditemukan pada 75% dari semua pasien manik. Waham sesuai mood seringkali melibatkan kesehatan, kemampuan atau kekuatan yang luar biasa. Dapat juga ditemukan waham dalam halusinasi aneh yang tidak sesuai mood.

Pikiran : Isi pikirannya termasuk tema kepercayaan dan kebesaran diri, sering kali perhatiannya mudah dialihkan. Fungsi kognitif ditandai oleh aliran gagasan yang tidak terkendali cepat.

Sensorium dan Kognisi : Secara kasar orientasi dan daya ingat adalah intak walaupun beberapa pasien manik mungkin sangat euforik sehingga mereka menjawab secara tidak tepat. Gejala tersebut disebut mania delirium (delirious mania) oleh Emil Kraepelin.

Pengendalian Impuls : Kira kira 75% pasien manik adalah senang menyerang atau mengancam.

Perimbangan dan Tilikan : Gangguan pertimbangan merupakan tanda dari pasien manik. Mereka mungkin melanggar peraturan dengan kartu kredit, aktifitas seksual dari finansial, kadang melibatkan keluarganya dalam kejatuhan finasial.

Reliabilitas : Pasien manik terkenal tidak dapat dipercaya dalam informasinya.

b. Pemeriksaan penunjang 1) Tes skrining The US Preventive Services Task Force (USPSTF) merekomendasikan orang dewasa menjalani tes skrining untuk depresi dalam praktik klinis yang dapat menjamin pengelolaan yang tepat, USPSTF menemukan bukti yang cukup untuk

merekomendasikan terhadap skrining rutin anak-anak atau remaja untuk depresi. Hal ini penting untuk memahami bahwa hasil yang diperoleh dari penggunaan setiap skala rating depresi tidak sempurna dalam berbagai populasi, terutama populasi geriatri. Tes skrining paling sederhana adalah satu pertanyaan: Apakah anda depresi? Sebuah analisis dikumpulkan menemukan bahwa skrining pertanyaan tunggal memiliki spesifisitas 97% tetapi, sensitivitas secara keseluruhan dari 32% dan, dengan demikian,

47

akan mengidentifikasi hanya 3 dari setiap 10 pasien dengan depresi dalam perawatan primer. Berikut test 2-pertanyaan alamat perasaan depresi dan anhedonia: Selama sebulan terakhir, anda telah terganggu oleh merasa sedih, tertekan, atau putus asa? Selama sebulan terakhir, anda telah terganggu oleh sedikit minat atau kesenangan dalam melakukan sesuatu? Dalam sebuah studi cross-sectional, 2 pertanyaan skrining ini menunjukkan sensitivitas 97% dan spesifisitas 67%. Instrumen skrining laporan diri lebih lanjut untuk depresi adalah sebagai berikut:

PHQ-9 - Skala depresi 9-item dari Patient Health Questionnaire, setiap item mencetak 0 sampai 3, menyediakan 0-27 keparahan skor

Beck Depression Inventory (BDI) - Sebuah skala gejala-rating 21-pertanyaan BDI untuk perawatan primer - Skala 7-pertanyaan diadaptasi dari BDI Zung Self-Penilaian Skala Depresi - Sebuah survei 20 item Skala Pusat Studi Epidemiologi Depresi (CES-D) - Sebuah instrumen 20-item yang memungkinkan pasien untuk mengevaluasi perasaan mereka, perilaku, dan pandangan dari minggu sebelumnya Berbeda dengan skala laporan diri di atas, Hamilton Depression Rating Scale

(HDRs) dilakukan oleh seorang profesional, bukan pasien dilatih. The HDRs memiliki 17 atau 21 item, mencetak skor 0-2 atau 0-4, total skor 0-7 dianggap normal, sedangkan skor 20 atau lebih tinggi mengindikasikan depresi cukup parah. Geriatric Depression Scale (GDS), meskipun dikembangkan untuk orang dewasa yang lebih tua, juga telah divalidasi pada orang dewasa yang lebih muda. The GDS terdiri dari 30 item, sebuah bentuk singkat GDS memiliki 15 item. Mengingat bahwa presentasi atipikal umum depresi pada populasi lanjut usia dapat menantang bahkan dokter paling berpengalaman, skala penilaian pada orang tua harus digunakan dan ditafsirkan hanya dalam konteks pemeriksaan yang lebih teliti untuk depresi. Pasien dengan gangguan depresi mayor sering mengeluh memori

48

buruk atau konsentrasi. Hal ini mungkin disebabkan oleh depresi itu sendiri atau ke demensia yang mendasari. Pada pasien yang lebih tua dengan demensia, Skala Cornell untuk Depresi pada Demensia dapat digunakan untuk menentukan kategori dan tingkat keparahan depresi. Dokter melengkapi skala berdasarkan observasi sebelumnya dan wawancara dengan pasien dan pengasuh pasien. 2) Pemeriksaan Laboratorium untuk Menyingkirkan Penyebab Organik Depresi adalah diagnosis klinis, berdasarkan riwayat dan temuan fisik. Tidak ada tes laboratorium diagnostik yang tersedia untuk mendiagnosis penyakit depresi, namun pemeriksaan laboratorium terfokus mungkin berguna untuk mengecualikan potensi penyakit medis yang mungkin hadir sebagai gangguan depresi mayor. Pemeriksaan laboratorium dapat mencakup hal-hal berikut: 1. Sel darah lengkap (CBC) count 2. Thyroid-stimulating hormone (TSH) 3. Vitamin B-12 4. Rapid plasma reagin (RPR) 5. Tes HIV 6. Elektrolit, termasuk kalsium, fosfat, dan kadar magnesium 7. Nitrogen urea darah (BUN) dan kreatinin 8. Tes fungsi hati (LFT) 9. Kadar alkohol dalam darah 10. Skrining toksikologi darah dan urin 11. Gas darah arteri (ABG) 12. Uji supresi deksametason (penyakit Cushing, tetapi juga positif dalam depresi) 13. Cosyntropin (ACTH) tes stimulasi (penyakit Addison) 3) Neuroimaging Neuroimaging dapat membantu memperjelas sifat dari penyakit neurologis yang dapat menghasilkan gejala psikiatrik, tetapi pemeriksaan ini mahal dan mungkin nilai dipertanyakan pada pasien tanpa defisit neurologis diskrit. Computed tomography (CT) atau magnetic resonance imaging (MRI) otak harus dipertimbangkan jika terdapat sindrom otak organik atau hipopituitarisme termasuk dalam diagnosis diferensial.

49

Positron emission tomography (PET) pencitraan menyediakan sarana untuk pemeriksaan reseptor mengikat ligan tertentu dan efek senyawa pada reseptor. Namun, PET bermasalah untuk digunakan dengan anak-anak dan remaja karena membutuhkan peralatan yang rumit dan menggunakan radiasi. Menggunakan single-photon emisi computed tomography (SPECT), Tutus et al. melaporkan perbedaan yang signifikan antara nilai indeks perfusi dari remaja yang tidak diobati dengan depresi dan orang-orang dari pasien kontrol. Para peneliti menemukan bahwa remaja dengan gangguan depresi mayor mungkin memiliki defisit aliran darah regional di anterofrontal kiri dan meninggalkan daerah korteks temporal, dengan perfusi asimetri kanan-kiri lebih besar dibandingkan pasien kontrol sehat (Halverson, 2013).

9. Penatalaksanaan Depresi a. Terapi Fisik dan Terapi Perubahan Perilaku ELECTRO CONVULSIVE THERAPY ( ECT ) ECT adalah terapi dengan melewatkan arus listrik ke otak. Metode terapi semacam ini sering digunakan pada kasus depresif berat atau mempunyai risiko bunuh diri yang besar dan respon terapi dengan obat antidepresan kurang baik. Pada penderita dengan risiko bunuh diri, ECT menjadi sangat penting karena ECT akan menurunkan risiko bunuh diri dan dengan ECT lama rawat di rumah sakit menjadi lebih pendek. Pada keadaan tertentu tidak dianjurkan ECT, bahkan pada beberapa kondisi tindakan ECT merupakan kontra indikasi. ECT tidak dianjurkan pada keadaan : - Usia yang masih terlalu muda ( kurang dari 15 tahun ) - Masih sekolah atau kuliah - Mempunyai riwayat kejang - Psikosis kronik - Kondisi fisik kurang baik - Wanita hamil dan menyusui

Selain itu, ECT dikontraindikasikan pada : penderita yang menderita epilepsi, TBC milier, tekanan tinggi intra kracial dan kelainan infark jantung.

50

Depresi berisiko kambuh manakala penderita tidak patuh, ketidaktahuan, pengaruh tradisi yang tidak percaya dokter, dan tidak nyaman dengan efek samping obat. Terapi ECT dapat menjadi pilihan yang paling efektif dan efek samping kecil. Terapi perubahan perilaku meliputi penghapusan perilaku yang mendorong terjadinya depresi dan pembiasaan perilaku baru yang lebih sehat. Berbagai metode dapat dilakukan seperti CBT (Cognitive Behaviour Therapy) yang biasanya dilakukan oleh konselor, psikolog dan psikiater (Depkes RI, 2007).

b. Psikoterapi Psikoterapi merupakan terapi yang digunakan untuk menghilangkan atau mengurangi keluhan-keluhan dan mencegah kambuhnya gangguan psikologik atau pola perilaku. maladaptif. Terapi dilakukan dengan jalan pembentukan hubungan profesional antara terapis dengan penderita. Psikoterapi pada penderita gangguan depresif dapat diberikan secara individu, kelompok, atau pasangan disesuaikan dengan gangguan psikologik yang mendasarinya. Psikoterapi dilakukan dengan memberikan kehangatan, empati, pengertian dan optimisme. Dalam pengambilan keputusan untuk melakukan psikoterapi sangat dipengaruhi oleh penilaian dari dokter atau penderitanya (Depkes RI, 2007).

c. Farmakoterapi 1) Antidepresan Klasik (Trisiklik & Tetrasiklik) Mekanisme kerja : Obatobat ini menghambat resorpsi dari serotonin dan noradrenalin dari sela sinaps di ujung-ujung saraf. Efek samping : -Efek jantung ; dapat menimbulkan gangguan penerusan impuls jantung dengan perubahan ECG, pada overdosis dapat terjadi aritmia berbahaya. -Efek anti kolinergik ; akibat blokade reseptor muskarin dengan menimbulkan antara lain mulut kering, obstipasi, retensi urin, tachycardia, serta gangguan potensi dan akomodasi, keringat berlebihan. -Sedasi

51

-Hipotensi ortostatis dan pusing serta mudah jatuh merupakan akibat efek antinoradrenalin, hal ini sering terjadi pada penderita lansia, mengakibatkan gangguan fungsi seksual. -Efek antiserotonin; akibat blokade reseptor 5HT postsinaptis dengan bertambahnya nafsu makan dan berat badan. -Kelainan darah; seperti agranulactose dan leucopenia, gangguan kulit -Gejala penarikan; pada penghentian terapi dengan mendadak dapat timbul antara lain gangguan lambung-usus, agitasi, sukar tidur, serta nyeri kepala dan otot. Obat-obat yang termasuk antidepresan klasik : Imipramin

Dosis lazim : 25-50 mg 3x sehari bila perlu dinaikkan sampai maksimum 250-300 mg sehari. Kontra Indikasi : Infark miokard akut Interaksi Obat : anti hipertensi, obat simpatomimetik, alkohol, obat penekan SSP Perhatian : kombinasi dengan MAO, gangguan kardiovaskular, hipotensi, gangguan untuk mengemudi, ibu hamil dan menyusui. Klomipramin

Dosis lazim : 10 mg dapat ditingkatkan sampai dengan maksimum dosis 250 mg sehari. Kontra Indikasi : Infark miokard, pemberian bersamaan dengan MAO, gagal jantung, kerusakan hati yang berat, glaukoma sudut sempit. Interaksi Obat : dapat menurunkan efek antihipertensi penghambat neuro adrenergik, dapat meningkatkan efek kardiovaskular dari noradrenalin atau adrenalin, meningkatkan aktivitas dari obat penekan SSP, alkohol. Perhatian : terapi bersama dengan preparat tiroid, konstipasi kronik, kombinasi dengan beberapa obat antihipertensi, simpatomimetik, penekan SSP, anti kolinergik, penghambat reseptor serotonin selektif, antikoagulan, simetidin. Monitoring hitung darah dan fungsi hati, gangguan untuk mengemudi. Amitriptilin Dosis lazim : 25 mg dapat dinaikan secara bertahap sampai dosis maksimum 150-300 mg sehari. Kontra Indikasi : penderita koma, diskrasia darah, gangguan depresif sumsum tulang, kerusakan hati, penggunaan bersama dengan MAO.

52

Interaksi Obat : bersama guanetidin meniadakan efek antihipertensi, bersama depresan SSP seperti alkohol, barbiturate, hipnotik atau analgetik opiate mempotensiasi efek gangguan depresif SSP termasuk gangguan depresif saluran napas, bersama reserpin meniadakan efek antihipertensi. Perhatian : ganguan kardiovaskular, kanker payudara, fungsi ginjal menurun, glakuoma, kecenderungan untuk bunuh diri, kehamilan, menyusui, epilepsi. Lithium karbonat Dosis lazim : 400-1200 mg dosis tunggal pada pagi hari atau sebelum tidur malam. Kontra Indikasi : kehamilan, laktasi, gagal ginjal, hati dan jantung. Interaksi Obat : diuretik, steroid, psikotropik, AINS, diazepam, metildopa, tetrasiklin, fenitoin, carbamazepin, indometasin. Perhatian : Monitor asupan diet dan cairan, penyakit infeksi, demam, influenza, gastroentritis.

2) Antidepresan Generasi ke-2 Mekanisme kerja : SSRI ( Selective Serotonin Re-uptake Inhibitor ) : Obat-obat ini menghambat resorpsi dari serotonin. NaSA ( Noradrenalin and Serotonin Antidepressants ): Obat-obat ini tidak berkhasiat selektif, menghambat re-uptake dari serotonin dan noradrenalin. Terdapat beberapa indikasi bahwa obat-obat ini lebih efektif daripada SSRI Antidepressan generasi ke-2, antara lain: Fluoxetin Dosis lazim : 20 mg sehari pada pagi hari, maksimum 80 mg/hari dalam dosis tunggal atau terbagi. Kontra Indikasi : hipersensitif terhadap fluoxetin, gagal ginjal yang berat, penggunaan bersama MAO. Interaksi Obat : MAO, Lithium, obat yang merangsang aktivitas SSP, anti depresan, triptofan, karbamazepin, obat yang terkait dengan protein plasma. Perhatian : penderita epilepsi yang terkendali, penderita kerusakan hati dan ginjal, gagal jantung, jangan mengemudi / menjalankan mesin.

53

Sertralin Dosis lazim : 50 mg/hari bila perlu dinaikkan maksimum 200 mg/hr. Kontra Indikasi : Hipersensitif terhadap sertralin. Interaksi Obat : MAO, Alkohol, Lithium, obat seretogenik. Perhatian : pada gangguan hati, terapi elektrokonvulsi, hamil, menyusui, mengurangi kemampuan mengemudi dan mengoperasikan mesin. Citalopram Dosis lazim : 20 mg/hari, maksimum 60 mg /hari. Kontra indikasi : hipersensitif terhadap obat ini. Interaksi Obat : MAO, sumatripan, simetidin. Perhatian : kehamilan, menyusui, gangguan mania, kecenderungan bunuh diri. Fluvoxamine Dosis lazim : 50mg dapat diberikan 1x/hari sebaiknya pada malam hari, maksimum dosis 300 mg. Interaksi Obat : warfarin, fenitoin, teofilin, propanolol, litium. Perhatian : Tidak untuk digunakan dalam 2 minggu penghentian terapi MAO, insufiensi hati, tidak direkomendasikan untuk anak dan epilepsi, hamil dan laktasi. Mianserin Dosis lazim : 30-40 mg malam hari, dosis maksimum 90 mg/ hari Kontra Indikasi : mania, gangguan fungsi hati. Interaksi Obat : mempotensiasi aksi depresan SSP, tidak boleh diberikan dengan atau dalam 2 minggu penghentian terapi. Perhatian : dapat menganggu psikomotor selama hari pertama terapi, diabetes, insufiensi hati, ginjal, jantung. Mirtazapin Dosis lazim : 15-45 mg / hari menjelang tidur. Kontra Indikasi : Hipersensitif terhadap mitrazapin. Interaksi Obat : dapat memperkuat aksi pengurangan SSP dari alkohol, memperkuat efek sedatif dari benzodiazepine, MAO. Perhatian : pada epilepsi sindroma otak organic, insufiensi hati, ginjal, jantung, tekanan darah rendah, penderita skizofrenia atau gangguan psikotik lain, penghentian terapi secara

54

mendadak, lansia, hamil, laktasi, mengganggu kemampuan mengemudi atau menjalankan mesin. Venlafaxine Dosis lazim : 75 mg/hari bila perlu dapat ditingkatkan menjadi 150-250 mg 1x/hari. Kontra Indikasi : penggunaan bersama MAO, hamil dan laktasi, anak < 18 tahun. Interaksi Obat : MAO, obat yang mengaktivasi SSP lain. Perhatian : riwayat kejang dan penyalahgunaan obat, gangguan ginjal atau sirosis hati, penyakit jantung tidak stabil, monitor tekanan darah jika penderita mendapat dosis harian > 200 mg. 3) Antidepresan MAO. Inhibitor Monoamin Oksidase (Monoamine Oxidase Inhibitor, MAOI) Farmakologi Monoamin oksidase merupakan suatu sistem enzim kompleks yang terdistribusi luas dalam tubuh, berperan dalam dekomposisi amin biogenik, seperti norepinefrin, epinefrin, dopamine, serotonin. MAOI menghambat sistem enzim ini, sehingga menyebabkan peningkatan konsentrasi amin endogen. Ada dua tipe MAO yang telah teridentifikasi, yaitu MAO-A dan MAO-B. Kedua enzim ini memiliki substrat yang berbeda serta perbedaan dalam sensitivitas terhadap inhibitor. MAO-A cenderungan memiliki aktivitas deaminasi epinefrin, norepinefrin, dan serotonin, sedangkan MAO-B memetabolisme benzilamin dan fenetilamin. Dopamin dan tiramin dimetabolisme oleh kedua isoenzim. Pada jaringan syaraf, sistem enzim ini mengatur dekomposisi metabolik katekolamin dan serotonin. MAOI hepatic

menginaktivasi monoamin yang bersirkulasi atau yang masuk melalui saluran cerna ke dalam sirkulasi portal (misalnya tiramin). Semua MAOI nonselektif yang digunakan sebagai antidepresan merupakan inhibitor ireversibel, sehingga dibutuhkan sampai 2 minggu untuk mengembalikan metabolisme amin normal setelah penghentian obat. Hasil studi juga mengindikasikan bahwa terapi MAOI kronik menyebabkan penurunan jumlah reseptor (down regulation) adrenergik dan serotoninergik. Farmakokinetik Absorpsi/distribusi Informasi mengenai farmakokinetik MAOI terbatas. MAOI

55

tampaknya terabsorpsi baik setelah pemberian oral. Kadar puncak tranilsipromin dan fenelzin mencapai kadar puncaknya masing-masing dalam 2 dan 3 jam. Tetapi, inhibisi MAO maksimal terjadi dalam 5 sampai 10 hari. Metabolisme/ekskresi metabolisme MAOI dari kelompok hidrazin (fenelzin, isokarboksazid) diperkirakan menghasilkan metabolit aktif. Inaktivasi terjadi terutama melalui asetilasi. Efek klinik fenelzin dapat berlanjut sampai 2 minggu setelah penghentian terapi. Setelah penghentian tranilsipromin, aktivitas MAO kembali dalam 3 sampai 5 hari (dapat sampai 10 Hari). Fenelzin dan isokarboksazid dieksresi melalui urin sebagian besar dalam bentuk metabolitnya. Populasi khusus asetilator lambat: Asetilasi lambat dari MAOI hidrazin dapat memperhebat efek setelah pemberian dosis standar. Indikasi Depresi: Secara umum, MAOI diindikasikan pada penderita dengan depresi atipikal (eksogen) dan pada beberapa penderita yang tidak berespon terhadap terapi antidpresif lainnya. MAOI jarang dipakai sebagai obat pilihan. Kontraindikasi Hipersensitif terhadap senyawa ini; feokromositoma; gagal jantung kongestif; riwayat penyakit liver atau fungsi liver abnormal; gangguan ginjal parah; gangguan serebrovaskular; penyakit kardiovaskular; hipertensi; riwayat sakit kepala; pemberian bersama dengan MAOI lainnya; senyawa yang terkait dibenzazepin termasuk

antidepresan trisiklik, karbamazepin, dan siklobenzaprin; bupropion; SRRI; buspiron; simpatomimetik; meperidin; dekstrometorfan; senyawa anestetik; depresan SSP; antihipertensif; kafein; keju atau makanan lain dengan kandungan tiramin tinggi (Depkes RI, 2007).

3) Serotonin dan Norepinephrin Reuptake Inhibitors (SNRIs)

56

Menurut Mayo Clinic (2012) SNRIs ini efektif untuk mengurangi gejala dari depresi. SNRIs juga sering digunakan untuk beberapa kondisi lain seperti kecemasan dan nyeri saraf. Kerja SNRIs SNRIs bekerja dengan mempengaruhi neurotransmiter yang biasanya digunakan dalam komunikasi antar sel-sel otak. Seperti kebanyakan antidepresan, SNRIs bekerja dengan merubah tingkatan salah satu atau beberapa neurotransmiter di dalam otak. SNRIs menghambat pengambilan ulang dari neurotransmiter serotonin dan norepinefrin di otak. Selain itu SNRIs juga menghambat beberapa neurotransmiter spesifik di otak. Merubah keseimbangan beberapa neurotransmiter ini biasanya akan membantu otak dalam menerima dan mengirimkan sinyal, sehingga merubah mood. Obat-obatan yang berada dalam kelompok obat ini. Beberapa contoh obat SNRIs yang sudah diakui dapat efektif dalam pengobatan depresi, adalah

Duloxetine (Cymbalta) Venlafaxine (Effexor XR) Desvenlafaxine (Pristiq)

Efek samping Efek samping yang biasa terjadi Mual Mulut kering Pusing Berkeringat Lemah Efek samping yang lain adalah

57

Kesulitan dalam buang air kecil Konstipasi Hilang napsu makan

10. Pencegahan Depresi Menurut Mayo Clinic (2012), tidak ada cara pasti untuk mencegah depresi. Namun, mengambil langkah-langkah untuk mengendalikan stres, meningkatkan ketahanan diri dan untuk meningkatkan kepercayaan diri yang rendah dapat membantu. Persahabatan dan dukungan sosial, terutama di saat krisis, dapat membantu pasien melalui masa-masa sulit. Selain itu, pengobatan pada gejala awal dapat membantu mencegah depresi yang memburuk. Pengobatan pemeliharaan jangka panjang juga dapat membantu mencegah kekambuhan gejala depresi.

11. Apakah Kepribadian Dapat Diubah dan Cara yang Dilakukan Bila Dapat Diubah pada Kasus Depresi. Suatu penelitian dalam mempelajari efek paroxetine SSRI ( Paxil dan Seroxat ) dalam uji coba terkontrol plasebo yang melibatkan 240 orang dewasa dengan gangguan depresi mayor. Pasien yang memakai paroxetine mengalami perbaikan depresi cukup besar dibandingkan pasien yang menerima plasebo. Namun, orang yang memakai paroxetine mengalami penurunan jauh lebih besar dalam neurotisisme (kecenderungan untuk mengalami emosi negatif dan ketidakstabilan emosional) dan peningkatan ekstraversi (kecenderungan untuk mengalami emosi positif) dibandingkan pasien yang menerima plasebo. SSRI mungkin dapat dipandang sebagai agen normalisasi - kepribadian, berguna dalam mengobati berbagai gangguan yang berkaitan dengan neurotisisme tinggi dan extraversi rendah (Fellman, 2009).

58

BAB III KESIMPULAN

Pasien datang dengan keluhan kurang lebih 1 bulan tidak bisa tidur, tidak ada nafsu makan, sering menyendiri di kamar. Bila diajak bicara, pasien menjawab dengan suara pelan. Dari alloanamnesis diketahui bahwa pasien pernah mengalami gangguan serupa kurang lebih 1 tahun yang lalu dan sembuh sendiri setelah 9 bulan. Sedangkan hasil pemeriksaan mental diperoleh hipoaktif, remming, mood depresi, afek menyempit, dan insight (tilikan diri) derajat 5. Temuan ini memperjelas dalam mengarahkan penegakan diagnosis, yaitu cenderung kearah depresi berulang dengan episode kini berat dengan tidak ada gangguan psikotik. Depresi adalah keadaan mood yang berkisar antara susah atau tidak gembira tahap rendah sampai ke kemurungan yang nyata dan keputusasaan di mana pada tingkat yang ekstrim biasanya disertai pesimisme yang mencolok dan kurangnya harapan masa depan. Pemeriksaan yang dilakukan, yaitu pemeriksaan status mental dan pemeriksaan penunjang yang bisa dilakukan dalam mendukung menegakkan diagnosis diantaranya tes skrining, pemeriksaan laboratorium, dan neuroimaging. Penatalaksanaan yang dilakukan meliputi terapi fisik menggunakan electro convulsive therapy (ECT) dan terapi perubahan perilaku menggunakan metode cognitive behavior therapy (CBT). Selain itu juga bisa diberikan psikoterapi untuk menghilangkan atau mengurangi keluhan-keluhan dan mencegah kambuhnya gangguan psikologik atau pola perilaku maladaptif Pemberian obat berupa golongan antidepressan klasik, generasi kedua, dan MAOI.

59

BAB IV SARAN Penegakan diagnosis dalam psikiatri peroleh dari anamnesis baik dengan pasien secara langsung maupun dengan pengantar pasien (alloanamnesis) pada pemeriksaan status mental. Dari anamnesis tersebut bisa didapatkan keterangan tentang riwayat penyakit dan gejala yang dialami pasien. Oleh karena itu, diperlukan penguasaan mahasiswa tentang penguasaan simptomatologis psikiatri lebih mendalam. Sehingga dalam pelaksanaan tutorial, kegiatan diskusi berjalan lebih lancar. Pencegahan pada depresi sangatlah penting dengan

menengendalikan stress, meningkatkan ketahanan diri, dan meningkatkan percaya diri.

60

DAFTAR PUSTAKA

Centers of Disease Control and Prevention (CDC). 2010. Current depression among adults in United states 2006 and 2008. MMWR Morb Mortal Wkly Rep.59 (38): 1229-35. DepkesRI. 2007. Pharmaceutical Care untuk Penderita Gangguan Depresif.

www.binfar.depkes.go.id/bmsimages/1361517835.pdf. Diakses tanggal 25 November 2013. Elvira, S.D., Hadisukanto, G. 2010. Buku Ajar Psikiatri Fakultas Kedokteran Universitas Indonesia. Jakarta: Badan Penerbit FKUI. Fellman, Megan. 2009. Antidepressant Can Change a Patients Personality: Personality change might be very important to long-term treatment outcome.. Diakses

http://www.northwestern.edu/newscenter/stories/2009/12/tang.html#sthash.Zk1qLn33.dpuf. tanggal 25 November 2013.

Halverson, Jerry L. 2013. Depression Workup. http://emedicine.medscape.com/article/286759workup. Diakses tanggal 25 November 2013. Hardywinoto, Setiabudi, T., 1999. Panduan Gerontologi Tinjauan dari Berbagai Aspek. Jakarta: PT Gramedia. Harvard Mental Health Letter. 2009. Sleep Mental

Health.http://www.health.harvard.edu/newsletters/Harvard_Mental_Health_Letter/2009/J uly/Sleep-and-mental-health. Diakses tanggal 26 November 2013. Japardi, Iskandar. 2010. Gangguan tidur. Dalam Hand Book of Psikiatri. Surakarta: Kesuma. Kane. 1999. Essentials of Clinical Geriatrics 4th Edition.USA : McGrow-Hill Companies, pp. 231-45. Kaplan, Harold I., et al. 2010. Kaplan-Sadock Sinopsis Psikiatri Jilid Satu. Tanggerang: Binarupa Aksara. Landefeld. 2004. Current Geriatric Diagnosis and Treatment. USA : McGrow- Hill. pp. 156-60. Lesler, Zayas, C., 2001. Comprehensive Geriatric Assessment. USA : McGraw Hill Companies. pp. 465-75. Maramis, Willy F dan Maramis Albert. 2009. Catatan Ilmu Kedokteran Jiwa. Surabaya: Airlangga University Press. Maslim, Rusdi. 2001. Diagnosis Gangguan Jiwa , Rujukan Ringkas PPDGJ- III. Jakarta: Nuh Jaya.

61

Mayo

Clinic

2012.

Depression

(major

depression):

prevention.

http://www.mayoclinic.com/health/depression/DS00175/DSECTION=prevention. Diakses tanggal 25 November 2013. Mayo Clinic. 2013. Serotonin and norepinephrine reuptake inhibitors Diakses (SNRIs). 25

http://www.mayoclinic.com/health/antidepressants/MH00067. November 2013.

tanggal

Nevid, JS. Rathus, SA, Greene, B. 2005. Psikologi Abnormal Jilid 1. Jakarta: Erlangga. Nuhriawangsa, Ibrahim. 2011. Symtomatologi Psikiatri. Surakarta: FK UNS. Sadock BJ, Kaplan HI, Grebb JA. 2003. Kaplan & Sadocks Synopsis of Psychiatri. 9thed . Philadelpia: Lippincott William & Wilkins. Susilohati, Mardiatmi. 2013. Ketrampilan Pemeriksaan Psikiatri: Hubungan Dokter- Pasien Teknik Wawancara. Dalam Buku Pedoman Ketrampilan Klinis. Surakarta: FK UNS. Unutzer, J., 2007. Late Life Depression. N Eng J Med 357:2269-76. Available from : http://content.nejm.org//cgi/content/full/357/22/2269. Diakses tanggal 25 November 2013.

62