Anda di halaman 1dari 70

1 Kimia Kelas X

S
i
l
a
b
u
s
S
e
k
o
l
a
h
:
.

.

.

.
K
e
l
a
s
/
S
e
m
e
s
t
e
r
:
X
/
2
M
a
t
a

P
e
l
a
j
a
r
a
n
:
K
i
m
i
a
S
t
a
n
d
a
r

K
o
m
p
e
t
e
n
s
i
:
4
.
M
e
m
a
h
a
m
i

s
i
f
a
t
-
s
i
f
a
t

s
e
n
y
a
w
a

o
r
g
a
n
i
k

a
t
a
u

d
a
s
a
r

g
u
g
u
s

f
u
n
g
s
i

d
a
n

s
e
n
y
a
w
a

m
a
k
r
o
m
o
l
e
k
u
l
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
4
.
1
M
e
n
d
e
s
k
r
i
p
s
i
-
k
a
n

k
e
k
h
a
s
a
n
a
t
o
m

k
a
r
b
o
n
d
a
l
a
m

m
e
m
-
b
e
n
t
u
k

s
e
-
n
y
a
w
a

h
i
d
r
o
-
k
a
r
b
o
n
.
D
e
f
i
n
i
s
i
S
e
n
y
a
w
a
H
i
d
r
o
k
a
r
b
o
n
1
.
M
e
n
u
g
a
s
i

s
i
s
w
a
u
n
t
u
k

m
e
n
y
e
l
i
d
i
k
i
a
d
a
n
y
a

u
n
s
u
r

C

d
a
n
H

d
a
l
a
m

s
e
n
y
a
w
a
o
r
g
a
n
i
k

m
e
l
a
l
u
i

p
e
r
-
c
o
b
a
a
n
.

(
*
)
2
.
M
e
n
j
e
l
a
s
k
a
n

k
e
-
k
h
a
s
a
n

a
t
o
m

k
a
r
b
o
n
d
a
l
a
m

s
e
n
y
a
w
a
k
a
r
b
o
n
.

M
a
m
p
u

m
e
n
g
i
d
e
n
-
t
i
f
i
k
a
s
i

u
n
s
u
r

C
,

H
,
d
a
n

O

d
a
l
a
m

s
e
n
y
a
-
w
a

o
r
g
a
n
i
k

m
e
l
a
l
u
i
p
e
r
c
o
b
a
a
n
.

M
a
m
p
u

m
e
n
d
e
s
-
k
r
i
p
s
i
k
a
n

k
e
k
h
a
s
a
n
a
t
o
m

k
a
r
b
o
n

d
a
l
a
m
s
e
n
y
a
w
a

k
a
r
b
o
n
.
T
e
s
u
n
j
u
k
k
e
r
j
a
T
e
s
t
e
r
t
u
l
i
s
U
j
i
p
e
t
i
k
k
e
r
j
a
p
r
o
s
e
d
u
r
P
i
l
i
h
a
n
g
a
n
d
a
P
a
n
a
s
k
a
n

n
a
s
i

y
a
n
g

t
e
l
a
h
d
i
h
a
l
u
s
k
a
n

d
a
n

s
e
r
b
u
k
C
u
O

d
a
l
a
m

t
a
b
u
n
g

r
e
a
k
s
i
.
H
u
b
u
n
g
k
a
n

t
a
b
u
n
g

r
e
a
k
s
i
d
e
n
g
a
n

a
i
r

k
a
p
u
r

m
e
n
g
-
g
u
n
a
k
a
n

s
l
a
n
g

k
e
c
i
l
.
A
m
a
t
i

p
e
r
u
b
a
h
a
n

y
a
n
g
t
e
r
j
a
d
i

p
a
d
a

a
i
r

k
a
p
u
r
.
S
e
l
a
n
j
u
t
n
y
a
,

u
j
i

t
i
t
i
k
-
t
i
t
i
k
a
i
r

y
a
n
g

m
e
n
e
m
p
e
l

p
a
d
a
d
i
n
d
i
n
g

t
a
b
u
n
g

r
e
a
k
s
i
d
e
n
g
a
n

k
e
r
t
a
s

k
o
b
a
l
t
(
I
I
)
,
a
m
a
t
i

p
e
r
u
b
a
h
a
n

w
a
r
n
a
y
a
n
g

t
e
r
j
a
d
i

p
a
d
a

k
e
r
t
a
s
k
o
b
a
l
t
(
I
I
)

t
e
r
s
e
b
u
t
.
S
e
n
y
a
w
a
-
s
e
n
y
a
w
a

h
i
d
r
o
-
k
a
r
b
o
n

b
e
r
i
k
u
t

b
e
r
a
n
t
a
i
s
i
k
l
i
s
,

k
e
c
u
a
l
i

.

.

.

.
a
.
|
|
|

|
|
|

|
|
|

|
|
|
b
.
Z

X
C
X
Z
G
C



C
H
|
|
G
C



C
H


Z

X
C
X



Z
1
.
B
u
k
u

P
G

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

7
3

8
3
2
.
B
u
k
u

P
R

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

3
9

4
7
3
.
A
l
a
t

d
a
n

b
a
h
a
n
y
a
n
g

s
e
s
u
a
i
u
n
t
u
k

i
d
e
n
-
t
i
f
i
k
a
s
i

u
n
s
u
r

C
d
a
n

H

d
a
l
a
m
s
e
n
y
a
w
a

h
i
d
r
o
-
k
a
r
b
o
n
.
4
.
B
u
k
u

B
S
E
K
i
m
i
a

1
,

A
r
i
H
a
r
n
a
n
t
o

d
a
n
R
u
m
i
n
t
e
n
,
D
e
p
d
i
k
n
a
s
,
2
0
0
9
8


4
5
m
e
n
i
t
P
e
n
d
i
d
i
k
a
n
k
a
r
a
k
t
e
r
(
*
)
D
i
s
i
p
l
i
n
2 Silabus
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
c
.
|
|
|

|
|
|

|
|
|


C
|
|
|
d
.
Z

X
C
X
Z
G
C
C
H
|
|

|
|
e
.
|
|

|
|

|
|
P
a
d
a

r
u
m
u
s

s
t
r
u
k
t
u
r
b
e
r
i
k
u
t
,

a
t
o
m

C

s
e
k
u
n
d
e
r
b
e
r
a
d
a

p
a
d
a

a
t
o
m

C
b
e
r
n
o
m
o
r

.

.

.

.

3
C
H
3
9
C
H
3
l
l
1
C
H
3


2
C


5
C
H


7
C
H
2


8
C
H


1
0
C
H
3
l
l
4
C
H
3
6
C
H
3
a
.
2
b
.
6
c
.
7
d
.
8
e
.
9
G
u
n
a
k
a
n

t
a
n
a
h

l
i
a
t

a
t
a
u
p
l
a
s
t
i
s
i
n
.

B
u
a
t
l
a
h

b
u
l
a
t
a
n
-
b
u
l
a
t
a
n

d
e
n
g
a
n

d
u
a
u
k
u
r
a
n

y
a
n
g

b
e
r
b
e
d
a
,
b
u
l
a
t
a
n

k
e
c
i
l

u
n
t
u
k

a
t
o
m
k
a
r
b
o
n

d
a
n

b
u
l
a
t
a
n

b
e
s
a
r
u
n
t
u
k

a
t
o
m

h
i
d
r
o
g
e
n
.
G
u
n
a
k
a
n

t
u
s
u
k

g
i
g
i
s
e
b
a
g
a
i

i
k
a
t
a
n

k
o
v
a
l
e
n
u
n
t
u
k

m
e
n
y
u
s
u
n

m
o
d
e
l
s
t
r
u
k
t
u
r

i
s
o
m
e
r
-
i
s
o
m
e
r
d
a
r
i

C
5
H
1
2
,

C
6
H
1
4
,

C
7
H
1
6
,
d
a
n

C
8
H
1
8
.
3
.
M
e
n
e
r
a
n
g
k
a
n

a
r
t
i
a
t
o
m

C

p
r
i
m
e
r
,

s
e
-
k
u
n
d
e
r
,

t
e
r
s
i
e
r
,

d
a
n
k
u
a
r
t
e
n
e
r

b
e
s
e
r
t
a
k
e
d
u
d
u
k
a
n
n
y
a
d
a
l
a
m

r
a
n
t
a
i

i
k
a
t
a
n
.

M
a
m
p
u

m
e
m
b
e
d
a
-
k
a
n

a
t
o
m

C

p
r
i
m
e
r
,
s
e
k
u
n
d
e
r
,

t
e
r
s
i
e
r
,
d
a
n

k
u
a
r
t
e
n
e
r
.
T
e
s
t
e
r
t
u
l
i
s
P
i
l
i
h
a
n
G
a
n
d
a
P
o
r
t
o
f
o
-
l
i
o

M
a
m
p
u

m
e
n
g
e
l
o
m
-
p
o
k
k
a
n

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n

b
e
r
-
d
a
s
a
r
k
a
n

k
e
j
e
n
u
h
-
a
n

i
k
a
t
a
n
.
4
.
M
e
m
b
u
a
t

m
o
d
e
l
m
o
l
e
k
u
l

s
u
a
t
u

s
e
-
n
y
a
w
a

h
i
d
r
o
k
a
r
b
o
n
m
e
n
g
g
u
n
a
k
a
n

t
a
n
a
h
l
i
a
t

a
t
a
u

p
l
a
s
t
i
s
i
n
d
a
n

t
u
s
u
k

g
i
g
i

u
n
t
u
k
m
e
n
u
n
j
u
k
k
a
n

i
k
a
t
a
n
j
e
n
u
h

p
a
d
a

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n
.
4
.
2
M
e
n
g
g
o
l
o
n
g
-
k
a
n

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n
b
e
r
d
a
s
a
r
k
a
n
s
t
r
u
k
t
u
r
n
y
a
d
a
n

h
u
b
u
n
g
a
n
-
n
y
a

d
e
n
g
a
n
s
i
f
a
t

s
e
n
y
a
w
a
.
P
e
n
u
g
a
s
-
a
n
8


4
5
m
e
n
i
t
P
e
n
d
i
d
i
k
a
n
k
a
r
a
k
t
e
r
(
*
)
P
a
n
t
a
n
g
m
e
n
y
e
r
a
h
P
e
n
g
g
o
l
o
n
g
a
n
S
e
n
y
a
w
a
H
i
d
r
o
k
a
r
b
o
n
1
.
B
u
k
u

P
G

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

8
4

1
0
3
2
.
B
u
k
u

P
R

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

4
7

6
0
3 Kimia Kelas X
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
S
t
r
u
k
t
u
r

s
e
n
y
a
w
a

a
l
k
u
n
a
t
e
r
d
a
p
a
t

p
a
d
a

.

.

.

.
a
.
H
H
H
|
|
|
H


H
|
|
H
H
H


H
|
H
b
.
H
H
H
|
|
|
H


C

=

C


H
|
|
|
H
H
H


H
|
H
c
.
H
H
H
|
|
|
H


H
|
|
H
H
H


H
|
H


H
|
H
d
.
H
H
H
|
|
|
H


H
|
|
H
H
H
|
H


H
|
|
H
H
e
.
H
H
H
|
|
|
H


C

=

C


H
|
|
H


H
H
|
H


H
H
|
H

P
i
l
i
h
a
n
g
a
n
d
a
T
e
s

t
e
r
-
t
u
l
i
s

M
a
m
p
u

m
e
m
b
e
r
i
n
a
m
a

s
e
n
y
a
w
a
a
l
k
a
n
a
,

a
l
k
e
n
a
,

d
a
n
a
l
k
u
n
a
.
5
.
M
e
n
g
g
a
m
b
a
r

r
u
m
u
s
s
t
r
u
k
t
u
r

s
e
n
y
a
w
a
a
l
k
a
n
a
,

a
l
k
e
n
a
,

d
a
n
a
l
k
u
n
a

s
e
r
t
a

m
e
m
-
b
e
r
i

n
a
m
a

s
e
s
u
a
i
a
t
u
r
a
n

I
U
P
A
C
.
3
.
A
l
a
t

d
a
n

b
a
h
a
n
y
a
n
g

s
e
s
u
a
i
u
n
t
u
k

i
d
e
n
t
i
f
i
-
k
a
s
i

u
n
s
u
r

C
d
a
n

H

d
a
l
a
m
s
e
n
y
a
w
a

h
i
d
r
o
-
k
a
r
b
o
n
.
4
.
B
u
k
u

B
S
E
K
i
m
i
a

1
,

A
r
i
H
a
r
n
a
n
t
o

d
a
n
R
u
m
i
n
t
e
n
,
D
e
p
d
i
k
n
a
s
,
2
0
0
9
4 Silabus
D
i

a
n
t
a
r
a

s
e
n
y
a
w
a

b
e
r
i
k
u
t
y
a
n
g

m
e
m
p
u
n
y
a
i

t
i
t
i
k
d
i
d
i
h

t
e
r
t
i
n
g
g
i

a
d
a
l
a
h

.

.

.

.
a
.
d
e
k
a
n
a
b
.
o
k
t
a
n
a
c
.
2
-
m
e
t
i
l
-
h
e
p
t
a
n
a
d
.
2
,
3
-
d
i
m
e
t
i
l
-
p
e
n
t
a
n
a
e
.
2
,
2
,
3
,
3
-
t
e
t
r
a
-
m
e
t
i
l
-
b
u
t
a
n
a
T
u
l
i
s
k
a
n

s
e
m
u
a

i
s
o
m
e
r
(
k
e
c
u
a
l
i

i
s
o
m
e
r

g
e
o
m
e
t
r
i
)
y
a
n
g

d
i
m
i
l
i
k
i

o
l
e
h

s
e
n
y
a
w
a
d
e
n
g
a
n

r
u
m
u
s

m
o
l
e
k
u
l
C
6
H
1
2

b
e
s
e
r
t
a

n
a
m
a
n
y
a
!
J
u
m
l
a
h

i
s
o
m
e
r

p
o
s
i
s
i

d
a
r
i
s
e
n
y
a
w
a
C
H
2

=

C
H


C
H
2


C
H
3
s
e
b
a
n
y
a
k

.

.

.

.
a
.
1
d
.
4
b
.
2
e
.
5
c
.
3
D
i

a
n
t
a
r
a

a
l
k
e
n
a

b
e
r
i
k
u
t
,
y
a
n
g

m
e
m
p
u
n
y
a
i

i
s
o
m
e
r
g
e
o
m
e
t
r
i

a
d
a
l
a
h

.

.

.

.
a
.
C
H
3
C
l
G
C

=

C
H
C
l
H
b
.
H
C
H
3
G
C

=

C
H
C
H
3
H
c
.
H
C
H
3
G
C

=

C
H
H
C
H
3
d
.
C
H
3
C
l
G
C

=

C
H
C
l
H
e
.
H
C
H
3
G
C

=

C
H
C
2
H
5
C
2
H
5
P
i
l
i
h
a
n
g
a
n
d
a
U
r
a
i
a
n
P
i
l
i
h
a
n
g
a
n
d
a
P
i
l
i
h
a
n
g
a
n
d
a
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s

M
a
m
p
u

m
e
n
y
i
m
p
u
l
-
k
a
n

h
u
b
u
n
g
a
n

t
i
t
i
k
d
i
d
i
h

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n

d
e
n
g
a
n
m
a
s
s
a

m
o
l
e
k
u
l
r
e
l
a
t
i
f

d
a
n

s
t
r
u
k
t
u
r
-
n
y
a
.

M
a
m
p
u

m
e
n
g
i
d
e
n
t
i
-
f
i
k
a
s
i

i
s
o
m
e
r
-
i
s
o
m
e
r
d
a
r
i

s
e
n
y
a
w
a

h
i
d
r
o
-
k
a
r
b
o
n

d
a
n

m
e
m
b
e
r
i
n
a
m
a

i
s
o
m
e
r
-
i
s
o
m
e
r
t
e
r
s
e
b
u
t

s
e
s
u
a
i
I
U
P
A
C
.

M
a
m
p
u

m
e
n
e
n
t
u
-
k
a
n

i
s
o
m
e
r

s
t
r
u
k
t
u
r
(
k
e
r
a
n
g
k
a

p
o
s
i
s
i
,
f
u
n
g
s
i
)
.

M
a
m
p
u

m
e
n
g
i
d
e
n
t
i
-
f
i
k
a
s
i

i
s
o
m
e
r

s
t
r
u
k
-
t
u
r

(
k
e
r
a
n
g
k
a

p
o
s
i
s
i
,
f
u
n
g
s
i
)

a
t
a
u

i
s
o
m
e
r
g
e
m
o
t
e
r
i

(
c
i
s
,

t
r
a
n
s
)
.
6
.
B
e
r
d
a
s
a
r
k
a
n

d
a
t
a
t
i
t
i
k

d
i
d
i
h

d
a
n

t
i
t
i
k
l
e
l
e
h

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n

d
a
l
a
m
t
a
b
e
l

s
i
s
w
a

d
i
m
i
n
t
a
m
e
n
g
i
d
e
n
t
i
f
i
k
a
s
i
h
u
b
u
n
g
a
n

t
i
t
i
k

d
i
d
i
h
d
e
n
g
a
n

M
r

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n
.
7
.
M
e
n
e
n
t
u
k
a
n

i
s
o
m
e
r
k
e
r
a
n
g
k
a

a
l
k
a
n
a
d
a
n

m
e
m
b
e
r
i

n
a
m
a
i
s
o
m
e
r
-
i
s
o
m
e
r
t
e
r
s
e
b
u
t
.

(
*
)
8
.
M
e
n
u
n
j
u
k
k
a
n

i
s
o
-
m
e
r

s
t
r
u
k
t
u
r

p
a
d
a
a
l
k
u
n
a

d
a
n

a
l
k
a
d
i
e
n
a
.
9
.
M
e
n
e
n
t
u
k
a
n

i
s
o
m
e
r
g
e
o
m
e
t
r
i

(
c
i
s
-
t
r
a
n
s
)
d
a
r
i

a
l
k
e
n
a
.
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
1
.
B
u
k
u

P
G

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

1
0
3

1
2
6
2
.
B
u
k
u

P
R

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

.

.

.
3
.
B
u
k
u

B
S
E
K
i
m
i
a

1
,

A
r
i
H
a
r
n
a
n
t
o

d
a
n
R
u
m
i
n
t
e
n
,
D
e
p
d
i
k
n
a
s
,
2
0
0
9
5 Kimia Kelas X
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
R
e
a
k
s
i
-
r
e
a
k
s
i

b
e
r
i
k
u
t
m
e
r
u
p
a
k
a
n

r
e
a
k
s
i

e
l
i
m
i
-
n
a
s
i
,

k
e
c
u
a
l
i

.

.

.

.
Z
n
O
a
.
C
H
3

C
H
2

C
H

C
H
2

C
H
3

|O
H
H
2
+
C
H
3

C
H
2

C
H
2

C
H
3
|
|
O
b
.
C
H
3

C
H
2

C
H
2
O
H
+
N
a

C
H
3

C
H
2

C
H
2
O
N
a
+
12
H
2
C
l
|
c
.
C
H
3

C
H

C
H
3
+
N
a
O
H

C
H
3

C
H
=
C
H
2
+
H
2
O
+
N
a
C
l
d
.








+

H
2
O
C
H
3
|
e
.
C
H
3

C
H

C
H
2

B
r
+
K
O
H

|

H
C
H
3
C
H
3
|
H
2
O
+
k
B
r
+
C
H
3

C
H

C
=
C
H
2
|
C
H
3
P
r
o
t
e
i
n

s
a
n
g
a
t

b
e
r
m
a
n
-
f
a
a
t

b
a
g
i

t
u
b
u
h

k
i
t
a
.

P
r
o
-
t
e
i
n

m
e
r
u
p
a
k
a
n

s
a
l
a
h
s
a
t
u

s
e
n
y
a
w
a

k
a
r
b
o
n
y
a
n
g

b
e
r
g
u
n
a

d
i

b
i
d
a
n
g
.

.

.

.
a
.
s
e
n
i
b
.
p
a
p
a
n
c
.
p
a
n
g
a
n
d
.
e
s
t
e
t
i
k
a
e
.
s
a
n
d
a
n
g

M
a
m
p
u

m
e
n
u
l
i
s
k
a
n
r
e
a
k
s
i

s
e
d
e
r
h
a
n
a
p
a
d
a

s
e
n
y
a
w
a

a
l
-
k
a
n
a
,

a
l
k
e
n
a
,

d
a
n
a
l
k
u
n
a

(
r
e
a
k
s
i

o
k
s
i
-
d
a
s
i
,

a
d
i
s
i
,

s
u
b
s
t
i
-
t
u
s
i
,

e
l
i
m
i
n
a
s
i
)

M
a
m
p
u

m
e
n
y
e
b
u
t
-
k
a
n

k
e
g
u
n
a
a
n

d
a
n
k
o
m
p
o
s
i
s
i

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n

d
a
l
a
m
b
i
d
a
n
g

p
a
n
g
a
n
.
1
0
.
M
e
n
u
l
i
s
k
a
n

p
e
r
-
s
a
m
a
a
n

r
e
a
k
s
i

s
u
b
-
s
t
i
t
u
s
i

p
a
d
a

a
l
k
a
n
a
,
r
e
a
k
s
i

a
d
i
s
i

p
a
d
a
a
l
k
e
n
a

d
a
n

a
l
k
u
n
a
,
s
e
r
t
a

r
e
a
k
s
i

e
l
i
m
i
-
n
a
s
i

p
a
d
a

a
l
k
a
n
a
.
1
1
.
M
e
n
g
k
a
j
i

d
a
n

m
e
n
-
d
i
s
k
u
s
i
k
a
n

k
e
g
u
n
a
-
a
n

d
a
n

k
o
m
p
o
s
i
s
i
s
e
n
y
a
w
a

h
i
d
r
o
k
a
r
-
b
o
n

d
a
l
a
m

b
i
d
a
n
g
p
a
n
g
a
n
.

(

)
P
i
l
i
h
a
n
g
a
n
d
a
P
i
l
i
h
a
n
g
a
n
d
a
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s
4
.
3
M
e
n
j
e
l
a
s
k
a
n
k
e
g
u
n
a
a
n

d
a
n
k
o
m
p
o
s
i
s
i
s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n
d
a
l
a
m

k
e
h
i
d
u
p
-
a
n

s
e
h
a
r
i
-
h
a
r
i
d
a
l
a
m

b
i
d
a
n
g
p
a
n
g
a
n
,

s
a
n
-
d
a
n
g
,

p
a
p
a
n
,
p
e
r
d
a
g
a
n
g
a
n
,
s
e
n
i
,

d
a
n

e
s
t
e
-
t
i
k
a
.
P
e
n
d
i
d
i
k
a
n
k
a
r
a
k
t
e
r
(
*
)
G
e
m
a
r
m
e
m
b
a
c
a
E
k
o
n
o
m
i
k
r
e
a
t
i
f
(

)
R
a
s
a
i
n
g
i
n

t
a
h
u
8


4
5
m
e
n
i
t
H
2
S
O
4
p
e
k
a
t
O
H
1
.
B
u
k
u

P
G

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

1
0
4

1
2
6
2
.
B
u
k
u

P
R

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

6
1

7
4
6 Silabus
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
P
l
a
s
t
i
k

m
e
r
u
p
a
k
a
n

s
a
l
a
h
s
a
t
u

s
e
n
y
a
w
a

h
i
d
r
o
k
a
r
-
b
o
n

y
a
n
g

s
e
r
i
n
g

d
i
g
u
n
a
-
k
a
n

s
e
b
a
g
a
i

p
e
n
g
g
a
n
t
i
k
a
y
u
.

A
l
a
s
a
n

y
a
n
g

t
e
p
a
t
u
n
t
u
k

p
e
r
n
y
a
t
a
a
n

t
e
r
s
e
-
b
u
t

a
d
a
l
a
h

.

.

.

.
a
.
p
e
r
s
e
d
i
a
a
n

k
a
y
u

t
e
r
-
b
a
t
a
s
b
.
p
l
a
s
t
i
k

l
e
b
i
h

a
w
e
t
d
i
b
a
n
d
i
n
g
k
a
n

k
a
y
u
c
.
p
l
a
s
t
i
k

b
e
r
a
s
a
l

d
a
r
i
r
e
a
k
s
i

p
o
l
i
m
e
r
i
s
a
s
i
d
.
k
a
y
u

m
e
n
i
m
b
u
l
k
a
n
p
e
n
c
e
m
a
r
a
n

l
i
n
g
k
u
n
g
a
n
e
.
p
l
a
s
t
i
k

h
a
r
g
a
n
y
a

l
e
b
i
h
m
u
r
a
h

d
i
b
a
n
d
i
n
g
k
a
n
k
a
y
u
S
e
n
y
a
w
a

p
o
l
i
v
i
n
i
l

a
s
e
t
a
t
d
i
g
u
n
a
k
a
n

s
e
b
a
g
a
i

z
a
t
p
e
r
e
k
a
t

p
a
d
a

c
a
t

i
n
t
e
r
i
o
r
.
S
e
n
y
a
w
a

t
e
r
s
e
b
u
t

b
e
r
-
g
u
n
a

t
e
r
u
t
a
m
a

d
i

d
a
l
a
m
b
i
d
a
n
g

.

.

.

.
a
.
s
e
n
i
b
.
p
a
p
a
n
c
.
p
a
n
g
a
n
d
.
e
s
t
e
t
i
k
a
e
.
s
a
n
d
a
n
g
P
i
l
i
h
a
n
g
a
n
d
a
P
i
l
i
h
a
n
g
a
n
d
a
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s

M
a
m
p
u

m
e
n
j
e
l
a
s
-
k
a
n

k
e
g
u
n
a
a
n

d
a
n
k
o
m
p
o
s
i
s
i

s
e
n
y
a
w
a
h
i
d
r
o
k
a
r
b
o
n

d
a
l
a
m
b
i
d
a
n
g

p
a
p
a
n
.

M
a
m
p
u

m
e
n
d
e
s
-
k
r
i
p
s
i
k
a
n

k
e
g
u
n
a
-
a
n

d
a
n

k
o
m
p
o
s
i
s
i
s
e
n
y
a
w
a

h
i
d
r
o
k
a
r
-
b
o
n

d
a
l
a
m

b
i
d
a
n
g
s
e
n
i

d
a
n

e
s
t
e
t
i
k
a
.
1
2
.
M
e
n
g
k
a
j
i

d
a
n

m
e
n
-
d
i
s
k
u
s
i
k
a
n

k
e
g
u
n
a
-
a
n

d
a
n

k
o
m
p
o
s
i
s
i
s
e
n
y
a
w
a

h
i
d
r
o
k
a
r
-
b
o
n

d
a
l
a
m

b
i
d
a
n
g
s
a
n
d
a
n
g

d
a
n

p
a
p
a
n
.
1
3
.
M
e
n
g
k
a
j
i

d
a
n

m
e
n
-
d
i
s
k
u
s
i
k
a
n

k
e
g
u
n
a
-
a
n

d
a
n

k
o
m
p
o
s
i
s
i
s
e
n
y
a
w
a

h
i
d
r
o
k
a
r
-
b
o
n

d
a
l
a
m

b
i
d
a
n
g
s
e
n
i

d
a
n

e
s
t
e
t
i
k
a
.
(
*
)
7 Kimia Kelas X
4
.
4
M
e
n
j
e
l
a
s
k
a
n
p
r
o
s
e
s

p
e
m
-
b
e
n
t
u
k
a
n

d
a
n
t
e
k
n
i
k

p
e
m
i
-
s
a
h
a
n

f
r
a
k
s
i
-
f
r
a
k
s
i

m
i
n
y
a
k
b
u
m
i

s
e
r
t
a

k
e
-
g
u
n
a
a
n
n
y
a
.
P
e
n
d
i
d
i
k
a
n
k
a
r
a
k
t
e
r
(
*
)
P
e
d
u
l
i

l
i
n
g
-
k
u
n
g
a
n
E
k
o
n
o
m
i
k
r
e
a
t
i
f
(

)
K
r
e
a
t
i
f
M
i
n
y
a
k


b
u
m
i
d
a
n

g
a
s

a
l
a
m
4


4
5
m
e
n
i
t
1
.
B
u
k
u

P
G

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

1
2
7

1
5
2
2
.
B
u
k
u

P
R

K
i
m
i
a
K
e
l
a
s

X

S
e
-
m
e
s
t
e
r

2
,

I
n
t
a
n
P
a
r
i
w
a
r
a
,

h
a
-
l
a
m
a
n

7
5

9
4
3
.
B
u
k
u

r
e
f
e
r
e
n
s
i
y
a
n
g

r
e
l
e
v
a
n
.
4
.
B
u
k
u

B
S
E
K
i
m
i
a

1
,

A
r
i
H
a
r
n
a
n
t
o

d
a
n
R
u
m
i
n
t
e
n
,
D
e
p
d
i
k
n
a
s
,
2
0
0
9
1
.
M
e
n
g
k
a
j
i

p
r
o
s
e
s
p
e
m
b
e
n
t
u
k
a
n
m
i
n
y
a
k

b
u
m
i

d
a
n
g
a
s

a
l
a
m
.
2
.
M
e
n
y
e
b
u
t
k
a
n

k
o
m
-
p
o
n
e
n
-
k
o
m
p
o
n
e
n
u
t
a
m
a

p
e
n
y
u
s
u
n
m
i
n
y
a
k

b
u
m
i
.
3
.
M
e
m
p
e
l
a
j
a
r
i

l
i
t
e
-
r
a
t
u
r

u
n
t
u
k

m
e
n
e
n
-
t
u
k
a
n

f
r
a
k
s
i
-
f
r
a
k
s
i
m
i
n
y
a
k

b
u
m
i

h
a
s
i
l
p
e
n
y
u
l
i
n
g
a
n
.

(
*
)

M
a
m
p
u

m
e
n
j
e
l
a
s
-
k
a
n

p
r
o
s
e
s

p
e
m
-
b
e
n
t
u
k
a
n

m
i
n
y
a
k
b
u
m
i

d
a
n

g
a
s

a
l
a
m
.

M
a
m
p
u

m
e
n
j
e
l
a
s
-
k
a
n

k
o
m
p
o
n
e
n
-
k
o
m
p
o
n
e
n

u
t
a
m
a
p
e
n
y
u
s
u
n

m
i
n
y
a
k
b
u
m
i
.

M
a
m
p
u

m
e
n
a
f
s
i
r
-
k
a
n

b
a
g
a
n

p
e
n
y
u
-
l
i
n
g
a
n

b
e
r
t
i
n
g
k
a
t
u
n
t
u
k

m
e
n
j
e
l
a
s
k
a
n
d
a
s
a
r

d
a
n

t
e
k
n
i
k
p
e
m
i
s
a
h
a
n

f
r
a
k
s
i
-
f
r
a
k
s
i

m
i
n
y
a
k

b
u
m
i
.
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s
U
r
a
i
a
n
U
r
a
i
a
n
U
r
a
i
a
n
G
a
s
-
g
a
s

p
e
t
r
o
le
u
m
P
e
t
r
o
le
u
m

e
t
e
r
B
e
n
s
in
M
in
y
a
k

t
a
n
a
h
/
k
e
r
o
s
in
M
in
y
a
k

s
o
la
r
M
in
y
a
k

d
ie
s
e
l
M
in
y
a
k

p
e
lic
in
L
ilin
M
in
y
a
k

b
a
k
a
r
B
i
t
u
m
e
n
/
a
s
p
a
l
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
M
e
n
g
a
p
a

g
a
s

a
l
a
m
,
m
i
n
y
a
k

b
u
m
i
,

d
a
n

b
a
t
u
b
a
r
a

d
i
s
e
b
u
t

b
a
h
a
n

b
a
k
a
r
f
o
s
i
l
?
U
n
s
u
r

p
e
n
y
u
s
u
n

m
i
n
y
a
k
b
u
m
i

d
e
n
g
a
n

p
e
r
s
e
n
t
a
s
e
t
e
r
b
e
s
a
r

a
d
a
l
a
h

.

.

.

.
a
.
k
a
r
b
o
n
b
.
o
k
s
i
g
e
n
c
.
n
i
t
r
o
g
e
n
d
.
h
i
d
r
o
g
e
n
e
.
b
e
l
e
r
a
n
g
P
e
r
h
a
t
i
k
a
n

g
a
m
b
a
r

b
a
g
a
n
p
e
n
y
u
l
i
n
g
a
n

m
i
n
y
a
k

m
e
n
-
t
a
h

s
e
c
a
r
a

b
e
r
t
i
n
g
k
a
t
b
e
r
i
k
u
t
!
B
e
r
d
a
s
a
r
k
a
n

h
a
s
i
l

d
a
r
i
b
a
g
a
n

p
e
n
y
u
l
i
n
g
a
n
m
i
n
y
a
k

m
e
n
t
a
h

d
i

a
t
a
s
,
t
e
n
t
u
k
a
n

k
e
g
u
n
a
a
n

d
a
r
i
f
r
a
k
s
i
-
f
r
a
k
s
i

m
i
n
y
a
k
m
e
n
t
a
h

t
e
r
s
e
b
u
t
!
8 Silabus
S
e
n
y
a
w
a

h
i
d
r
o
k
a
r
b
o
n
y
a
n
g

m
e
m
i
l
i
k
i

n
i
l
a
i

o
k
t
a
n
t
e
r
e
n
d
a
h

a
d
a
l
a
h

.

.

.

.
a
.
b
u
t
a
n
a
b
.
p
e
n
t
a
n
a
c
.
1
-
p
e
n
t
e
n
a
d
.
n
-
h
e
k
s
a
n
a
e
.
n
-
h
e
p
t
a
n
a
J
e
l
a
s
k
a
n

h
u
b
u
n
g
a
n

k
u
a
l
i
-
t
a
s

b
e
n
s
i
n

d
e
n
g
a
n

j
u
m
l
a
h
g
a
s

C
O

y
a
n
g

d
i
h
a
s
i
l
k
a
n
!
P
i
l
i
h
a
n
G
a
n
d
a
U
r
a
i
a
n
T
e
s
t
e
r
t
u
l
i
s
T
e
s
t
e
r
t
u
l
i
s

M
a
m
p
u

m
e
m
b
e
d
a
-
k
a
n

k
u
a
l
i
t
a
s

b
e
n
s
i
n
b
e
r
d
a
s
a
r
k
a
n
b
i
l
a
n
g
a
n

o
k
t
a
n
n
y
a
.

M
a
m
p
u

m
e
n
j
e
l
a
s
-
k
a
n

d
a
m
p
a
k

p
e
m
-
b
a
k
a
r
a
n

b
a
h
a
n

b
a
k
a
r
t
e
r
h
a
d
a
p

l
i
n
g
k
u
n
g
a
n
.
4
.
M
e
n
g
k
a
j
i

p
e
r
b
e
d
a
-
a
n

k
u
a
l
i
t
a
s

b
e
n
s
i
n
b
e
r
d
a
s
a
r
k
a
n

b
i
-
l
a
n
g
a
n

o
k
t
a
n
n
y
a
.
5
.
M
e
n
d
i
s
k
u
s
i
k
a
n
d
a
m
p
a
k

n
e
g
a
t
i
f
p
e
m
b
a
k
a
r
a
n

b
a
h
a
n
b
a
k
a
r

t
e
r
h
a
d
a
p

m
a
-
n
u
s
i
a

d
a
n

l
i
n
g
k
u
n
g
-
a
n
,

s
e
r
t
a

a
l
t
e
r
n
a
t
i
f
p
e
n
g
g
a
n
t
i

b
a
h
a
n
b
a
k
a
r

y
a
n
g

a
m
a
n
.

(

)
K
o
m
p
e
t
e
n
s
i
D
a
s
a
r
M
a
t
e
r
i

P
o
k
o
k
/
P
e
m
b
e
l
a
j
a
r
a
n
K
e
g
i
a
t
a
n
P
e
m
b
e
l
a
j
a
r
a
n
I
n
d
i
k
a
t
o
r

P
e
n
c
a
p
a
i
a
n
K
o
m
p
e
t
e
n
s
i
P
e
n
i
l
a
i
a
n
T
e
k
n
i
k
B
e
n
t
u
k
I
n
s
t
r
u
m
e
n
C
o
n
t
o
h

I
n
s
t
r
u
m
e
n
A
l
o
k
a
s
i
W
a
k
t
u
A
l
a
t

d
a
n

S
u
m
b
e
r
B
e
l
a
j
a
r
N
i
l
a
i

d
a
n
M
a
t
e
r
i

y
a
n
g
D
i
i
n
t
e
g
r
a
s
i
k
a
n
B
e
n
s
i
n

d
a
n
d
a
m
p
a
k
p
e
m
b
a
k
a
r
a
n
b
a
h
a
n

b
a
k
a
r
9 Kimia Kelas X
Rencana Pelaksanaan Pembelajaran
Bab I Larutan Elektrolit dan Nonelektrolit
Sekolah : . . . . . . . . . .
Kelas/Semester : X/2
Mata Pelajaran : Kimia
Alokasi Waktu : 4 45 menit (2 pertemuan)
Standar Kompetensi : 3. Memahamisifat-sifatlarutannonelektrolitdanelektrolitsertareaksioksidasireduksi.
Kompetensi Dasar : 3.1 Mengidentifikasi sifat larutan nonelektrolit dan elektrolit berdasarkan data hasil
percobaan.
Indikator Pencapaian Kompetensi
Mampumengidentifikasisifat-sifatlarutanelektrolitdannonelektrolitmelaluipercobaan.
Mampumengelompokkanlarutankedalamlarutanelektrolitdannonelektrolitberdasarkansifathantaran
listriknya.
Mampumenjelaskanpenyebabkemampuanlarutanelektrolitmenghantarkanaruslistrik.
Mampumendeskripsikanbahwalarutanelektrolitdapatberupasenyawaiondansenyawakovalenpolar.
Tujuan Pembelajaran
Pesertadidikmampu:
1. membedakansifat-sifatlarutanelektrolitdannonelektrolit;
2. mengelompokkanlarutankedalamlarutanelektrolitdannonelektrolit;
3. menjelaskanpenyebabkemampuanlarutanelektrolitmenghantarkanaruslistrik;
4. menyebutkanbahwalarutanelektrolitterdiriatassenyawaiondansenyawakovalenpolar.
Nilai dan Materi yang Diintegrasikan
1. Pendidikankarakter:RasaInginTahu,Kreatif,danGemarMembaca.
2. Ekonomikreatif:Kreatif,Komunikatif,danPantangMenyerah.
Materi Pembelajaran
1. Sifat-SifatLarutanElektrolitdanNonelektrolit
2. CaraLarutanElektrolitMenghantarkanListrik
3. JenisElektrolitBerdasarkanIkatannya
Metode Pembelajaran
1. ModelPembelajaran
a. Direct Instruction(DI)
b. Cooperative Learning (CL)
2. Metode
a. Tanyajawab
b. Eksperimen
Langkah-Langkah Kegiatan
Pertemuan Pertama
1. Kegiatan Pendahuluan (10 menit)
a. Motivasi
Gurumenanyakanperbedaanantaracampuranhomogendanheterogenmelaluicontoh.
b. Prasyarat Pengetahuan
Siswadapatmenjelaskanpengertianlarutan.
10 Rencana Pelaksanaan Pembelajaran (RPP)
2. Kegiatan Inti (75 menit)
a. Eksplorasi
Gurumenjelaskanpengertianlarutanelektrolitdanlarutannonelektrolit.
Gurumenjelaskancaramenentukanderajationisasilarutan.
Gurumenjelaskancaralarutanelektrolitmenghantarkanlistrik.
b. Elaborasi
Siswamengidentifikasiperbedaanciri-cirilarutanelektrolitdannonelektrolitmelaluipercobaan.
Setelahmelakukanpercobaan,gurumemintasiswauntukmengembangkanrasaingintahunya
mengenaisifatelektrolitdannonelektrolitdarilarutan-larutanyangadadisekitarsiswa.Dengan
rasaingintahu,siswaakantertarikuntukmengujisifat-sifatelektrolitsuatularutan.(*)
Siswamenjawabpertanyaan-pertanyaandanmembuatkesimpulanmengenaihasilpercobaan.
Setelahmengetahuiciri-cirilarutanelektrolitdannonelektrolit,gurumemintasiswauntukbersikap
kreatifdenganmenerapkansifatlarutanelektrolityangadadisekitaruntukmenyalakanlampusaat
terjadipemadamanlistrik.Dengandemikian,siswabelajarmengaplikasikanilmudidunianyata.()
Siswamengerjakansoal-soallatihanpadaujiKompetensi1mengenaisifat-sifatlarutanelektrolit
dannonelektrolit.
Siswaberkreasimembuatbaganataugambarcarabeberapalarutanelektrolitmenghantarkanlistrik.
Guru meminta siswa berlatih bersikap komunikatif dengan membentuk kelompok belajar dan
melakukan diskusi mengenai senyawa elektrolit dan nonelektrolit. Siswa saling membantu dan
bertukarpendapat.Dengandemikian,materiakanlebihmudahdipahami.(**)()
Siswamengerjakansoal-soallatihanpadaUjiKompetensi2mengenaicaralarutanelektrolitmeng-
hantarkanlistrik.
(*) Pendidikankarakter(RasaInginTahu).
(**) Pendidikankarakter(Kreatif).
() Ekonomikreatif(Kreatif).
() Ekonomikreatif(komunikatif).
c. Konfirmasi
Gurumemintasiswamengumpulkanpembahasanhasilpercobaan.
Gurubersamasiswamembahasdanmenyimpulkanhasilpercobaan.
Gurubersamasiswamembahassoal-soallatihanyangdikerjakansiswa.
3. Kegiatan Penutup (5 menit)
Gurumemintasiswamempelajarimaterijeniselektrolitberdasarkanikatannya.
Pertemuan Kedua
1. Kegiatan Pendahuluan (5 menit)
a. Motivasi
Gurumenanyakanpengertiansenyawaion,kovalenpolar,dankovalennonpolar.
b. Prasyarat Pengetahuan
Siswamengetahuiprosesionisasizatelektrolitdalamair.
2. Kegiatan Inti (30 menit)
a. Eksplorasi
Gurumenjelaskanpengertiansenyawaiondansenyawakovalenpolar.
Gurumenjelaskanbeberapacontohsenyawaiondansenyawakovalenpolar.Gurumemotivasi
siswauntukmencariinformasiyanglebihlengkapmengenaisenyawaiondansenyawakovalen
(polardannonpolar)dariberbagailiteratur.Denganbanyakmembaca,pengetahuansiswaakan
semakinluas.(***)
Gurumemotivasisiswauntukbersikappantangmenyerahdalambelajar,baiksaatmempelajari
materimaupunmengerjakansoal.Denganbanyakbelajardanberlatih,pemahamansiswamengenai
suatukonsepakansemakinmeningkat.()
(***) PendidikanKarakter(GemarMembaca).
() EkonomiKreatif(PantangMenyerah).
11 Kimia Kelas X
b. Elaborasi
Siswamengerjakansoal-soalUjiKompetensi3.
c. Konfirmasi
Gurubersamasiswamembahassoal-soalyangdikerjakanolehsiswa.
3. Kegiatan Penutup (5 menit)
Gurumenugasisiswauntukmengerjakansoal-soalulanganharianpadababini.
Alat Sumber Belajar
1. BukuPG Kimia Kelas X Semester 2,IntanPariwara,2012
2. BukuPR Kimia Kelas X Semester 2,IntanPariwara,2012
3. Seperangkatalatdanbahanuntukpercobaanidentifikasisifatlarutanelektrolitdannonelektrolit
4. Buku BSE Kimia X untuk SMA/MA,AriHarnantodanRuminten,Depdiknas,2009
Penilaian Hasil Belajar
1. Teknik Penilaian dan Bentuk Instrumen
a. Teknik Penilaian
1) Testertulis
2) Tesunjukkerja
b. Bentuk Instrumen
1) Uraian
2) Ujipetikkerjaprosedur
2. Contoh Instrumen
a. Uraian
Suatuzatdalambentukpadatantidakdapatmenghantarkanaruslistrik,tetapisaatdilarutkandalamair
zattersebutdapatmenghantarkanaruslistrik.Berilahpenjelasanmengenaihaltersebut!
b. Uji Petik Kerja Prosedur
Lakukanpercobaanuntukmengidentifikasisifat-sifatlarutanelektrolitdannonelektrolitdengancara
menyusunrangkaianalatpengujielektrolitdaribaterai,bolalampu,kabel,elektrodekarbon,dangelas
beker!Ujibeberapalarutanuntukmengetahuiperbedaanciri-cirilarutanelektrolitdannonelektrolit!
Rubrik:
Nilaiakhir=
Jumlah skor perolehan siswa
Jumlah skor maksimum
100
________,______________
Mengetahui,
KepalaSMA______________ GuruMataPelajaran
........................ ........................
___________________________ ___________________________
NIP_______________________ NIP_______________________
No. Aspek
1.
2.
3.
4.
Kesesuaian kegiatan dengan prosedur
Perolehandata
Pengolahandata
Kesimpulan
Total
Skor Maksimum
20
10
15
5
50
Skor Perolehan Siswa
12 Rencana Pelaksanaan Pembelajaran (RPP)
Rencana Pelaksanaan Pembelajaran
Bab IV Minyak Bumi
Sekolah : . . . . . . . . . .
Kelas/Semester : X/2
Mata Pelajaran : Kimia
Alokasi Waktu : 4 45 menit (2 pertemuan)
Standar Kompetensi : 4. Memahami sifat-sifat senyawa organik atau dasar gugus fungsi dan senyawa
makromolekul
Kompetensi Dasar : 4.4 Menjelaskanprosespembentukandanteknikpemisahanfraksi-fraksiminyakbumi
sertakegunaannya.
Indikator Pencapaian Kompetensi
Mampumendeskripsikanprosespembentukanminyakbumidangasalam.
Mampumenjelaskankomponen-komponenutamapenyusunminyakbumi.
Mampumenafsirkanbaganpenyulinganbertingkatuntukmenjelaskandasardanteknikpemisahanfraksi-
fraksiminyakbumi.
Mampumengkajiperbedaankualitasbensinberdasarkanbilanganoktannya.
Mendeskripsikandampaknegatifpembakaranbahanbakarterhadapmanusiadanlingkungansertaalternatif
penggantibahanbakaryangaman.
Tujuan Pembelajaran
Pesertadidikmampu:
1. menjelaskanprosespembentukanminyakbumidangasalam;
2. menyebutkankomponen-komponenutamaminyakbumi;
3. menjelaskanbaganpenyulinganbertingkatpadaminyakbumidanmenjelaskanteknikpemisahanminyak
bumi,
4. menjelaskanperbedaankualitasbensinberdasarkanbilanganoktannya;
5. menjelaskandampaknegatifpembakaranbahanbakarterhadapmanusiadanlingkungansertaalternatif
bahanbakaryangaman.
Nilai dan Materi yang Diintegrasikan
1. Pendidikankarakter:PeduliLingkungan.
2. Ekonomikreatif:Kreatif.
Materi Pembelajaran
1. Minyakbumidangasalam
2. Bensindandampakpembakaranbahanbakar
Metode Pembelajaran
1. ModelPembelajaran
a. Direct Instruction(DI)
b. Cooperative Learning (CL)
2. Metode
a. Tanyajawab
b. Diskusiinformasi
Langkah-Langkah Kegiatan
Pertemuan Pertama
1. Kegiatan Pendahuluan (10 menit)
a. Motivasi
Gurumemulaipembelajarandenganmenanyakankesiswatentangsenyawahidrokarbonbeserta
contohnya.
13 Kimia Kelas X
b. Prasyarat Pengetahuan
Siswadapatmenyebutkancontohsenyawahidrokarbon,misalminyakbumi.
2. Kegiatan Inti (75 menit)
a. Eksplorasi
Gurumenjelaskanprosespembentukanminyakbumidangasalam.
Gurumenjelaskankandunganberbagaisenyawakarbondalamminyakbumi.
Gurumenjelaskanprosesmenyulinganminyakbumidanfraksi-fraksinya.
b. Elaborasi
Siswamenyebutkankegunaandarifraksi-fraksiminyakbumi.
Siswamengerjakansoal-soallatihanpadaUjiKompetensi1dantugaspadasubbabini.
c. Konfirmasi
Gurumenjelaskanpembahasansoal-soallatihanyangdikerjakansiswa.
3. Kegiatan Penutup (5 menit)
Gurumemintasiswamengumpulkanhasiltugasnyapadapertemuanselanjutnya.
Pertemuan Kedua
1. Kegiatan Pendahuluan (5 menit)
a. Motivasi
Gurumenanyakankepadasiswatentangsenyawayangdihasilkandarireaksipembakaran.
b. Prasyarat Pengetahuan
Siswamengetahuipersamaanreaksipembakaran.
2. Kegiatan Inti (30 menit)
a. Eksplorasi
Gurumenjelaskantentangbensindanpenentuanbilanganoktannya.
Gurumembericontohsenyawa-senyawahidrokarbonyangdigunakanuntukmenaikkanbilangan
oktanpadabensin.
Gurumenjelaskandampaknegatifpembakaranbahanbakar,khususnyabensin.Gurumenjelaskan
bahwapembakaranbensinmenghasilkangasCOyangberbahayabagikesehatanjikaterhirup.
Olehkarenaitu,gurumengingatkansiswaagartidakmenghidupkanmensinkendaraanbermotordi
dalamruangtertutupagarlingkungandidalamrumahbersihdaripolutangasCO.(*)
Gurumembukaforumdiskusisiswauntukmencaribahanbakaralternatifsebagaipenggantibensin.
Gurumembagisiswadalamkelompok-kelompokdiskusiuntukmendiskusikanbahanbakaralternatif
penggantibensin.Setiapkelompokdimintakreatifmengemukakanpendapatnyatentangpandangan
kelompoknyaterhadapsuatubahantertentubesertacarapengolahannyasehinggabahantersebut
dapatdijadikansebagaibahanbakarpenggantibensin.Kelompokyanglainjugadimintakreatif
menanggapidanmemberimasukankepadakelompokyangmemimpindiskusi.()
(*) Pendidikankarakter(PeduliLingkungan).
() Ekonomikreatif(Kreatif).
b. Elaborasi
Siswamenyebutkanberbagaibahanalamyangdapatdijadikansebagaialternatifpenggantibensin
atausolar.
Siswamengerjakansoal-soalUjiKompetensi2.
c. Konfirmasi
Gurubersamasiswamembahassoal-soalyangdikerjakansiswa.
3. Kegiatan Penutup (5 menit)
Gurumenugasisiswauntukmengerjakansoal-soalulanganharianpadababini.
14 Rencana Pelaksanaan Pembelajaran (RPP)
Alat Sumber Belajar
1. BukuPG Kimia Kelas X Semester 2,IntanPariwara,2012
2. BukuPR Kimia Kelas X Semester 2,IntanPariwara,2012
3. Buku BSE Kimia X untuk SMA/MA,AriHarnantodanRuminten,Depdiknas,2009
Penilaian Hasil Belajar
1. Teknik Penilaian dan Bentuk Instrumen
a. Teknik Penilaian
Testertulis
b. Bentuk Instrumen
1) Pilihanganda
2) Uraian
2. Contoh Instrumen
a. Pilihan Ganda
Lilinmerupakanhasilpengolahanminyakbumiyangberwujudpadat.Lilindiperolehdariprosespengolahan
fraksi....
a. oli
b. solar
c. residu
d. bensin
e. kerosin
b. Uraian
Sebutkansenyawa-senyawahidrokarbonyangterdapatdidalamminyakbumi!
________,______________
Mengetahui,
KepalaSMA______________ GuruMataPelajaran
........................ ........................
___________________________ ___________________________
NIP_______________________ NIP_______________________
15 Kimia Kelas X
Bab I Larutan Elektrolit dan
Nonelektrolit
A. Pilihan Ganda
1. Jawaban: e
Larutan merupakan campuran homogen
(serbasama)antaraduazatataulebih.Garamyang
dimasukkan ke dalam air dan diaduk akan
membentukcampuranserbasama.Larutangaram
jika disaring dengan kertas saring tidak akan
meninggalkanpartikelzatterlarut.Sementaraitu,
pasir, tanah, kerikil, dan kopi akan membentuk
campuranheterogendanmeninggalkanpartikelzat
terlarutsaatdisaringdengankertassaring.
2. Jawaban: c
Larutan elektrolit lemah mengalami ionisasi
sebagian sehingga dalam larutannya hanya
mengandung sedikit ion. Hal ini mengakibatkan
larutanelektrolithanyamampumenyalakanlampu
dengan redup atau menghasilkan sedikit
gelembunggas.
3. Jawaban: c
Larutan yang dapat menyalakan lampu dengan
redup saat diuji dengan alat uji elektrolit adalah
larutanelektrolitlemah,misalasamcuka.Asam
sulfatdangaramdapuradalahelektrolitkuatyang
dapat menyalakan lampu dengan terang. Gula
pasir dan urea adalah senyawa nonelektrolit
sehinggatidakdapatmenyalakanlampu.
4. Jawaban: a
Larutanelektrolitkuatmerupakanlarutanyangakan
terionisasi sempurna jika dilarutkan dalam air,
misalHCldanH
2
SO
4
.Sementaraitu,CH
3
COOH
danNH
3
merupakanlarutanelektrolitlemahkarena
hanyaterionisasisebagiansaatdilarutkandalam
air.C
6
H
12
O
6
merupakanlarutannonelektrolitkarena
didalamairtidakdapatterionisasi.
5. Jawaban: e
Menyalakan lampu dengan terang adalah ciri
larutanelektrolitkuat.
6. Jawaban: b
Jumlahmolzatmula-mula=30mol
Jumlahmolzatyangterionisasi
=(3020)mol=10mol
=
jumlah mol zat yang terionisasi
jumlah mol zat mula-mula
=
10
30
=0,333.
7. Jawaban: e
Jumlahmolzatmula-mula=
massa zat
massa molekul zat
=
20
40
=0,5mol
=
jumlah mol zat terionisasi
jumlah mol zat mula-mula
=
0,5 0,2
0,5

=
0,3
0,5
=0,6
Olehkarenamempunyaiderajationsiasi0<<1,
zattersebuttermasukelektrolitlemah.
8. Jawaban: b
Alkohol dan bensin merupakan senyawa
nonelektrolit.Bentuklarutandarizat-zattersebut
tidakdapatmenghantarkanaruslistrik.Sementara
itu,airlaut,airjeruk,sodakue,dangaramdapur
merupakanzatelektrolit.Dalambentuklarutannya,
zat-zattersebutakanterionisasisehinggamampu
menghantarkanaruslistrik.
9. Jawaban: b
HClmerupakanzatelektrolitkuat.Dalamair,HCl
akanterionisasimenjadiionH
+
danCl

sehingga
dapatmenghantarkanaruslistrik.Dalambenzena,
HCltidakdapatlarutdantidakterionisasisehingga
tidakdapatmenghantarkanaruslistrik.
10. Jawaban: a
Bahan kimia yang termasuk nonelektrolit yaitu
lelehannaftalena(kamper).Sementaraitu,larutan
natriumhidroksida,larutankaliumiodida,larutan
asametanoat,danlarutanasamsulfatmerupakan
larutanelektrolit.
B. Uraian
1. Larutantersusundarizatterlarutdanpelarut.Zat
terlarutdanpelarutdalamsuatularutantidakdapat
dibedakan.Dalamlarutan,jumlahzatterlarutlebih
sedikitdaripadapelarut.
2. a. Larutan elektrolit akan menghasilkan
gelembung gas dan menyalakan lampu.
Larutannonelektrolittidakakanmenghasilkan
gelembunggasdantidakmenyalakanlampu.
16 Kunci Jawaban dan Pembahasan
b. Larutan elektrolit kuat akan menghasilkan
banyak gelembung gas dan menyalakan
lampudenganterang.
Larutan elektrolit lemah hanya akan
menghasilkansedikitgelembunggasdantidak
dapat menyalakan lampu atau menyalakan
lampudenganredup.
3. Contohzatelektrolit:
a. asamcuka,
b. garamdapur,dan
c. kapursirih.
Contohzatnonelektrolit:
a. urea,
b. gula,dan
c. alkohol.
4. Ionisasi adalah peristiwa terurainya molekul zat
elektrolit menjadi partikel-partikel penyusunnya
yang disebut ion saat zat elektrolit tersebut
dilarutkandalamair.
Contoh:NaCl(aq)Na
+
(aq)+Cl

(aq)
5. H
3
PO
4

3H
+
+PO
4
3
=0,40
Jumlahmolzatmula-mula=5mol
=
jumlah mol zat yang terionisasi
jumlah mol zat mula-mula
Jumlahmolzatyangterionisasi
=jumlahmolzatmula-mula
=0,405mol
=2mol
Jadi,jumlahmolzatyangterionisasiadalah2mol.
A. Pilihan Ganda
1. Jawaban: a
Teori ion menyatakan bahwa dalam larutan
elektrolit terdapat ion-ion yang dapat bergerak
bebas.Ion-ionyangdapatbergerakbebastersebut
menghantarkanaruslistrikmelaluilarutan.Teori
inidikemukakanolehArrhenius.
2. Jawaban: d
Teori Arrhenius menyatakan bahwa larutan
elektrolitdapatmenghantarkanaruslistrikkarena
ion-iondalamlarutandapatbergerakbebas.
3. Jawaban: a
Anion(ionnegatif)yangteruraidarilarutanelektrolit
padaproseselektrolisisakanmelepaselektronke
anode.Elektrontersebutmengalirdarianodeke
katodemelaluisumberarus.
4. Jawaban: d
H
2
SO
4
merupakan larutan asam kuat sehingga
akanterionisasisempurnamenjadi2H
+
danSO
4
2
.
5. Jawaban: a
Garamelektrolitkuatberasaldariasamkuatdan
basakuat.KClberasaldariasamkuatHCldan
basakuatKOH.Sementaraitu,NH
4
Cl,Al
2
(SO
4
)
3
,
HCOOK,danCH
3
COONaadalahgaramlemah.
NH
4
ClberasaldariasamkuatHCldanbasalemah
NH
4
OH.Al
2
(SO
4
)
3
berasaldariasamkuatH
2
SO
4
danbasalemahAl(OH)
3
.HCOOKberasaldaribasa
kuatKOHdanasamlemahHCOOH.CH
3
COONa
berasal dari basa kuat NaOH dan asam lemah
CH
3
COOH.
6. Jawaban: b
Dayahantarlistrikpalingbesardimilikiolehlarutan
elektrolit kuat. H
2
SO
4
dan NaCl merupakan
elektrolitkuat.Namun,jumlahiondariH
2
SO
4
lebih
banyak daripada NaCl sehingga larutan yang
mempunyaidayahantarlistrikpalingbesaradalah
H
2
SO
4
.CH
3
COOHdanNH
4
OHadalahelektrolit
lemah, sedangkan CH
3
OH merupakan non-
elektrolit.
7. Jawaban: b
Larutanyangbersifatelektrolit(kuatataulemah)
dapatmenghantarkanaruslistrik.Larutantersebut
akan menyalakan lampu dan menghasilkan
gelembung gas atau tidak menyalakan lampu,
tetapimenghasilkangelembunggas.
8. Jawaban: e
Larutanyangtermasukelektrolitkuatyaitularutan
yangberasaldariasamkuat,basakuat,danlarutan
garamdaribasakuatdanasamkuat.Larutanasam
lemahdanbasalemahtermasukelektrolitlemah.
9. Jawaban: a
Reaksiionisasitiap-tiapsenyawasebagaiberikut.
H
2
SO
4
2H
+
+SO
4
2
NH
4
OHNH
4
+
+OH

C
2
H
5
OH
C
6
H
12
O
6

CH
3
COOHH
+
+CH
3
COO

Dari persamaan reaksi terlihat bahwa H


2
SO
4
mempunyaiionpalingbanyak,yaitutigaion(dua
ionH
+
dansatuionSO
4
2
).
10. Jawaban: c
Senyawa yang tetap berbentuk molekul saat
dilarutkan dalam air merupakan senyawa
nonelektrolit. Senyawa nonelektrolit tidak akan
terionisasi saat dilarutkan dalam air dan
mempunyai derajat ionisasi 0. Senyawa
17 Kimia Kelas X
nonelektrolittidakdapatmenghantarkanaruslistrik
sehinggatidakdapatmenyalakanlampudantidak
menimbulkangassaatdiujidenganalatpenguji
elektrolit.
11. Jawaban: b
Reaksi elektrolisis AgCl menghasilkan endapan
perakdikatodedangasklorindianode.
12. Jawaban: c
LarutanMg(OH)
2
adalahlarutanelektrolitkuatyang
akan terionisasi sempurna. Larutan ini mampu
menyalakanlampudenganterangdanmenimbulkan
banyakgelembunggas.
13. Jawaban: c
BaSO
4
adalahgaramdariasamkuat(H
2
SO
4
)dan
basa kuat (Ba(OH)
2
) sehingga BaSO
4
akan
terionisasisempurna.IonBa
2+
menangkapelektron
darikatodemembentukendapanBadanionSO
4
2
akanmelepaselektronkeanodemembentukgas
SO
2
. Elektron mengalir dari anode ke katode
melaluisumberarus.
14. Jawaban: c
KertassaringyangdibasahidenganlarutanCuCrO
4
laludijepitdenganpenjepitbuayadandihubung-
kandengansumberaruslistrikakanmenunjukkan
peristiwapergerakanionmenujuelektrode.Pada
kutubpositif(anode)kertassaringakanberwarna
kuning karena adanya ion CrO
4
2
. Pada kutub
negatif(katode)kertassaringakanberwarnabiru
yangmerupakanwarnaionCu
2+
.
15. Jawaban: c
AgCladalahgaramyangberasaldaribasakuat
danasamkuatsehinggatermasukelektrolitkuat.
AgClterionisasisempurnadalamairmenjadiAg
+
danCl

.
B. Uraian
1. Peristiwatersebutmenunjukkanbahwazatpadat
dapat terionisasi saat dilarutkan dalam air. Zat
tersebut terurai menjadi ion-ionnya yang dapat
bergerakbebassehinggamampumenghantarkan
aruslistrik.Berbedadenganbentukpadatanyang
mempunyaiikatankuatdantidakmengandungion.
2. Senyawaelektrolitdapatmenghantarkanaruslistrik
jikaberadadalambentuklarutan.Dalambentuk
larutan, senyawa elektrolit akan mengalami
ionisasi. Selanjutnya, kedua elektrode yang
berbedadimasukkankedalamlarutanelektrolit.
Kedua elektrode tersebut dihubungkan pada
sumber arus listrik sehingga terbentuk katode
(elektrode yang bermuatan negatif) dan anode
(elektrode yang bermuatan positif). Pada saat
sumber arus listrik dihubungkan, ion-ion positif
dalamlarutanelektrolitakanmenangkapelektron
dari katode. Sebaliknya, ion-ion negatif dalam
larutan elektrolit melepas elektron ke anode.
Selanjutnya,elektronyangtelahditangkapanode
mengalir ke katode melalui sumber arus listrik.
Pelepasandanpenerimaanelektronolehionini
akanmengakibatkanadanyahantaranaruslistrik.
3. a. Ba(OH)
2
(aq)Ba
2+
(aq)+2OH

(aq)
b. K
2
CO
3
(aq)2K
+
(aq)+CO
3
2
(aq)
c. NaNO
3
(aq)Na
+
(aq)+NO
3

(aq)
d. Ca
3
(PO
4
)
2
(aq)3Ca
2+
(aq)+2PO
4
3
(aq)
e. CH
3
COONa(aq)CH
3
COO

(aq)+Na
+
(aq)
4. a. Contohlarutan
1) elektrolitkuat:H
2
SO
4
danNaOH
2) elektrolitlemah:HCOOHdanHCN
3) nonelektrolit:C
2
H
5
OHdanC
8
H
18
b. Gejalayangmunculjikadiujidenganalatuji
elektrolit.
1) Larutan elektrolit kuat akan mampu
menyalakan lampu dengan terang dan
menimbulkanbanyakgelembunggas.
2) Larutan elektrolit lemah akan mampu
menyalakan lampu dengan redup atau
tidak mampu menyalakan lampu dan
menimbulkangelembunggas.
3) Larutan nonelektrolit tidak mampu me-
nyalakanlampudantidakmenimbulkan
gelembunggas.
5. =
jumlah mol zat yang terionisasi
jumlah mol zat mula-mula
Jumlahmolzatyangterionisasi
=jumlahmolzatmula-mula
a. Ion-ionNaOHyangterbentuk
=jumlahmolzatyangterionisasi
=11=1mol
b. Ion-ionH
2
SO
4
yangterbentuk
=jumlahmolzatyangterionisasi
=12=2mol
c. Ion-ionNH
4
OHyangterbentuk
=jumlahmolzatyangterionisasi
=0,51=0,5mol
d. Ion-ionC
2
H
5
COOHyangterbentuk
=jumlahmolzatyangterionisasi
=0,751=0,75mol
Semakin banyak ion terbentuk, semakin cepat
menghantarkan arus listrik. Urutan kecepatan
menghantarkanaruslistrikdariyangpalingtinggi
kerendahyaituH
2
SO
4
,NaOH,C
2
H
5
COOH,dan
NH
4
OH.
18 Kunci Jawaban dan Pembahasan
A. Pilihan Ganda
1. Jawaban: a
Senyawa yang dalam bentuk lelehan dapat
menghasilkan ion adalah senyawa ion. Lelehan
senyawa ion mengandung ion-ion yang dapat
bergerakbebassehinggadapatmenghantarkan
aruslistrik.Berbedadengansenyawakovalen
polar yang hanya dapat menghasilkan ion saat
dilarutkandalamair.
2. Jawaban: d
Adanyasuatugayatarik-menarikantaratomdalam
senyawakovalenpolardapatmemutuskanikatan-
ikatandalammolekulsehinggaterbentukion.
3. Jawaban: d
H
2
CO
3
merupakansenyawakovalenpolaryang
dapatmenghantarkanaruslistrik.Fe(OH)
3
danKOH
berikatanionik,sedangkanCH
4
danH
2
merupakan
senyawakovalennonpolaryangbersifatnonelektrolit
sehinggatidakdapatmenghantarkanaruslistrik.
4. Jawaban: a
Senyawaelektrolityangdalambentuklelehantidak
dapatmenghantarkanaruslistrikadalahsenyawa
kovalenpolar,contohHNO
3
.NaCl,KF,LiOH,dan
Sr(OH)
2
adalah senyawa ion yang dapat
menghantarkanaruslistrikdalambentuklelehan.
5. Jawaban: b
HCldanNH
3
adalahsenyawakovalen.NaFdan
KCladalahsenyawaionik.
6. Jawaban: b
LiOH merupakan senyawa elektrolit kuat yang
berasaldarisenyawaion.HBrmerupakanelektrolit
kuat yang berasal dari senyawa kovalen polar.
H
2
CO
3
,H
3
PO
4
,danNH
4
OHmerupakansenyawa
kovalenpolaryangbersifatelektrolitlemah.
7. Jawaban: a
Senyawakovalenpolardalambentuklelehantidak
dapat menghantarkan arus listrik tetapi dapat
menghantarkanaruslistrikdalambentuklarutan.
Sementaraitu,senyawaiondapatmenghantarkan
arus listrik baik dalam bentuk lelehan maupun
larutan.
8. Jawaban: b
Gula(C
6
H
12
O
6
)jikadilarutkandalamairtidakakan
terionisasi ( = 0) karena merupakan larutan
nonelektrolit. Di dalam larutan tersebut tidak
terdapat ion, tetapi semua masih dalam bentuk
molekul.
9. Jawaban: b
Senyawa kovalen merupakan senyawa yang
terbentukkarenapemakaianbersamapasangan
elektron, misal HBr (asam bromida). Reaksi
ionisasinyasebagaiberikut.
HBr(aq)H
+
(aq)+Br

(aq)
NaBr, KCl, LiOH, dan Mg(OH)
2
merupakan
senyawaion.
10. Jawaban: c
Senyawa berbentuk gas merupakan senyawa
kovalen. Senyawa kovalen yang dapat
menghantarkanaruslistrikdalambentuklarutan
adalah senyawa kovalen polar. Senyawa ini
terionisasidalamair.Ion-ionyangdihasilkandapat
menghantarkanaruslistrik.
B. Uraian
1. Ya, semua senyawa ion termasuk elektrolit.
Senyawaionadalahsenyawayangterbentukdari
atomlogamdanatomnonlogamyangberikatan
ion.Senyawaiondalambentuklelehanmaupun
larutandapatmenghantarkanaruslistrikkarena
adanyaion-ionyangbergerakbebas.Olehkarena
itu, senyawa ion termasuk elektrolit. Semua
senyawa ion merupakan elektrolit kuat, kecuali
Al(OH)
3
danFe(OH)
3
.
2. Hidrasiadalahprosesterkurungdanterikatnyaion
ataumolekulzatterlarutolehmolekul-molekulair.
Saat zat dilarutkan dalam air, zat tersebut akan
berinteraksidenganmolekulairsehinggaterurai
menjadiion-ionataumolekul-molekulnya.
3. Senyawaiondalambentuklelehanmaupunlarutan
dapatmenghantarkanaruslistrikkarenaion-ionnya
dapat bergerak bebas. Berbeda dengan bentuk
kristalnyayangtersusunrapat,ion-ionpenyusun-
nyatidakdapatbergerak.Olehkarenaitu,kristal
senyawaiontidakdapatmenghantarkanaruslistrik.
4. Larutansenyawakovalenpolarbersifatelektrolit
karena dalam larutan senyawa kovalen polar
mengalamiionisasimenjadiion-ionnyayangdapat
bergerak bebas. Dalam larutan, ion-ion dapat
melepasdanmenerimaelektronsehinggadapat
menghantarkanaruslistrik.
Senyawakovalennonpolarbersifatnonelektrolit
karenadalamlarutansenyawakovalennonpolar
tidak terionisasi, tetapi tetap dalam bentuk
molekulnya. Oleh karena itu, senyawa kovalen
nonpolartidakdapatmenghantarkanaruslistrik.
19 Kimia Kelas X
5. a. Sr(OH)
2
,KBr,danLiOH:senyawaion
Senyawa-senyawatersebuttermasukelektrolit
kuatkarenadapatterionisasisempurnadalam
air,mampumenyalakanlampudenganterang,
danmenghasilkanbanyakgelembunggas.
b. H
2
CO
3
,NH
4
Cl,danH
3
PO
4
:senyawakovalen
polar
Senyawa-senyawa kovalen polar tersebut
termasukelektrolitlemahkarenaterionisasi
sebagian dalam air, mampu menyalakan
lampu dengan redup, dan menghasilkan
sedikitgelembunggas.
c. H
2
OdanCl
2
:senyawakovalennonpolar
Senyawa-senyawa tersebut termasuk
nonelektrolit karena tidak dapat terionisasi
dalamairdantidakdapatmenghantarkanarus
listrik.
A. Pilihan Ganda
1. Jawaban: b
Larutan yang dapat menyalakan lampu dengan
terangdanmenghasilkangelembunggasadalah
larutanelektrolitkuat.HBrtermasukelektrolitkuat.
H
2
SdanFe(OH)
3
adalahelektrolitlemah.C
2
H
5
OH
danC
6
H
12
O
6
adalahnonelektrolit.
2. Jawaban: d
Jumlahmolzatyangterionisasi
=jumlahmolzatmula-mula
=0,42=0,8mol
Jumlahmolzatyangtidakterionisasi
=(20,8)mol
=1,2mol
3. Jawaban: e
Urea merupakan zat nonelektrolit. Dengan
demikian,sifat-sifatureasaatdilarutkandidalam
airyaitutidakmengalamiionisasidantetapsebagai
molekul, mempunyai = 0, tidak dapat
menghantarkanaruslistrik,tidakdapatmenyala-
kanlampu,sertatidakmenghasilkangelembung
gas.
4. Jawaban: d
Ion H
+
adalah kation. Kation akan menangkap
elektrondarikatode.SebanyakduaionH
+
akan
membentukH
2
denganmenangkapduaelektron
sehinggatimbulgelembunggashidrogen.
5. Jawaban: e
MgCl
2
danNaOHadalahsenyawaelektrolitkuat.
Persamaanreaksiionisasinyaditandaidengansatu
arah panah ke kanan. NH
4
OH, H
3
PO
4
, dan HF
adalahsenyawaelektrolitlemah.Persamaanreaksi
ionisasinyaditandaidenganduaarahpanahbolak-
balik. Persamaan reaksi ionisasi yang tepat
ditunjukkanolehreaksiH
3
PO
4
.
6. Jawaban: c
Anionakanmelepaselektronyangditangkapoleh
anode.Katodemelepaselektronyangkemudian
ditangkapolehkation.Elektronmengalirdari
anodemenujukatodemelaluisumberarus.
7. Jawaban: a
Larutanyangmengalamiionisasisempurnadalam
airadalahlarutanelektrolitkuat.NaOHdanHCl
adalahlarutanelektrolitkuat.CO(NH)
2
danCH
3
OH
adalah larutan nonelektrolit. H
2
S dan Al(OH)
3
adalahlarutanelektrolitlemah.Jadi,larutanyang
mengalami ionisasi sempurna adalah HCl dan
NaOH.
8. Jawaban: e
Larutanyangtidakdapatmenyalakanlamputetapi
mampu menghasilkan gelembung gas adalah
larutan elektrolit lemah, misal asam karbonat.
Asam klorida dan garam dapur adalah larutan
elektrolit kuat. Urea dan etanol adalah larutan
nonelektrolit.
9. Jawaban: e
Larutanyangmempunyaiderajationisasi()=1
adalah larutan elektrolit kuat, misal HBr, HNO
3
,
H
2
SO
4
, dan Ca(OH)
2
. HCOOH adalah larutan
elektrolitlemahyangmemilikiderajationisasi
0<<1.
10. Jawaban: c
IonPO
4
3
merupakanionyangbermuatannegatif
(anion). Dalam proses elektrolisis, anion akan
bergerakmenujuanode.
11. Jawaban: e
LarutanKOHadalahelektrolitkuatyangterionisasi
sempurnamenjadiion-ionnya.Ionpositif(kation)
akanmenerimaelektrondarikatode,sedangkan
ion negatif akan melepas elektron ke anode.
Proses pelepasan dan penerimaan elektron ini
mengakibatkanlarutanKOHdapatmenghantarkan
aruslistrik.
12. Jawaban: e
Larutan yang dapat menyalakan lampu dengan
redupdanmenimbulkangelembunggasadalah
larutanelektrolitlemah.ContohH
2
CO
3
,Al(OH)
3
,
danCH
3
COOH.Sementaraitu,NaOH,LiOH,dan
HCladalahlarutanelektrolitkuat.
20 Kunci Jawaban dan Pembahasan
13. Jawaban: c
SenyawaH
2
CO
3
merupakanelektrolitlemahyang
akanterionisasisebagianmenjadi2H
+
danCO
3
2
.
Ionisasisebagianditandaidenganduaarahpanah
bolak-balik.
14. Jawaban: c
Aliran listrik dalam larutan elektrolit dapat terus
berlangsungselamamasihadakationdananion.
Saatsemuakationsudahmenangkapelektrondari
katodedansemuaanionsudahmelepaselektron
keanode,aliranlistrikakanberhenti.
15. Jawaban: a
LarutanelektrolitlemahditunjukkanolehlampuA
danCkarenagelembunggastidakmenyalakan
lampu dan menyalakan lampu redup meskipun
tidak terbentuk gelembung gas. Sementara itu,
larutanBdanEadalahlarutanelektrolitkuatyang
ditandai dengan nyala lampu terang dan ada
gelembung gas. Larutan D adalah larutan
nonelektrolitkarenatidakdapatmenyalakanlampu
ataupunmenghasilkangelembunggas.
16. Jawaban: a
CaSO
4
merupakan senyawa ion yang akan
terionisasi sempurna dalam air dengan derajat
ionisasi()=1.CaSO
4
adalahsenyawaelektrolit
kuat yang mampu menyalakan lampu dengan
terangdanmenghasilkangelembunggas.
17. Jawaban: d
Larutan elektrolit kuat ditunjukkan oleh larutan
nomor 4) dan 5) karena mampu menghasilkan
banyak gelembung dan menyalakan lampu
meskipun larutan nomor 4) menyalakan lampu
denganredup.Larutannomor2)dan3)merupakan
larutan elektrolit lemah karena menghasilkan
sedikit gelembung gas dan tidak dapat
menyalakanlampuataumenyalakanlampudengan
redup. Sementara itu, larutan nonelektrolit
ditunjukkan oleh larutan nomor 1) karena tidak
dapat menghasilkan gelembung gas dan tidak
dapatmenyalakanlampu.Jadi,pasanganlarutan
elektrolit kuat dan nonelektrolit berturut-turut
ditunjukkanolehnomor5)dan1).
18. Jawaban: a
ZatAadalahelektrolitkuatyangakanterionisasi
sempurnasehinggajumlahmolyangtersisa0.
Zat B adalah nonelektrolit yang tidak bisa
terionisasisehinggajumlahmoltidakberkurang.
19. Jawaban: e
Larutanyangmempunyaiderajationisasi0<<1
adalahlarutanelektrolitlemah,misalNH
4
OHdan
H
2
CO
3
.LarutanKBr,NaOH,danHCladalahlarutan
elektrolitkuatdengan=1.
20. Jawaban: e
Larutan elektrolit lemah dapat menghasilkan
gelembung gas tetapi tidak dapat menyalakan
lampu atau dapat menyalakan lampu dengan
redup,sepertiditunjukkanolehgambarnomorIII.
Larutanyangdapatmenyalakanlamputetapitidak
menghasilkan gelembung gas juga termasuk
larutanelektrolitlemah,sepertiyangditunjukkan
oleh nomor I. Larutan nonelektrolit tidak dapat
menghasilkan gelembung gas dan tidak dapat
menyalakan lampu. Larutan nonelektrolit
ditunjukkanolehgambarnomorIV.Sementaraitu,
gambarnomorIImerupakanlarutanelektrolitkuat.
Larutan dapat menyalakan lampu dan
menghasilkanbanyakgelembunggas.
21. Jawaban: c
Dayahantarlistriklarutanelektrolitdipengaruhioleh
jumlah ion yang dihasilkan. Semakin banyak
jumlah ion dalam larutan, semakin besar daya
hantarlistriknya.
22. Jawaban: b
NaOHadalahsenyawaion.Sementaraitu,NH
4
Cl,
HBr, H
3
PO
4
, dan H
2
CO
3
termasuk senyawa
kovalenpolar.
23. Jawaban: d
NH
4
OHadalahsenyawaelektrolityangberikatan
kovalen. LiOH, Mg(OH)
2
, NaBr, dan Sr(OH)
2
,
merupakansenyawaelektrolityangberikatanion.
24. Jawaban: d
Senyawa ion yang dilarutkan dalam air akan
terionisasisempurnadalamlarutan.Ion-ionyang
dihasilkandapatbergerakbebassehinggadapat
menghantarkanaruslistrik.
25. Jawaban: d
Ikatanionadalahikatanyangterbentukdariatom
logam dan atom nonlogam, misal KCl, NaBr,
Mg(OH)
2
, KF, dan LiOH. Sementara itu, HClO
4
,
H
2
SO
4
,danNH
4
Cladalahsenyawakovalenpolar
yangterbentukdariatom-atomnonlogam.
26. Jawaban: d
SenyawaCl
2
merupakansenyawakovalennon-
polar yang tidak dapat terionisasi dalam air
sehinggatidakdapatmenghantarkanaruslistrik.
27. Jawaban: a
NaBrmerupakansenyawaion.Senyawaiontidak
dapat menghantarkan arus listrik dalam bentuk
padatan. Bentuk lelehan dan larutannya dapat
menghantarkanaruslistrikdandapatmenyalakan
lampusaatdiujidenganalatpengujielektrolit.Dalam
larutan,NaBrterionisasisempurnamenjadiionNa
+
danBr

.
21 Kimia Kelas X
28. Jawaban: d
Senyawa yang dapat menghantarkan arus listrik
dalam bentuk larutan adalah senyawa ion dan
kovalenpolar.Senyawaionmemilikititiklelehtinggi.
Oleh karena itu, senyawa x bukan senyawa ion
melainkansenyawakovalenpolar.Senyawayang
tidakdapatmenghantarkanaruslistrikmeskipun
dalambentuklarutanadalahsenyawakovalennon-
polar.
29. Jawaban: c
Larutan elektrolit kuat menghasilkan banyak
gelembunggasdanmenyalakanlampudengan
terang. Larutan elektrolit kuat ditunjukkan oleh
gambarnomor1)dan2).Larutanelektrolitlemah
menghasilkan sedikit gelembung gas dan
menyalakanlampudenganredupatautidakdapat
menyalakan lampu. Larutan elektrolit lemah
ditunjukkan oleh gambar nomor 4) dan 5).
Sementara itu, gambar nomor 3) menunjukkan
larutan nonelektrolit. Larutan nonelektrolit tidak
dapatmenyalakanlampudantidakmenghasilkan
gelembunggas.Jadi,larutanelektrolitkuatdan
elektrolit lemah berturut-turut ditunjukkan oleh
larutannomor1)dan5).
30. Jawaban: a
Senyawayangberikatanionmudahlarutdalam
air dan dapat menghantarkan arus listrik dalam
fasecair.Senyawaionmempunyaititikdidihdan
titiklelehyangtinggi.
B. Uraian
1. Saatdiujidenganalatpengujielektrolit,elektrolit
kuatdapatmenghantarkanaruslistrikdenganbaik,
dapat menyalakan lampu dengan terang, dan
menghasilkanbanyakgelembunggas.Elektrolit
kuatdalamairdapatterionisasisempurnadengan
derajationisasi()=1.
Contoh:H
2
SO
4
(aq)2H
+
(aq)+SO
4
2
(aq)
Sementara itu, elektrolit lemah kurang baik
menghantarkanaruslistrik,tidakdapatmenyalakan
lampuataudapatmenyalakanlampudenganredup
danmenghasilkansedikitgelembunggas.Elektrolit
lemah dalam air terionisasi sebagian dengan
derajationisasi0<<1.
Contoh:H
3
PO
4
(aq) 3H
+
(aq)+PO
4
3
(aq)
2. Derajationisasi()memengaruhidayahantarlistrik.
Semakin besar harga , semakin kuat sifat
elektrolitnya.Berartisemakinbanyakaruslistrik
yang dihantarkan. Sebaliknya, semakin kecil
harga,semakinlemahsifatelektrolitnya.Berarti
semakinlemahmenghantarkanaruslistrik.
3. a. Ion-ionyangadadalamlarutanadalahK
+
dan
Br

.
b. Produk yang dihasilkan di katode adalah
endapankaliumdandianodedihasilkangas
bromin.
c. Persamaanreaksiyangterjadi:
katode
:K
+
(aq)+e

K(s)
anode
:2Br

(aq)Br
2
(g)+2e

4. Larutanyangbersifatelektrolitkuatyaitularutan
AdanBkarenamenghasilkanbanyakgelembung
dan lampu menyala terang meskipun larutan A
menyalakanlampudenganredup.Larutanyang
bersifat elektrolit lemah yaitu larutan C dan E
karena menghasilkan sedikit gelembung dan
menyalakan lampu dengan redup atau tidak
menyalakanlampu.Larutannonelektrolitadalah
larutanDkarenatidakdapatmenyalakanlampu
dantidakdapatmenghasilkangelembunggas.
5. Asamkarbonatmerupakanasamlemah.Jikaasam
karbonatdiujidenganalatujielektrolitmakalampu
tidakakanmenyalaataudapatmenyalaredupdan
timbulsedikitgelembunggas.Halinikarenalarutan
asamkarbonatbersifatelektrolitlemah.
6. a. Zat B termasuk elektrolit lemah karena
menyalakan lampu dengan redup dan
menghasilkansedikitgelembunggas.
b. JumlahmolzatBmula-mula
=
40 gram
40 g/mol
=1mol
JumlahmolzatByangterionisasi=0,4mol
MolzatByangterionisasi =(10,4)mol
=0,6mol
Derajationisasi()
=
jumlah mol zat B yang terionisasi
jumlah mol zat B mula-mula
=
0,6 mol
1 mol
=0,6
Jadi,zatByangterionisasisebanyak0,6mol
danderajationisasinya0,6.
7. Senyawakovalenmurnitidakdapatmenghantar-
kanaruslistrikkarenamolekul-molekulnyatidak
mengandung ion-ion. Saat dilarutkan dalam air,
senyawakovalenpolarakanterionisasisehingga
terdapat ion-ion yang mampu menangkap dan
melepas elektron. Oleh karena itu, larutan
senyawakovalenpolardapatmenghantarkanarus
listrik.
22 Kunci Jawaban dan Pembahasan
8. a. Senyawakovalenpolarjikadilarutkandalam
airdapatmengalamiionisasisehinggaakan
terurai menjadi ion-ionnya. Sementara itu,
senyawa kovalen nonpolar jika dilarutkan
dalam air tidak dapat terionisasi dan tetap
dalambentukmolekulnya.
b. Senyawa kovalen polar dapat terionisasi
sehingga dapat menghantarkan arus listrik,
sedangkansenyawakovalennonpolartidak
dapatmenghantarkanaruslistrikkarenatidak
terionisasi.
9. Airhujan,airsungai,danairlautdapatmenyalakan
lampusaatdiujidenganalatujielektrolit.Halini
dapatterjadikarenaair-airtersebutmengandung
zat terlarut yang bersifat elektrolit. Zat terlarut
tersebut dapat terionisasi sehingga mampu
menghantarkanaruslistrik.
10. a. AkiTimbal
Akitimbalseringdigunakansebagaisumber
arus untuk automobil. Aki timbal meng-
gunakan larutan H
2
SO
4
encer sebagai
elektrolit.ElektrodeyangdigunakanberupaPb
sebagai anode dan PbO sebagai katode.
Reaksiyangterjadimenghasilkanlistrikdan
mengubahkeduaelektrodemenjadiPbSO
4
.
b. Fuel Cells
Fuel cells adalah sel bahan bakar yang
mempunyaikapasitaslistrikyangtahanlama,
mudah perawatannya, dan mempunyai
efisiensitinggi.Selinimenggunakanlarutan
KOHpekatsebagaielektrolit.Gashidrogen
digunakan sebagai anode dan gas oksigen
sebagai katode. Masing-masing gas
dimasukkan ke dalam elektrode karbon
berpori. Ion OH

yang dihasilkan di katode


akanbereaksidengangasH
2
dianode.
Bab II Reaksi Reduksi Oksidasi
(Redoks)
A. Pilihan Ganda
1. Jawaban: d
Reduksi merupakan reaksi pelepasan oksigen,
penerimaan elektron, mengalami penurunan
bilangan oksidasi, serta melibatkan pengikatan
hidrogen.Zatyangmengalamireduksidinamakan
oksidator. Oksidasi merupakan reaksi peng-
gabunganoksigen,pelepasanelektron,mengalami
kenaikan bilangan oksidasi, serta melibatkan
pelepasanhidrogen.Zatyangmengalamioksidasi
dinamakanreduktor.
2. Jawaban: b
Reaksi reduksi terjadi apabila suatu reaksi
mengalamipenurunanbilanganoksidasiseperti
padaOmenjadiO
2
.OmenjadiO
2
mengalami
penurunanbilanganoksidasidari0(nol)menjadi
2. Sementara itu, Al menjadi Al
3+
mengalami
kenaikanbilanganoksidasidari0(nol)menjadi+3.
F

menjadi F
2
mengalami kenaikan bilangan
oksidasidari1menjadi0(nol).Fe
2+
menjadiFe
3+
mengalami kenaikan bilangan oksidasi dari +2
menjadi+3.CamenjadiCa
2+
mengalamikenaikan
bilanganoksidasidari0(nol)menjadi+2.
3. Jawaban: c
Reaksi oksidasi mengalami kenaikan bilangan
oksidasi. Reaksi reduksi mengalami penurunan
bilanganoksidasi.
1) 3CuS+8HNO
3
3Cu(NO
3
)
2
+2NO+3S+4H
2
O
2+5+20
Oksidasi
Reduksi
2) CaCO
3
+2HClCaCl
2
+CO
2
+H
2
O
+2+4 1 +21 +4
Tidak mengalami perubahan bilangan
oksidasi.
3) 2FeCl
3
+H
2
S2FeCl
2
+2HCl+S
+3 2 +2 0
Reduksi
Oksidasi
4) Fe
2
O
3
+3H
2
SO
4
2Fe
2
(SO
4
)
3
+3H
2
O
+3 +6 +3+6
Tidak mengalami perubahan bilangan
oksidasi.
5) 2KClO
3
+3S2KCl+3SO
2
+5 0 1+4
Reduksi
Oksidasi
Jadi, reaksi yang tidak mengalami perubahan
bilanganoksidasiterdapatpadareaksinomor2)
dan4).
4. Jawaban: e
Reaksiyangmelibatkanpenggabunganoksigen
merupakanreaksioksidasi.Padapersamaanreaksi
tersebut, oksigen berada di sebelah kiri tanda
panah.Misalpadareaksiberikut.
23 Kimia Kelas X
C
6
H
12
O
6
+6O
2
6CO
2
+6H
2
O
Reaksi pada pilihan jawaban a, b, c, dan d
merupakanreaksireduksi(kehilanganoksigen).
5. Jawaban: d
MnO
2
merupakanzatyangmelepaskanoksigen
membentuk H
2
O. MnO
2
disebut oksidator.
Pelepasan oksigen oleh MnO
2
ini dinamakan
reduksi.Sementaraitu,HClmerupakanzatyang
mengalami penggabungan oksigen membentuk
H
2
O.HCldisebutreduktor.Penggabunganoksigen
olehHCldinamakanoksidasi.
6. Jawaban: d
Reaksireduksi: F
2
+2e

2F

Reaksioksidasi: 2I

I
2
+2e

_________________________________
Reaksiredoksi: F
2
+2I

I
2
+2F

SpesiyangmenerimaelektronyaituF
2
.
Spesi F
2
menerima 2 elektron membentuk F

.
Sementara itu, I

melepaskan 2 elektron mem-


bentukI
2
.
7. Jawaban: d
Fe
2
O
3
(s)+3CO(g)2Fe(s)+3CO
2
(g)
+3+20+4
Reduksi
Oksidasi
Fe
2
O
3
padareaksitersebutmengalamipenurunan
bilangan oksidasi (reduksi) dari +3 menjadi 0.
Sementaraitu,COpadareaksitersebutmengalami
kenaikan bilangan oksidasi (oksidasi) dari +2
menjadi+4.
8. Jawaban: b
UnsurAmudahmelepaselektronmembentukion
bermuatanpositif.Sementaraitu,unsurBmudah
menerima elektron membentuk ion bermuatan
negatif.Reaksiyangterjadisebagaiberikut.
A A
2+
+2e

B+2e

B
2
+
A+B A
2+
+B
2
9. Jawaban: d
Persamaanreaksiredoks:
Mg(s)+2Fe
3+
(aq)2Fe
2+
(aq)+Mg
2+
(aq)
0 +3 +2 2+
Oksi dasi
Reduksi
BilanganoksidasiunsurMgmenjadiMg
2+
berubah
dari0menjadi+2.Jadi,selisihbilanganoksidasinya
adalah +2 (mengalami kenaikan 2 bilangan
oksidasi).
10. Jawaban: b
a. 2Al+Fe
2
O
3
Al
2
O
3
+2Fe
+30
Reduksi
Fe
2
O
3
mengalamireduksi.
b. SnCl
2
+2HgCl
2
SnCl
4
+Hg
2
Cl
2
+2+4
Oksidasi
SnCl
2
mengalamioksidasi.
c. H
2
S+2FeCl
3
2FeCl
2
+S+2HCl
+3+2
Reduksi
FeCl
3
mengalamireduksi.
d. 2CuSO
4
+4KI 2K
2
SO
4
+I
2
+2CuI
+2+1

Reduksi
CuSO
4
mengalamireduksi.
e. MnO
2
+4HCI MnCl
2
+Cl
2
+2H
2
O
+4+2
Reduksi
MnO
2
mengalamireduksi.
Jadi,senyawadigarisbawahiyangmengalami
oksidasiadalahSnCl
2
.
B. Uraian
1. a. Pelepasandanpenggabunganoksigen.
Reaksi oksidasi adalah reaksi yang
melibatkan pengikatan atau penggabungan
oksigenpadasuatuzat.Reaksireduksiadalah
reaksipelepasanoksigendarisuatuzat.
b. Pelepasandanpenerimaanelektron.
Reaksioksidasimerupakanreaksipelepasan
elektron. Reaksi reduksi merupakan reaksi
penerimaanelektron.
c. Kenaikandanpenurunanbilanganoksidasi.
Reaksi oksidasi adalah reaksi yang
mengalami kenaikan bilangan oksidasi.
Reaksireduksiadalahreaksiyangmengalami
penurunanbilanganoksidasi.
d. Pelepasandanpengikatanhidrogen.
Reaksi oksidasi adalah reaksi yang
melepaskanhidrogen.Reaksireduksiadalah
reaksiyangmelibatkanpengikatanhidrogen.
24 Kunci Jawaban dan Pembahasan
2.
2NaIO
3
(aq)+5NaHSO
3
(aq)I
2
(aq)+3NaHSO
4
(aq)+2Na
2
SO
4
(aq)+H
2
O()
+5+40+6
Reduksi
Oksidasi
Jadi,zatyangmengalamireduksiadalahNaIO
3
.
ZatyangmengalamioksidasiadalahNaHSO
3
.
3. Persamaanreaksisebagaiberikut.
a. CH
4
(g)+2O
2
(g) CO
2
(g)+2H
2
O(g)
Mengalamipenggabunganoksigen
Mengalami penggabungan oksigen
Reaksi tersebut merupakan reaksi oksidasi
karenaCdanHmengalamipenggabungan
oksigen(bukanreaksiredoks).
b. H
2
S(g)+Cl
2
(g)2HCl(g)+S(s)
Mengikathidrogen
Melepaskan hidrogen
Reaksi tersebut merupakan reaksi redoks
karenaH
2
SmelepashidrogenmembentukS
(oksidasi)danCl
2
mengikathidrogenmenjadi
HCl(reduksi).
c. Zn(s)+CuO(s)ZnO(s)+Cu(s)
Melepas oksigen
Mengalami penggabungan oksigen
Reaksitersebutmerupakanreaksireduksi
oksidasi (redoks) karena Zn mengalami
penggabunganoksigen(oksidasi)danCuO
melepaskanoksigen(reduksi).
d. 2NH
3
(g)+3CuO(s)N
2
(g)+3Cu(s)+3H
2
O()
Melepashidrogen
Melepas oksigen
Reaksi tersebut merupakan reaksi redoks
karenaCuOmelepasoksigenmembentukCu
(reduksi), sedangkan NH
3
melepaskan
hidrogen(oksidasi).
4. 4Ag(s)+O
2
(g)+2H
2
S(g)2Ag
2
S(s)+2H
2
O()
00+12
Oksidasi
Reduksi
Reaksiterbentuknyanodapadaperhiasanperak
tersebut merupakan reaksi redoks karena pada
reaksitersebutAgmengalamikenaikanbilangan
oksidasi (oksidasi), sedangkan O
2
mengalami
penurunanbilanganoksidasi(reduksi).
5. a. 2H
2
(g)+O
2
(g) 2H
2
O()
Pada reaksi tersebut, O
2
mengikat H
2
membentuk H
2
O sehingga O
2
mengalami
reduksidanH
2
mengalamioksidasi.Reaksi
tersebutmelibatkanpengikatanhidrogen.
b. H
2
(g)+2Na(s)2NaH(s)
Pada reaksi tersebut, Na mengikat H
2
sehingga H
2
mengalami oksidasi dan Na
mengalami reduksi. Reaksi tersebut
melibatkanpengikatanhidrogen.
c. 2H
2
O
2
(aq)2H
2
O()+O
2
(g)
Pada reaksi tersebut, senyawa H
2
O
2
melepaskanhidrogenmembentukO
2
.Pada
reaksiini,OdalamH
2
O
2
mengalamioksidasi
menjadiO
2
danreduksimenjadiH
2
O.
d. Zn(s)+2HCl(aq)ZnCl
2
(aq)+H
2
(g)
Pada reaksi tersebut, senyawa HCl
melepaskanhidrogenmembentukZnCl
2
.Pada
reaksi tersebut, Zn mengalami oksidasi
menjadi ZnCl
2
, sedangkan H pada HCl
mengalamireduksimenjadiH
2
.
A. Pilihan Ganda
1. Jawaban: c
BilanganoksidasiHpadaH
2
=0.Bilanganoksidasi
H pada H
2
O, H
2
O
2
, dan HNO
3
= +1. Bilangan
oksidasiHpadaNaH=1.
2. Jawaban: a
MnO
2
+2H
2
SO
4
+2NaIMnSO
4
+Na
2
SO
4
+2H
2
O+I
2
+41+20
Reduksi
Oksidasi
Reduktormerupakanzatyangmengalamireaksi
oksidasi.Jadi,zatyangberperansebagaireduktor
adalah NaI. Sementara itu, MnO
2
merupakan
oksidator(zatyangmengalamireaksireduksi).
3. Jawaban: d
BilanganoksidasiFe(CN)
6
3
=3
(1BOFe)+(6BOCN) =3
(1BOFe)+(6(1)) =3
BOFe =+3
Jadi,bilanganoksidasiunsurFedalamFe(CN)
6
3
adalah+3.
25 Kimia Kelas X
4. Jawaban: b
1) Mg+2HNO
3
Mg(NO
3
)
2
+H
2
0+2
Oksidasi
Mg mengalami reaksi oksidasi (bertindak
sebagaireduktor).
2) 2KClO
3
+3S 2KCl+3SO
2
+51
Reduksi
Cl pada KClO
3
mengalami reaksi reduksi
(bertindaksebagaioksidator).
3) 2KMnO
4
+5H
2
C
2
O
4
+3H
2
SO
4
K
2
SO
4
+2MnSO
4
+3+10CO
2
+8H
2
O
+4
Oksidasi
C pada H
2
C
2
O
4
mengalami reaksi oksidasi
(bertindaksebagaireduktor).
Jadi,unsur-unsuryangdigarisbawahipadareaksi
tersebut secara berturut-turut bertindak sebagai
reduktor,oksidator,danreduktor.
5. Jawaban: c
1) SO
2
danSO
3
BilanganoksidasiSO
2
=0
(1BOS)+(2BOO) =0
BOS+(2(2)) =0
BOS =+4
BilanganoksidasiSO
3
=0
(1BOS)+(3BOO) =0
BOS+(3(2)) =0
BOS =+6
2) H
2
SO
3
danH
2
SO
4
BilanganoksidasiH
2
SO
3
=0
(2BOH)+(1BOS)+(3BOO) =0
(21)+BOS+(3(2)) =0
2+BOS+(6) =0
BOS =+4
BilanganoksidasiH
2
SO
4
=0
(2BOH)+(1BOS)+(4BOO) =0
(21)+BOS+(4(2)) =0
2+BOS+(8) =0
BOS =+6
3) Na
2
SO
4
danNa
2
S
BilanganoksidasiNa
2
SO
4
=0
(2BONa)+(1BOS)+(4BOO) =0
(21)+BOS+(4(2)) =0
2+BOS+(8) =0
BOS =+6
BilanganoksidasiNa
2
S=0
(2BONa)+(1BOS) =0
(21)+BOS =0
2+BOS =0
BOS =2
4) H
2
SdanH
2
SO
4
BilanganoksidasiH
2
S=0
(2BOH)+(1BOS) =0
(21)+BOS =0
BOS =2
BilanganoksidasiH
2
SO
4
=0
(2BOH)+(1BOS)+(4BOO) =0
(21)+BOS+(4(2)) =0
2+BOS+(8) =0
BOS =+6
5) Na
2
SO
3
danSO
2
BilanganoksidasiNa
2
SO
3
=0
(2BONa)+(1BOS)+(3BOO) =0
(21)+BOS+(3(2)) =0
2+BOS+(6) =0
BOS =+4
BilanganoksidasiSO
2
=0
(1BOS)+(2BOO) =0
BOS+(2(2)) =0
BOS =+4
Jadi,pasanganyangmengandungunsurSdengan
bilanganoksidasiyangsamaadalahNa
2
SO
3
dan
SO
2
.
6. Jawaban: e
a. H
+
+OH

H
2
O
22
Tidak mengalami oksidasi atau reduksi
b. 2SO
2
+O
2
2SO
3
02
Reduksi
c. 2KClO
3
+3S 2KCl+3SO
2
22
Tidakmengalamioksidasiataureduksi
d. H
2
O
2
+2KI+2HCl 2KCl+I
2
+2H
2
O
12
Reduksi
e. 5H
2
O
2
+2KMnO
4
+3H
2
SO
4
K
2
SO
4
+2MnSO
4
1+8H
2
O+5O
2
0
Oksidasi
Jadi, oksigen bertindak sebagai reduktor
(mengalamireaksioksidasi).
26 Kunci Jawaban dan Pembahasan
7. Jawaban: c
2KMnO
4
+3H
2
SO
4
+5H
2
C
2
O
4
K
2
SO
4
+2MnSO
4
+8H
2
O+10CO
2
+7+3+2+4
Reduksi
Oksidasi
Jadi, zat hasil reduksi dan oksidasi dari reaksi
tersebutadalahMnSO
4
danCO
2
.
8. Jawaban: a
Oksidatormerupakanzatyangmengalamireaksi
reduksi(penurunanbilanganoksidasi).Cuyang
mempunyaibilanganoksidasi0(nol)tidakmungkin
mengalamipenurunanbilanganoksidasi.Cl
2
yang
mempunyai bilangan oksidasi 0 (nol) dapat
mengalamipenurunanbilanganoksidasimenjadi
1(Cl

).Na
+
yangmempunyaibilanganoksidasi
+1dapatmengalamipenurunanbilanganoksidasi
menjadi0(nol).Mg
2+
yangmempunyaibilangan
oksidasi+2dapatmengalamipenurunanbilangan
oksidasimenjadi0(nol).
9. Jawaban: a
Zatyangmengalamireduksi(mengalamipenurunan
bilanganoksidasi)dinamakanoksidator.
a. N
2
NH
3
03
Reduksi
N
2
=oksidator
b. NO NO
2
+2+4
Oksidasi
NO=reduktor
c. NO
2
NO
3
+4+6
Oksidasi
NO
2
=reduktor
d. NH
3
NO
3+2
Oksidasi
NH
3
=reduktor
e. NH
3
NO
3
3+6
Oksidasi
NH
3
=reduktor
Jadi,zatbergarisbawahyangmengalamireaksi
reduksiadalahN
2
saatberubahmenjadiNH
3
.
10. Jawaban: e
Bilanganoksidasiunsur-unsuryangbergarisbawah
padasenyawa-senyawatersebutsebagaiberikut.
a. H
2
S=0
(2BOH)+(1BOS) =0
(2(+1))+(BOS) =0
BOS =2
SO
2
=0
(1BOS)+(2BOO) =0
(BOS)+(2(2) =0
BOS =+4
b. NH
3
=0
(1BON)+(3BOH) =0
(BON)+3(+1) =0
BON =3
NO
2
=0
(1BON)+(2BOO) =0
(BON)+(2(2)) =0
BON =+4
c. CuCl
2
=0
(1BOCu)+(2BOCl) =0
(+2)+(2BOCl) =0
BOCl =1
NaClO=0
(1BONa)+(1BOCl)+(1BOO) =0
(+1)+(BOCl)+(2) =0
BOCl =+1
d. MnO
2
=0
(1BOMn)+(2BOO) =0
(BOMn)+2(2) =0
BOMn =+4
K
2
Mn
2
O
7
=0
(2BOK)+(2BOMn)+(7BOO) =0
(2(+1))+(2BOMn)+(7(2)) =0
(+2)+(2BOMn)+(14) =0
BOMn =+6
e. K
2
CrO
4
=0
(2BOK)+(1BOCr)+(4BOO) =0
(2(+1))+(1BOCr)+(4(2)) =0
BOCr =+6
K
2
Cr
2
O
7
=0
(2BOK)+(2BOCr)+(7BOO) =0
(2(+1))+(2BOCr)+(7(2)) =0
(+2)+(2BOCr)+(14) =0
BOCr =+6
Jadi, pasangan senyawa yang masing-masing
mempunyai unsur dengan bilangan oksidasi +6
adalahK
2
CrO
4
denganK
2
Cr
2
O
7
.
11. Jawaban: e
Perubahanbilanganoksidasipadareaksi-reaksi
tersebutsebagaiberikut.
a. Zn+2HClZnCl
2
+H
2
0 +11+220
Oksidasi
Reduksi
b. 2K+2H
2
O2KOH+H
2
0+1+10
Oksidasi
Reduksi
27 Kimia Kelas X
c. I
2
+2Na
2
S
2
O
3
2NaI+Na
2
S
4
O
6
0+2+461+2+1012
Reduksi
Oksidasi
d. Zn+2AgNO
3
Zn(NO
3
)
2
+2Ag
0+1+56+2+10120
Oksidasi
Reduksi
e. Cl
2
+2NaOHNaCl+NaClO+H
2
O
0+12+1+11+1+12+22
Reduksi
Oksi dasi
Reaksiautoredoksadalahreaksiyangsalahsatu
reaktannyamengalamireaksioksidasidanjuga
reaksi reduksi. Jadi, reaksi autoredoks terdapat
padareaksie.
12. Jawaban: c
Reaksikoproporsionasimerupakanreaksiredoks
denganhasilreduksidanhasiloksidasimerupakan
unsuryangsama.
a. 2N
2
+3O
2
2N
2
O
3
00+32
Reduksi
Oksidasi
Reaksi ini bukan reaksi koproporsionasi
karenaunsuryangmenjadihasilreduksidan
hasiloksidasinyaberbeda.
b. Zn+2HClZnCl
2
+H
2
0+1+20
Oksidasi
Reduksi
Reaksiinibukanreaksikoproporsionasi.
c. 2H
2
S+SO
2
2H
2
O+3S
2+40
Reduksi
Oksidasi
Reaksiinitermasukreaksikoproporsionasi.
Unsur S bertindak sebagai hasil reduksi
sekaligussebagaihasiloksidasi.
d. 6ClO
2
+3H
2
O5HClO
3
+HCl
+4+51
Oksidasi
Reduksi
Reaksi ini bukan reaksi koproporsionasi
melainkanreaksidisproporsionasi.UnsurCl
bertindak sebagai oksidator sekaligus
reduktor.
e. Fe+2AgNO
3
2Ag+Fe(NO
3
)
2
0+10+2
Reduksi
Oksidasi
Reaksiinibukanreaksikoproporsionasi.
13. Jawaban: b
SnO
2
(s)+2C(s)Sn()+2CO(g)
BilanganoksidasiSndalamSnO
2
sebagaiberikut.
BilanganoksidasiSnO
2
=0
(1BOSn)+(2BOO) =0
(1BOSn)+(2(2)) =0
BOSn+(4) =0
BOSn =+4
BilanganoksidasiunsurSn=0
BilanganoksidasiunsurC=0
BilanganoksidasiCdalamCOsebagaiberikut.
BilanganoksidasiCO=0
(1BOC)+(1BOO) =0
BOC+(1(2)) =0
BOC+(2) =0
BOC =+2
Jadi,bilanganoksidasiSnberubahdari+4menjadi
0,sedangkanbilanganoksidasiCberubahdari0
menjadi+2.
14. Jawaban: d
a. IO
3

+51
Menerima 6 elektron
b. ClO
3

Cl

+51
Menerima 6 elektron
c. H
2
O
2
OH

12
Menerima1elektron
d. MnO
4

Mn
2+
+7+2
Menerima 5 elektron
e. Cr
2
O
7
2
Cr
3+
+6+3
Menerima3elektron
Jadi,oksidatoryangdapatmenerimalimaelektron
adalahMnO
4

menjadiMn
2+
.
15. Jawaban: d
2KMnO
4
+10FeSO
4
+8H
2
SO
4
K
2
SO
4
+2MnSO
4
+5Fe
2
(SO
4
)
3
+8H
2
O
+7+2+2+3
Reduksi
Oksidasi
28 Kunci Jawaban dan Pembahasan
KMnO
4
mengalami reaksi reduksi (sebagai
oksidator) dengan hasil reduksi berupa MnSO
4
.
FeSO
4
mengalami reaksi oksidasi (sebagai
reduktor)denganhasiloksidasiberupaFe
2
(SO
4
)
3
.
S tidak mengalami penurunan atau kenaikan
bilanganoksidasi.BilanganoksidasiStetap+6.
B. Uraian
1. a. SdalamSO
2
BilanganoksidasiSO
2
=0
(1BOS)+(2BOO) =0
(1BOS)+(2(2)) =0
BOS =+4
b. ZndalamZnO
2

BilanganoksidasiZnO
2

=1
(1BOZn)+(2BOO) =1
BOZn+(2(2)) =1
BOZn =+3
c. NdalamNH
4
+
BilanganoksidasiNH
4
+
=+1
(1BON)+(4BOH) =+1
BON+(41) =+1
BON =3
d. IdalamNaIO
3
BilanganoksidasiNaIO
3
=0
(1BONa)+(1BOI)+(3BOO) =0
(11)+BOI+(3(2)) =0
BOI =+5
e. PdalamNa
3
PO
4
BilanganoksidasiNa
3
PO
4
=0
(3BONa)+(1BOP)+(4BOO) =0
(31)+BOP+(4(2)) =0
BOP =+5
f. FedalamFe(CN)
6
4
BilanganoksidasiFe(CN)
6
4
=4
(1BOFe)+(6BOCN) =4
BOFe+(6(1)) =4
BOFe =+2
2. a. Fe
2
O
3
(s)+3CO(g)2Fe(s)+3CO
2
(g)
+3 +20+4
Reduksi
Oksidasi
Oksidator(zatyangmengalamireduksi)pada
reaksitersebutadalahFe
2
O
3
.Hasilreduksi
berupaFe.
b. 2MnO
4

(aq)+5H
2
S(aq)+6H
+
(aq)2Mn
2+
(aq)+5S(s)+8H
2
O()
+7 2+20
Reduksi
Oksidasi
Oksidator(zatyangmengalamireduksi)pada
reaksi tersebut adalah MnO
4

. Hasil reduksi
berupaMn
2+
.
c. Cu
2
O(s)+2H
+
(aq)Cu(s)+Cu
2+
(aq)+H
2
O()
+1 0+2
Reduksi
Oksidasi
Oksidator(zatyangmengalamireduksi)pada
reaksi tersebut adalah Cu
2
O. Hasil reduksi
berupa Cu. Oleh karena reaksi tersebut
merupakanreaksiautoredoksmakazatyang
bertindaksebagaireduktorjugaCu
2
O.
3. Perubahanbilanganoksidasipadareaksi-reaksi
tersebutsebagaiberikut.
a. 3I
2
+6KOH5KI+KIO
3
+3H
2
O
0+12+1 +11+1+56+12
Reduksi
Oksidasi
b. Ag(NH
3
)
2
+
+2H
+
Ag
+
+2NH
4
+
+16+6+1+13+4
(Tidakterjadiperubahanbilanganoksidasi)
c. CaCO
3
CaO+CO
2
+2+46+22+44
(Tidakterjadiperubahanbilanganoksidasi)
d. 2HgO2Hg+O
2
+2202
Reduksi
e. 2HCuCl
2
Cu+Cu
2+
+4Cl

+2H
+
+1+12
H
2
O
0+21+1
Reduksi
Oksidasi
Jadi, autoredoks terjadi jika satu unsur dalam
senyawamengalamireaksioksidasidanreduksi.
Haliniterjadipadareaksiadane.
No.
a.
b.
c.
d.
e.
f.
Unsur
SdalamSO
2
Zn dalam ZnO
2

NdalamNH
4
+
IdalamNaIO
3
PdalamNa
3
PO
4
Fe dalam Fe(CN)
6
4
Bilangan Oksidasi
+4
+3
3
+5
+5
+2
29 Kimia Kelas X
4. 1) Fe(s)+SO
2
(g)+O
2
(g)FeSO
4
(s)
0+44 0+2+68
Oksidasi
Oksidasi
Reduksi
UnsuryangmengalamioksidasiadalahFedan
SdalamSO
2
.Unsuryangmengalamireduksi
adalahO
2
.
2) 4FeSO
4
(s)+O
2
(g)+6H
2
O()2Fe
2
O
3
H
2
O(s) +4H
2
SO
4
(aq)
+2+680+22+66+22
UnsuryangmengalamioksidasiadalahFedalam
FeSO
4
.UnsuryangmengalamireduksiadalahO
2
.
5. Magnesiumpadareaksitersebutdikatakansebagai
zatpereduksi.Zatpereduksimerupakannamalain
darireduktor(zatyangmengalamireaksioksidasi).
CuO+MgCu+MgO
+200+2
Reduksi
Oksidasi
A. Pilihan Ganda
1. Jawaban: c
Fe
2
O
3
terbentuk dari ion Fe
3+
dengan ion O
2
.
Bilangan oksidasi Fe adalah +3 sehingga jika
bergabung dengan ion oksida senyawanya
bernamabesi(III)oksida.
2. Jawaban: b
Natriumnitratterbentukdariionnatriumdanion
nitrat.Ionnatriummerupakankationdenganrumus
Na
+
. Sementara itu, ion nitrat merupakan anion
denganrumusNO
3

.JikaionNa
+
bergabungdengan
ionNO
3

akanmembentuksenyawadenganrumus
NaNO
3
.
3. Jawaban: c
PCl
3
=fosfortriklorida
Ba
3
(PO
4
)
2
=bariumfosfat
CH
3
COONa=natriumasetat
MgSO
4
=magnesiumsulfat
Ca(OH)
2
=kalsiumhidroksida
4. Jawaban: e
NaCl :natriumklorida
NaClO :natriumhipoklorit
NaClO
2
:natriumklorit
NaClO
3
:natriumklorat
NaClO
4
:natriumperklorat
Oksidasi
Reduksi
5. Jawaban: d
Amonium nitrat mempunyai rumus kimia
NH
4
NO
3
.NH
4
NO
3
terbentukdariionNH
4
+
danNO
3

.
BilanganoksidasiNH
4
+
=+1
(1BON)+(4BOH) =+1
BON+(41) =+1
BON =3
BilanganoksidasiNO
3

=1
(1BON)+(3BOO)=1
BON+(3(2)) =1
BON =+5
Jadi,bilanganoksidasiNdalamsenyawaamonium
nitratadalah3dan+5.
6. Jawaban: b
6CO
2
(g)+6H
2
O(g)C
6
H
12
O
6
(s)+6O
2
(g)
+4200
Reduksi
Oksidasi
Padareaksitersebutterjadipelepasanoksigen.C
merupakan oksidator (mengalami reduksi),
sedangkan O merupakan reduktor (mengalami
oksidasi). Bilangan oksidasi C berubah dari +4
menjadi0.BilanganoksidasiOberubahdari2
menjadi0.
7. Jawaban: b
8. Jawaban: e
CuSO
4
terbentukdariiontembaga(II)danionsulfat
sehingganamasenyawaadalahtembaga(II)sulfat.
Cu
2
SO
4
terbentukdariiontembaga(I)danionsulfat
sehingga nama senyawanya adalah tembaga(I)
sulfat.
9. Jawaban: d
(CH
2
O)
n
menangkapoksigenmembentukCO
2
dan
H
2
O.Padareaksiiniterjadipenggabunganoksigen
pada(CH
2
O)
n
menjadinCO
2
dannH
2
O.
10. Jawaban: d
Cr
2
O
3
(s)+2Al(s)Al
2
O
3
(s)+2Cr(s)
+30+30
Reduksi
Oksidasi
Jadi,perubahanbilanganoksidasiCrterjadidari
+3menjadi0.
Rumus Kimia
a. MgO
b. Mg
3
N
2
c. Mg(CN)
2
d. Mg(NO
2
)
2
e. Mg(NO
3
)
2
Nama Kimia
Magnesium oksida
Magnesium nitrida
Magnesium sianida
Magnesium nitrit
Magnesium nitrat
30 Kunci Jawaban dan Pembahasan
B. Uraian
1. a. Kaliumpermanganat=KMnO
4
.
Bilangan oksidasi K = +1 karena KMnO
4
terbentukdariionK
+
danionMnO
4

.
b. Mangan(II)klorida=MnCl
2
.
Bilangan oksidasi Mn = +2 karena MnCl
2
terbentukdariionMn
2+
danionCl

.
c. Kobalt(III)nitrat=Co(NO
3
)
3
.
BilanganoksidasiCo=+3karenaCo(NO
3
)
3
terbentukdariionCo
3+
danionNO
3

.
d. Magnesiumhipoklorit=Mg(ClO)
2
.
BilanganoksidasiMg=+2karenaMg(ClO)
2
terbentukdariionMg
2+
danionClO

.
e. Besi(II)asetat=Fe(CH
3
COO)
2
Bilangan oksidasi Fe = +2 karena
Fe(CH
3
COO)
2
terbentukdariionFe
2+
danion
CH
3
COO

.
2. a. Fe
2+
+SO
4
2
FeSO
4
FeSO
4
=besi(II)sulfat
b. Al
3+
+NO
2

Al(NO
2
)
3
Al(NO
2
)
3
=aluminiumnitrit
c. Cr
3+
+Cl

CrCl
3
CrCl
3
=krom(III)klorida
d. Ag
+
+PO
4
3
Ag
3
PO
4
Ag
3
PO
4
=perakfosfat
e. Mg
2+
+S
2
MgS
MgS=magnesiumsulfida
3. Pasangannamakimiadanrumuskimiayangtepat
berdasarkan tabel tersebut adalah a dan 4,
bdan2,cdan1,ddan5,sertaedan3.
4. Denganmenggunakanlumpuraktif,BODdalam
airdapatdikurangihingga90%.Penurunantingkat
BOD dilakukan dengan mempercepat aktivitas
mikroorganisme yang menguraikan sampah
organik. Aktivitas mikroorganisme dipercepat
denganlumpuraktif.Penguraiansampahorganik
inimenerapkanreaksioksidasi.
(CH
2
O)
n
+nO
2
nCO
2
+nH
2
O+panas
Padaprosesiniterjadipenggabunganoksigenoleh
sampahorganik(CH
2
O)
n
menjadinCO
2
dannH
2
O.
5. 2PbO+C2Pb+CO
2
+200+4
Reduksi
Oksidasi
a. ReaktanyangmengalamireduksiadalahPbO.
b. ReaktanyangmengalamioksidasiadalahC.
c. NamakimiaPbO=timbal(II)oksida.
A. Pilihan Ganda
1. Jawaban: a
Pereaksiyangmengalamipenggabunganoksigen
merupakan pereaksi yang mengalami oksidasi
(reduktor).Reduktormerupakanpereduksiatauzat
yangteroksidasi.
2. Jawaban: a
Perkembangan konsep reaksi reduksi oksidasi
yaitukonseppelepasandanpenggabunganoksigen,
konseppelepasandanpenerimaanelektron,konsep
kenaikandanpenurunanbilanganoksidasi,serta
pelepasan dan pengikatan hidrogen. Dengan
demikian,urutanperkembanganpengertianreduksi
yangbenaradalahpelepasanoksigen,penerimaan
elektron, penurunan bilangan oksidasi, dan
pengikatanhidrogen.
3. Jawaban: e
K
2
CrO
4
2K
+
+CrO
4
2
BilanganoksidasiCrO
4
2
=2.
(1BOCr)+(4BOO) =2
BOCr+(4(2)) =2
BOCr8 =2
BOCr =+6
4. Jawaban: d
Reaksi reduksi merupakan reaksi yang
melepaskanoksigen.
1) 2H
2
(g)+O
2
(g) 2H
2
O()
Reaksi ini termasuk reaksi oksidasi karena
mengalamipenggabunganoksigen.
2) 2Fe
2
O
3
(aq)+3C(s) 4Fe(s)+3CO
2
(g)
Reaksiinitermasukreaksiredoks.
Fe
2
O
3
melepas oksigen membentuk Fe
(reaksi reduksi). Atom C mengalami
penggabungan oksigen membentuk CO
2
(reaksioksidasi).
3) CS
2
(aq)+3O
2
(g) CO
2
(g)+2SO
2
(g)
Reaksi ini termasuk reaksi oksidasi karena
CS
2
mengalamipenggabunganoksigen.
4) 2KClO
3
(aq) 2KCl(aq)+3O
2
(g)
Reaksi ini termasuk reaksi reduksi karena
KClO
3
melepasoksigenmenjadiKCl.
5) CH
4
(aq)+2O
2
(g) CO
2
(g)+2H
2
O()
Reaksi ini termasuk reaksi oksidasi karena
CH
4
mengalamipenggabunganO
2
.
31 Kimia Kelas X
5. Jawaban: c
1) Natriumbromit=NaBrO
2
.
BilanganoksidasiNaBrO
2
=0
(1BONa)+(1BOBr)+(2BOO) =0
(11)+BOBr+(2(2)) =0
1+BOBr4 =0
BOBr =+3
2) Natriumbromat=NaBrO
3
.
BilanganoksidasiNaBrO
3
=0
(1BONa)+(1BOBr)+(3BOO) =0
(11)+BOBr+(3(2)) =0
1+BOBr6 =0
BOBr =+5
3) Natriumbromida=NaBr.
BilanganoksidasiNaBr=0
(1BONa)+(1BOBr) =0
(11)+BOBr =0
BOBr =1
4) Natriumperbromat=NaBrO
4
.
BilanganoksidasiNaBrO
4
=0
(1BONa)+(1BOBr)+(4BOO) =0
(11)+BOBr+(4(2)) =0
1+BOBr8 =0
BOBr =+7
5) Natriumhipobromit=NaBrO.
BilanganoksidasiNaBrO=0
(1BONa)+(1BOBr)+(1BOO) =0
(11)+BOBr+(1(2)) =0
1+BOBr2 =0
BOBr =+1
Jadi, bilangan oksida Br terendah adalah +2
terdapatdalamsenyawaNaBr.
6. Jawaban: a
1) Cu(s)+Br
2
(g)CuBr
2
(s)
00+21
Oksidasi
Reduksi
Reaksiinitermasukreaksiredoks
2) Cu(s)+2AgNO
3
(aq)Cu(NO
3
)
2
(aq)+2Ag(s)
0+1+2 0
Oksidasi
Reduksi
Reaksiinitermasukreaksiredoks
3) Cu(OH)
2
(aq)+2HCl(aq)CuCl
2
(aq)+2H
2
O()
+21+21
Tetap
Tetap
Reaksi ini bukan termasuk reaksi redoks
melainkanreaksinetralisasi.
4) Cu(NO
3
)
2
(aq)+K
2
CO
3
(aq)CuCO
3
(s)+2KNO
3
(aq)
+2+1+2+1
Tetap
Tetap
Reaksi ini bukan termasuk reaksi redoks
melainkanreaksidekomposisi.
7. Jawaban: d
Reaksiyangmempunyaireduktordanoksidator
berupa unsur yang sama disebut reaksi
autoredoks(reaksidisproporsionasi).
1) 2SO
2
+O
2
2SO
3
+40+62
Oksidasi
Reduksi
Reaksi ini bukan reaksi autoredoks karena
unsuryangmenjadireduktordanoksidatornya
berbeda.
2) SO
2
+H
2
SS+H
2
O
+420
Oksidasi
Reduksi
Reaksiinibukanreaksiautoredoksmelainkan
reaksikoproporsionasikarenareduktordan
oksidator berbeda, tetapi hasil reduksi dan
hasiloksidasinyasama.
3) FeCl
3
+H
2
SFeCl
2
+HCl+S
+32+20
Reduksi
Oksidasi
Reaksi ini bukan reaksi autoredoks karena
unsuryangmenjadireduktordanoksidatornya
berbeda.
4) Br
2
+NaOHNaBr+NaBrO
3
+H
2
O
01+5
Reduksi
Oksidasi
Reaksi ini merupakan reaksi autoredoks
karena unsur yang menjadi reduktor dan
oksidatornyasama.
5) CaCl
2
+Mg(OH)
2
Ca(OH)
2
+MgCl
2
+21+22+1+22+1+21
Reaksiinibukanreaksiautoredoksmaupun
reaksiredokskarenatidakterjadiperubahan
bilanganoksidasi.
32 Kunci Jawaban dan Pembahasan
8. Jawaban: b
1) N
2
NO
0+2
Oksidasi
2) N
2
NH
3
03
Reduksi
3) NH
3
NO
3+2
Oksidasi
4) NH
3
NO
3
3+6
Oksidasi
5) NO
2
NO
3
+4+6
Oksidasi
9. Jawaban: b
Oksidatormerupakanzatyangmengalamireaksi
reduksi(mengalamipenurunanbilanganoksidasi).
2HBr+H
2
SO
4
Br
2
+SO
2
+2H
2
O
1+60+4
Oksidasi
Reduksi
Jadi,zatyangmerupakanoksidatoradalahH
2
SO
4
.
Sementara itu, HBr merupakan reduktor
(mengalamioksidasi).
10. Jawaban: b
Al+3Ag
+
Al
3+
+3Ag
0+1+30
Oksidasi
Reduksi
Jadi,atomaluminiummengalamireaksioksidasi
(teroksidasi)ataumerupakanpereduksi(reduktor).
Sementaraitu,ionperakmengalamireaksireduksi
(tereduksi) atau merupakan pengoksidasi
(oksidator).
11. Jawaban: e
1) BilanganoksidasiK
2
Cr
2
O
7
=0
(2BOK)+(2BOCr)+(7BOO) =0
(21)+(2BOCr)+(7(2)) =0
2+2BOCr14 =0
2BOCr =+12
BOCr =+6
2) BilanganoksidasiMnO=0
(1BOMn)+(1BOO) =0
BOMn+(1(2)) =0
BOMn =+2
3) BilanganoksidasiMnO
2
=0
(1BOMn)+(2BOO) =0
BOMn+(2(2)) =0
BOMn4 =0
BOMn =+4
4) MnSO
4
terbentukdariionMn
2+
danSO
4
2
.
BilanganoksidasiMn
2+
=+2
BilanganoksidasiKMnO
4
=0
(1BOK)+(1BOMn)+(4BOO) =0
(11)+BOMn+(4(2)) =0
1+BOMn8 =0
BOMn =+7
5) BilanganoksidasiK
2
MnO
4
=0
(2BOK)+(1BOMn)+(4BOO) =0
(21)+BOMn+(4(2)) =0
2+BOMn8 =0
BOMn =+6
Jadi,unsurMnyangmempunyaibilanganoksidasi
samadenganbilanganoksidasiCrdalamK
2
Cr
2
O
7
adalahunsurMndalamK
2
MnO
4
.
12. Jawaban: d
CaH
2
(s)+2H
2
O()Ca(OH)
2
(aq)+2H
2
(g)
+21+12+22+10
Oksidasi
Reduksi
Jadi,kalsiumdanoksigentidakmengalamireduksi
maupun oksidasi. Sementara itu, hidrogen
mengalami reduksi dari bilangan oksidasi +1
menjadi0danmengalamioksidasidaribilangan
oksidasi1menjadi+1.
13. Jawaban: a
Bilangan oksidasi pada reaksi-reaksi tersebut
sebagaiberikut.
1) NH
3
NH
4
+
(tidakadaperubahan
3+3 3+4 bilanganoksidasi)
2) CO
3
2
CO (terjadipenurunan
+46 +22 bilanganoksidasipadaC)
3) SO
2
SO
3
(terjadikenaikan
+44 +66 bilanganoksidasipadaS)
4) N
2
O
4
NO
2

(terjadipenurunan
+88 +34 bilanganoksidasipadaN)
5) S
2
O
3
2
S
2
O
4
2
(terjadikenaikan
+46 +68 bilanganoksidasipadaS)
Jadi,yangtidakmengalamiperubahanbilangan
oksidasiadalahreaksiNH
3
NH
4
+
.
14. Jawaban: e
Oksidator merupakan zat yang mengakibatkan
terjadinyareaksireduksiataupenurunanbilangan
oksidasi.
33 Kimia Kelas X
KClO
3
(s) + S(s) + H
+
(aq) KCl(s) + SO
2
(g) + H
2
O()
+501+4
Reduksi
Oksidasi
Oksidator =KClO
3
Reduktor =S
Hasilreduksi =KCl
Hasiloksidasi =SO
2
15. Jawaban: d
Oksidatormerupakanzatyangmengalamireduksi.
Reduksi selalu disertai oksidasi sehingga untuk
menentukan zat yang mengalami reduksi dapat
dicarizatyangmengalamioksidasiterlebihdahulu.
1) OCl

+H
2
O
2
Cl

+H
2
O+O
2
+11
Reduksi
H
2
O
2
mengalamireaksioksidasi(reduktor).
2) Ag
2
O+H
2
O
2
H
2
O+2Ag+O
2
+10
Reduksi
H
2
O
2
mengalamireaksioksidasi(reduktor).
3) 2Ce
4+
+H
2
O
2
2Ce
3+
+O
2
+2H
+
+4+3
Reduksi
H
2
O
2
mengalamireaksioksidasi(reduktor).
4) Mn
2+
+H
2
O
2
+2OH

MnO
2
+2H
2
O
+2+4
Oksidasi
H
2
O
2
mengalamireaksireduksi(oksidator).
5) Cr
2
O
7
2
+3H
2
O
2
+8H
+
2Cr
3+
+3O
2
+7H
2
O
+6+3
Reduksi
H
2
O
2
mengalamireaksioksidasi(reduktor).
Jadi,senyawaH
2
O
2
berfungsisebagaioksidator
padareaksiMn
2+
+H
2
O
2
+2OH

MnO
2
+2H
2
O.
16. Jawaban: c
Mg+2H
+
Mg
2+
+H
2
0+1+20
Oksidasi
Reduksi
Jadi, reaksi yang terjadi pada perubahan atom
magnesiummenjadiionmagnesiumadalahberupa
reaksioksidasikarenaterjadipelepasan2elektron.
17. Jawaban: b
MnO
2
+2NaCl +2H
2
SO
4
MnSO
4
+Na
2
SO
4
+2H
2
O+Cl
2
+41+2 0
Reduksi
Oksidasi
Oksidator =MnO
2
Reduktor =NaCl
Hasiloksidasi =Cl
2
Hasilreduksi =MnSO
4
18. Jawaban: d
1) AgCl(s)+2NH
3
(aq)Ag(NH
3
)
2
Cl(aq)
+11+11
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
2) AgNO
3
(aq)+NaCl(aq)AgCl(s)+NaNO
3
(aq)
+1+52+11+11+1+52
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
3) OH

(aq)+Al(OH)
3
(s)AlO
2

(aq)+2H
2
O()
2+1+32+1+32+12
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
4) Hg(NO
3
)
2
(aq)+Sn(s) Hg(s)+Sn(NO
3
)
2
(aq)
+200+2
Reduksi
Oksidasi
Terjadi perubahan bilangan oksidasi atau
mengalamireaksireduksioksidasi(redoks).
5) NaOH(aq)+CH
3
COOH(aq)CH
3
COONa(aq) +H
2
O()
+12+1 +1+12
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
19. Jawaban: b
4KI+2CuSO
4
2CuI+I
2
+2K
2
SO
4
1+2+10
Oksidasi
Reduksi
Jadi,zatyangmerupakanhasiloksidasidanhasil
reduksisecaraberturut-turutadalahI
2
danCuI.
34 Kunci Jawaban dan Pembahasan
20. Jawaban: d
1) H
2
SSO
2
2+4
Oksidasi(bilanganoksidasinaik)
2) SO
3
SO
4
2
+6+6
Tetap(bilanganoksidasitetap)
3) NO
2
NO

3
+4+5
Oksidasi(bilanganoksidasinaik)
4) CrO
4
2
Cr
3+
+6+3
Reduksi(bilanganoksidasiturun)
5) Fe(OH)
2
Fe
2
O
3
+2+3
Oksidasi(bilanganoksidasinaik)
21. Jawaban: b
K
2
Cr
2
O
7
+7H
2
SO
4
+6FeSO
4
K
2
SO
4
+Cr
2
(SO
4
)
3
+3Fe
2
(SO
4
)
3
+7H
2
O
+6+2+3+3
Reduksi
Oksidasi
Zatyangberperansebagaipereduksi(reduktor)
atau mengalami oksidasi adalah FeSO
4
.
Sementaraitu,K
2
Cr
2
O
7
merupakanoksidatoratau
pengoksidasi.
22. Jawaban: b
SnCl
2
+2HgCl
2
SnCl
4
+Hg
2
Cl
2
+2+2+4+1
Oksidasi
Reduksi
Jadi,bilanganoksidasiHgberubahdari+2menjadi
+1.
23. Jawaban: a
1) BilanganoksidasiClO
4

=1
(1BOCl)+(4BOO)=1
BOCl+(4(2)) =1
BOCl =+7
2) BilanganoksidasiS
2
O
7
2
=2
(2BOS)+(7BOO) =2
(2BOS)+(7(2)) =2
2BOS14 =2
2BOS =+12
BOS =+6
3) BilanganoksidasiC
2
O
4
2
=2
(2BOC)+(4BOO) =2
(2BOC)+(4(2)) =2
2BOC8 =2
2BOC =+6
BOC =+3
4) BilanganoksidasiSbO
3
3
=3
(1BOSb)+(3BOO) =3
(1BOSb)+(3(2)) =3
BOSb6 =3
BOSb =+3
5) BilanganoksidasiAsO
4
3
=3
(1BOAs)+(4BOO) =3
BOAs+(4(2)) =3
BOAs8 =3
BOAs =+5
Jadi,bilanganoksidasitertinggidimilikiolehunsur
ClpadaionClO
4

.
24. Jawaban: a
3CuS+8HNO
3
3Cu(NO
3
)
2
+2NO+3S+4H
2
O
2+5+20
Oksidasi
Reduksi
Oksidator =HNO
3
Reduktor =CuS
Hasiloksidasi =S
Hasilreduksi =NO
25. Jawaban: e
Amonia=NH
3
BilanganoksidasiNH
3
=0
(1BON)+(3BOH) =0
BON+(31) =0
BON =3
Asamnitrat=HNO
3
BilanganoksidasiHNO
3
=0
(1BOH)+(1BON)+(3BOO) =0
(11)+BON+(3(2)) =0
1+BON6 =0
BON =+5
Kaliumnitrat=KNO
3
BilanganoksidasiKNO
3
=0
(1BOK)+(1BON)+(3BOO) =0
(11)+BON+(3(2)) =0
1+BON6 =0
BON =+5
Amoniumklorida=NH
4
Cl
BilanganoksidasiNH
4
Cl=0
(1BON)+(4BOH)+(1BOCl)=0
(1BON)+(41)+(1(1)) =0
BON+41 =0
BON =3
35 Kimia Kelas X
Dinitrogentrioksida=N
2
O
3
BilanganoksidasiN
2
O
3
=0
(2BON)+(3BOO) =0
(2BON)+(3(2)) =0
(2BON)6 =0
2BON =+6
BON =+3
Jadi, nitrogen mempunyai bilangan oksidasi +3
padasenyawadinitrogentrioksida.
26. Jawaban: d
Reaksidisproporsionasiadalahreaksiredoksjika
reduktor dan oksidator dalam reaksi redoks
tersebut merupakan unsur yang sama. Dengan
demikian, ion-ion yang dapat mengalami reaksi
disproporsionasidapatmengalamikenaikanatau
penurunanbilanganoksidasi.
BilanganoksidasiClO

=1
(1BOCl)+(1BOO) =1
BOCl+(1(2)) =1
BOCl =+1
BilanganoksidasiClO
4

=1
(1BOCl)+(4BOO)=1
BOCl+(4(2)) =1
BOCl =+7
BilanganoksidasiCl

=1
Jadi,ion-ionyangtidakdapatmengalamireaksi
disproporsionasiadalahCl

danClO
4

.
27. Jawaban: c
1) BilanganoksidasiSO
2
=0
(1BOS)+(2BOO) =0
(1BOS)+(2(2)) =0
BOS =+4
2) BilanganoksidasiNa
2
S
2
O
3
=0
(2BONa)+(2BOS)+(3BOO) =0
(21)+(2BOS)+(3(2)) =0
(2BOS) =+4
BOS =+2
3) BilanganoksidasiNaHSO
3
=0
(1BONa)+(1BOH)+(1BOS)+(3BOO) = 0
(11)+(11)+(1BOS)+(3(2)) = 0
BO S = +4
4) BilanganoksidasiH
2
S=0
(2BOH)+(1BOS) =0
(21)+(1BOS) =0
BOS =2
5) BilanganoksidasiH
2
SO
3
=0
(2BOH)+(1BOS)+(3BOO) =0
(21)+(1BOS)+(3(2)) =0
BOS =+4
6) BilanganoksidasiCuSO
4
=0
(1BOCu)+(1BOS)+(4BOO) =0
(12)+(1BOS)+(4(2)) =0
BOS =+6
7) BilanganoksidasiSO
3
=0
(1BOS)+(3BOO) =0
(1BOS)+(3(2)) =0
BOS =+6
8) BilanganoksidasiNa
2
S=0
(2BONa)+(1BOS) =0
(21)+(1BOS) =0
BOS =2
9) BilanganoksidasiH
2
S
2
O
7
=0
(2BOH)+(2BOS)+(7BOO) =0
(21)+(2BOS)+(7(2)) =0
(2BOS) =+12
BOS =+6
10) BilanganoksidasiNaHSO
4
=0
(1BONa)+(1BOH)+(1BOS)+(4BOO) = 0
(11)+(11)+(1BOS)+(42) = 0
(1BOS) = +6
BO S = +6
NilaibilanganoksidasiSdalamsenyawaberikut
berturut-turut:
a. H
2
S,H
2
SO
3
,CuSO
4
=2,+4,+6
b. Na
2
S
2
O
3
,SO
3
,Na
2
S=+2,+6,2
c. NaHSO
4
,SO
3
,H
2
S
2
O
7
=+6,+6,+6
d. NaHSO
3
,H
2
S
2
O
7
,H
2
S=+4,+6,2
e. SO
2
,Na
2
S
2
O
3
,NaHSO
3
=+4,+2,+4
Jadi,NaHSO
4
,SO
3
,danH
2
S
2
O
7
memilikibilangan
oksidasiyangsamasebesar+6.
28. Jawaban: c
Hg
2
Cl
2
terbentukdariunsurraksadenganbilangan
oksidasi +1 dan unsur klor dengan bilangan
oksidasi 1. Dengan demikian, nama senyawa
Hg
2
Cl
2
adalah raksa(I) klorida. Raksa(II) klorida
mempunyairumuskimiaHgCl
2
.Penamaanraksa
klorida, raksa diklorida, dan diraksa diklorida
merupakanpenamaanyangsalah.
29. Jawaban: e
a. K
3
SbO
4
=kaliumantimonat
b. K
3
SbO
3
=kaliumantimonit
c. H
3
SbO
4
=asamantimonat
d. Ca
3
(SbO
3
)
2
=kalsiumantimonit
e. Ca
3
(SbO
4
)
2
=kalsiumantimonat
30. Jawaban: c
Rumus Kimia
a. AlBr
3
b. MgSO
4
c. CaSiO
3
d. KClO
3
e. SiO
2
Nama Kimia
Aluminiumbromida
Magnesium sulfat
Kalsium silikat
Kalium klorat
Silikon dioksida
36 Kunci Jawaban dan Pembahasan
B. Uraian
1. Reduksibanyakdilakukanpadapengolahanbijih
logam.Beberapacontohnyasebagaiberikut.
a. Reduksibijihbesi(Fe
2
O
3
atauhematit)dengan
karbonmonoksida(CO).
Reaksinya:
Fe
2
O
3
(s)+3CO(g)2Fe(s)+3CO
2
(g)
b. Reduksikromium(III)oksidaolehaluminium.
Reaksinya:
Cr
2
O
3
(s)+2Al(s)Al
2
O
3
(s)+2Cr(s)
c. Reduksitembaga(II)oksidaolehgashidrogen.
Reaksinya:
CuO(s)+H
2
(g)Cu(s)+H
2
O(g)
2. a. 5C
2
O
4
2
10CO
2
+10e

Melepassepuluhelektronreaksioksidasi.
b. 2MnO
4

+16H
+
+10e

2Mn
2+
+8H
2
O
Menerimasepuluhelektronreaksireduksi.
c. H
2
O
2
O
2
+2H
+
+2e

Melepasduaelektronreaksioksidasi.
d. Cr
2
O
7
2
+14H
+
+6e

2Cr
3+
+7H
2
O
Menerimaenamelektronreaksireduksi.
3. a. BilanganoksidasiAlO
2

=1
(1BOAl)+(2BOO) =1
BOAl+(2(2)) =1
BOAl4 =1
BOAl =+3
b. BilanganoksidasiC
2
O
4
2
=2
(2BOC)+(4BOO) =2
2BOC+(4(2)) =2
2BOC8 =2
2BOC =+6
BOC =+3
c. BilanganoksidasiS
2
O
8
2
=2
(2BOS)+(8BOO) =2
(2BOS)+(8(2)) =2
2BOS16 =2
2BOS =+14
BOS =+7
d. BilanganoksidasiBrO
3

=1
(1BOBr)+(3BOO) =1
(1BOBr)+(3(2)) =1
BOBr6 =1
BOBr =+5
e. BilanganoksidasiAsO
4
3
=3
(1BOAs)+(4BOO) =3
(1BOAs)+(4(2)) =3
BOAs8 =3
BOAs =+5
4. a. 4AgClO
3
+3Cl
2
4AgCl+6ClO
2
+51
Penurunanbilanganoksidasisebesar6
b. As
2
O
3
+6Zn+12OH

2AsH
3
+6ZnO
2
2
+3H
2
O
+33
Penurunanbilanganoksidasisebesar6
c. CH
4
+2O
2
CO
2
+2H
2
O
4+4
Kenaikan bilangan oksidasi sebesar +8
d. Cl
2
+IO
3

+2OH

IO
4

+2Cl

+H
2
O
+5+7
Kenaikanbilanganoksidasisebesar+2
5. a. BilanganoksidasiH
2
C
2
O
4
=0
(2BOH)+(2BOC)+(4BOO) =0
(21)+(2BOC)+(4(2)) =0
(2BOC) =+6
BOC =+3
b. BilanganoksidasiAlAsO
4
=0
(1BOAl)+(1BOAs)+(4BOO) =0
(13)+(1BOAs)+(4(2)) =0
BOAs =+5
c. BilanganoksidasiBa
2
XeO
6
=0
(2BOBa)+(1BOXe)+(6BOO) =0
(22)+(1BOXe)+(6(2)) =0
BOXe =+8
d. BilanganoksidasiK
2
Cr
2
O
7
=0
(2BOK)+(2BOCr)+(7BOO) =0
(21)+(2BOCr)+(7(2)) =0
(2BOCr) =+12
BOCr =+6
6. 2K
2
CrO
4
+H
2
SO
4
K
2
SO
4
+K
2
Cr
2
O
7
+H
2
O
+6+6+6+6
Tetap
Tetap
Reaksitersebutbukanmerupakanreaksiredoks
karenatidakterjadiperubahanbilanganoksidasi.
Bilanganoksidasiunsur-unsurdisebelahkiritanda
panahsamadenganbilanganoksidasiunsur-unsur
disebelahkanantandapanah.
7. a. 2FeCl
3
+H
2
S2FeCl
2
+2HCl+S
+32+20
Reduksi
Oksidasi
Oksidator =FeCl
3
Reduktor =H
2
S
Hasiloksidasi=S
Hasilreduksi=FeCl
2
37 Kimia Kelas X
b. 2CrI
3
+64KOH+27Cl
2
2K
2
CrO
4
+6KIO
4
+54KCl+32H
2
O
+30+61
Oksidasi
Reduksi
Oksidator =Cl
2
Reduktor =CrI
3
Hasiloksidasi=K
2
CrO
4
Hasilreduksi=KCl
8. 2FeCl
2
+Cl
2
2FeCl
3
+20+31
Oksidasi
Reduksi
Reaksitersebuttidakdapatdikategorikanreaksi
koproporsionasi meskipun hasil oksidasi dan
reduksinyasamayaituFeCl
3
.Halinikarenahasil
oksidasiberupaunsurFedalamsenyawaFeCl
3
,
sedangkanhasilreduksiberupaunsurCldalam
senyawa FeCl
3
. Jadi, meskipun senyawa hasil
oksidasidanhasilreduksisama,tetapiunsurnya
berbeda.
9. a. KClO
3
b. Na
2
MnO
4
c. MgBr
2
d. Sr
3
(PO
4
)
2
e. Cu
2
SO
3
10. a. 2SnO
2
+2C2Sn+2CO
2
+400+4
Reduksi
Oksidasi
Zatpengoksidasi(oksidator)=SnO
2
Zatpereduksi(reduktor)=C
a. 6CO
2
+12H
2
SC
6
H
12
O
6
+6H
2
O+12S
+4200
Reduksi
Oksidasi
Zatpengoksidasi(oksidator)=CO
2
Zatpereduksi(reduktor)=H
2
S
2. Jawaban: a
Asam sulfat adalah larutan elektrolit kuat yang
dapat menghantarkan arus listrik dengan baik.
Asamsulfatterionisasisempurnadalamairdengan
derajationisasi()=1.Asamsulfatmampume-
nyalakanlampudenganterangdanmenghasilkan
banyakgelembunggas.
3. Jawaban: d
Jumlahmolzatmula-mula=0,5mol
Jumlahmolzatyangterionisasi=0,3mol
=
jumlah mol zat yang terionisasi
jumlah mol zat mula-mula
=
0,3 mol
0,5 mol
=0,6
Zat X merupakan elektrolit lemah karena
mempunyaiderajationisasi0<<1.
4. Jawaban: d
Larutan elektrolit kuat adalah larutan yang ter-
ionisasisempurnadalamair,misalHCl,Ba(OH)
2
,
NaCl,danH
2
SO
4
,Larutanelektrolitlemahakan
terionisasisebagiandalamair,misalNH
4
OHdan
CH
3
COOH.Jadi,pasanganlarutanelektrolitkuat
danlemahsecaraberturut-turutadalahH
2
SO
4
dan
NH
4
OH.
5. Jawaban: d
Bensin tidak dapat menghantarkan arus listrik
karenabersifatnonelektrolit.Senyawanonelektrolit
dalamairtidakterionisasi.Olehkarenaitu,bensin
mempunyaiderajationisasinol.
6. Jawaban: d
Senyawa yang bukan elektrolit (senyawa non-
elektrolit)merupakansenyawayangtidakdapat
menghantarkan arus listrik. Di antara senyawa
tersebutyangmerupakansenyawanonelektrolit
yaitu karbon tetraklorida (CCl
4
). Sementara itu,
tembaga(II) klorida (CuCl
2
), kalium hidroksida
(KOH),asamsulfat(H
2
SO
4
),danamoniumklorida
(NH
4
Cl) merupakan senyawa elektrolit (dapat
menghantarkanaruslistrik).
7. Jawaban: a
Padapercobaantersebutsebelumpenambahan
asam sulfat encer tidak ada aliran arus listrik.
Peristiwa ini menunjukkan bahwa larutan
sebelumnyabersifatnonelektrolit,misalair(H
2
O).
Larutanasamsulfat,natriumklorida,asamklorida,
danamoniumkloridaadalahsenyawaelektrolit.
Apabilasenyawa-senyawatersebutsebelumnya
mengisigelasbeker,akanadaaliranaruslistrik
yang mengalir bahkan sebelum penambahan
larutanasamsulfatcair.
8. Jawaban: d
Dalam proses elektrolisis, NaOH akan terurai
menjadiionNa
+
danionOH

.Katodeakanmelepas
elektron ke dalam larutan, yang kemudian
ditangkap oleh Na
+
. Anode akan menangkap
elektrondariOH

dalamlarutan.
Latihan Ulangan Tengah Semester
A. Pilihan Ganda
1. Jawaban: e
Larutanyangmampumenghantarkanaruslistrik
merupakanlarutanelektrolit,misallarutangaram
dapur. Urea, alkohol, spiritus, dan gula pasir
merupakanzatnonelektrolit.Larutannonelektrolit
tidakmampumenghantarkanaruslistrik.
38 Kunci Jawaban dan Pembahasan
9. Jawaban: d
Larutan elektrolit lemah ditandai dengan nyala
lampu redup atau tidak menyala disertai sedikit
gelembunggaspadaalatujielektrolit.Larutanini
ditunjukkanolehlarutannomor3)dan4).Larutan
elektrolitkuatditandaidengannyalalamputerang
danadanyabanyakgelembunggas.Larutannomor
1)dan2)adalahelektrolitkuatmeskipunlarutan
nomor 1) menyala redup. Larutan nonelektrolit
ditandaidenganlampuyangtidakmenyaladan
tidakadagelembunggas.Larutannomor5)adalah
larutannonelektrolit.
10. Jawaban: d
NH
4
OH merupakan elektrolit lemah yang akan
terionisasisebagianmenjadiionNH
4
+
danionOH

.
Persamaan reaksi ionisasinya ditandai dengan
tandapanahbolak-balik.BegitujugadenganH
2
CO
3
dan HCN yang merupakan elektrolit lemah.
Sementaraitu,KCldanMg(OH)
2
adalahelektrolit
kuatyangakanterionisasisempurna.Persamaan
reaksiionisasinyaditandaidengansatuarahpanah
kekanan.
11. Jawaban: d
Saataruslistrikdilewatkanmelaluilelehankalium
bromida,akanterjadiproseselektrolisis.Kalium
bromidaakanterionisasimenjadiionkalium(K
+
)
danionbromida(Br

).Ionkaliumakanbergerak
menujuelektrodenegatif(katode)danmenangkap
elektrondarikatode.Ionbromidaakanbergerak
menuju elektrode positif (anode) dan melepas
elektronkeanode.
12. Jawaban: a
Asamfosfatadalahlarutanelektrolitlemahyang
terionisasi sebagian dalam air. Asam fosfat
memiliki derajat ionisasi 0 < < 1. Natrium
hidroksida adalah larutan elektrolit kuat yang
terionisasi sempurna dalam air. Derajat ionisasi
natrium hidroksida () = 1. Natrium hidroksida
menghasilkanjumlahionlebihbanyakdaripada
asamfosfatmeskipunkonsentrasinyalebihkecil.
Olehkarenaitu,natriumhidroksidamenghantarkan
aruslistriklebihbaikdaripadaasamfosfat.
13. Jawaban: d
Senyawayangmenghantarkanaruslistrikdalam
jumlahpalingsedikitjikadilarutkandalamairadalah
senyawayangbersifatelektrolitlemah.Senyawa
yang bersifat elektrolit lemah yaitu H
2
CO
3
yang
merupakansenyawakovalenpolar(asamlemah).
Sementara itu, CsF, BaCl
2
, KNO
3
, dan Mg(OH)
2
merupakansenyawaion.Senyawaiontermasuk
elektrolitkuatkarenamengalamiionisasisempurna
dalamlarutannya(sangatbaikmenghantarkanarus
listrik),kecualiAl(OH)
3
danFe(OH)
3
.
14. Jawaban: b
Larutanyangtidakdapatmenghantarkanaruslistrik
berasal dari senyawa kovalen nonpolar, misal
senyawaCl
2
.Dalamair,senyawainitidakdapat
terionisasi dan tetap berbentuk molekul. Oleh
karenaitu,larutansenyawakovalennonpolartidak
dapatmenghantarkanaruslistrik.HBr,Na
2
SO
4
,
danCa(NO
3
)
2
merupakansenyawaionyangdapat
menghantarkanaruslistrikdalambentuklelehan
maupun larutan. Sementara itu, HClO
4
adalah
senyawakovalenpolaryanghanyadapatmeng-
hantarkanaruslistrikdalambentuklarutannya.
15. Jawaban: a
SenyawaKClmerupakansenyawaionik.Senyawa
ionik dalam bentuk padatannya tidak dapat
menghantarkan arus listrik. Bentuk lelehannya
dapatmenghantarkanaruslistrikkarenaion-ionnya
dapat bergerak bebas. Dalam bentuk larutan,
senyawaionikakanterionisasisempurnadalam
airsehinggadapatmenghantarkanaruslistrik.
16. Jawaban: a
H
2
SO
4
dan HBr adalah elektrolit kuat yang
mempunyaiikatankovalenpolar.NH
4
OHdanH
2
S
juga termasuk senyawa kovalen polar tetapi
bersifatelektrolitlemah.SenyawaLiOH,NaOH,
NaCl,Sr(OH)
2
,Ca(NO
3
)
2
,danFe(OH)
3
merupakan
elektrolitkuatyangberikatanion.
17. Jawaban: d
Senyawakovalenpolardapatmenghantarkanarus
listrikdalambentuklarutan.Ion-ionyangterbentuk
dalam larutannya dapat bergerak bebas dan
menghantarkanaruslistrik.Berbedadenganbentuk
larutan, cairan senyawa kovalen terdiri atas
molekul-molekulnya sehingga tidak dapat
menghantarkanlistrik.
18. Jawaban: d
Senyawa ion merupakan senyawa yang dapat
menghantarkanaruslistrikdalamkeadaanlelehan
danlarutan.Halinikarenadalamkeadaanlelehan
danlarutansenyawaiondapatteruraimenjadiion
positif dan ion negatif yang bergerak bebas
sehinggadapatmenghantarkanaruslistrik.Dalam
keadaan padat atau kristal, senyawa ion belum
terionisasisehinggatidakdapatmenghantarkan
aruslistrik.
19. Jawaban: b
Natriumklorida(NaCl)merupakansenyawaion.
Dalambentukpadatan,senyawaionmempunyai
susunanmampatdanrapatsertabelumterionisasi
sehingga tidak terdapat ion-ion di dalamnya.
Dengan demikian, padatan NaCl tidak dapat
menghantarkan arus listrik. Senyawa ion dapat
menghantarkan arus listrik jika dilelehkan atau
39 Kimia Kelas X
dilarutkan dalam air. Jika NaCl dilelehkan atau
dilarutkan dalam air, NaCl akan terionisasi
membentuk ion Na
+
dan ion Cl

yang dapat
bergerak bebas. Adanya ion-ion yang bergerak
bebas inilah yang mengakibatkan larutan NaCl
dapatmenghantarkanaruslistrik.
20. Jawaban: a
HCl merupakan senyawa kovalen polar. Dalam
bentukmurni,HCltidakdapatmenghantarkanarus
listrik.Olehkarenaitu,lampupadaalatujielektrolit
tidakakanmenyaladantidakterbentukgelembung
gas.NaClmerupakansenyawaionyangmampu
menghantarkanaruslistrikdalambentuklelehan
dan larutan. Jika diuji dengan alat uji elektrolit,
larutan NaCl akan menyalakan lampu dengan
terangdanterbentukbanyakgelembunggas.
21. Jawaban: c
Besiyangtidakdapatdioksidasilagiartinyabesi
mempunyaibilanganoksidasitertinggidantidak
dapatmengalamikenaikanbilanganoksidasilagi.
Berdasarkanhargabilanganoksidasiyangdimiliki
besi,besiyangtidakdapatdioksidasilagiadalah
besiyangmempunyaibilanganoksidasi+3.Besi
dalambentukunsurmempunyaibilanganoksidasi
0 (nol), sedangkan dalam bentuk senyawa besi
mempunyaibilanganoksidasi+2dan+3.
BilanganoksidasiFe=0
BilanganoksidasiFedalamFeCl
2
=+2
BilanganoksidasiFedalamFe
2
O
3
=+3
BilanganoksidasiFedalamFeSO
4
=+2
BilanganoksidasiFedalamFe(NO
3
)
2
=+2
Jadi,besiyangtidakdapatdioksidasilagiterdapat
dalamsenyawaFe
2
O
3
.
22. Jawaban: c
a. H
2
SS
20
Kenaikanbilanganoksidasi
b. H
2
H
2
O
0+1
Kenaikanbilanganoksidasi
c. ClO
3

Cl

+5 1
Penurunanbilanganoksidasi
d. NO
2
NO
3

+4 +5
Kenaikanbilanganoksidasi
e. Fe(OH)
2
Fe
2
O
3
+2 +3
Kenaikanbilanganoksidasi
23. Jawaban: c
7MnO
4
2
+4H
+
+O
2
MnO
2
+6MnO
4

+4OH

+6+4+7
reduksi
oksidasi
Reaksi tersebut merupakan reaksi autoredoks
karena unsur yang mengalami reduksi dan
oksidasisama,yaituMndalamMnO
4
2
.
24. Jawaban: c
Bilanganoksidasi(BO)unsuryangdigarisbawahi
sebagaiberikut.
1) BilanganoksidasiSO
2
Cl
2
=0
(1BOS)+(2BOO)+(2BOCl) =0
(BOS)+(2(2)+(2(1)) =0
(BOS)+(4)+(2) =0
BOS =+6
2) BilanganoksidasiHNO
2
=0
(1BOH)+(1BON)+(2BOO) =0
(1(+1))+(BON)+(2(2)) =0
(+1)+(BON)+(4) =0
BON =+3
3) BilanganoksidasiFe(CN)
6
4
=4
(1BOFe)+(1BOCN) =4
(BOFe)+(6(1)) =4
(BOFe)+(6) =4
BOFe =+2
4) BilanganoksidasiNi(CO)
4
=0
(1BONi)+(4BOCO) =0
(BONi)+(4(1)) =0
BONi =+4
5) BilanganoksidasiH
2
CO
3
=0
(2BOH)+(1BOC)+(3BOO) =0
(2(+1))+(BOC)+(3(2)) =0
(+2)+(BOC)+(6) =0
BOC =+4
Jadi,unsuryangmempunyaibilanganoksidasi+2
adalahFedalamFe(CN)
6
4
.
25. Jawaban: e
Cu+2H
2
SO
4
CuSO
4
+2H
2
O+SO
2
0 +6 +2 +4
oksidasi
reduksi
Jadi, bilangan oksidasi S berubah (mengalami
penurunan)dari+6menjadi+4.
26. Jawaban: c
MnO
4

+8H
+
+5Fe
2+
Mn
2+
+5Fe
3+
+4H
2
O
+7 +2 +2 +3
reduksi
oksidasi
Fe(besi)mengalamioksidasi.Fe
2+
melepaskan
elektronsehinggamerupakanreduktor.Mangan
mengalami reduksi sehingga merupakan
pengoksidasi(oksidator).
40 Kunci Jawaban dan Pembahasan
27. Jawaban: e
1) Ca
2+
(aq)+SO
4
2
(aq)CaSO
4
(aq)
+2+62+2+62
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
2) NH
4
+
(aq)+OH

(aq)NH
3
(g)+H
2
O()
32+13+12
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
3) Cr
2
O
7
2
(aq)+H
2
O()2CrO
4
2
(aq)+2H
+
(aq)
+6+12+62+1
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
4) CuO(s)+2HNO
3
(aq)Cu(NO
3
)
2
(aq)+H
2
O()
+22+1+5+2+5+12
Tidak terjadi perubahan bilangan oksidasi
(bukanreaksiredoks).
5) 2Na
2
S
2
O
3
(aq)+I
2
(aq)Na
2
S
4
O
6
(aq)+2NaI(aq)
+2 0 +2,5 1
oksidasi
reduksi
Reaksitersebutmerupakanreaksireduksidan
oksidasi(redoks).
28. Jawaban: e
K
2
Cr
2
O
7
+7H
2
SO
4
+FeSO
4
K
2
SO
4
+Cr
2
(SO
4
)
3
+Fe
2
(SO
4
)
3
+7H
2
O
+6 +2 +3 +3
reduksi
oksidasi
Jadi,hasiloksidasidanhasilreduksipadapersamaan
reaksi tersebut secara berturut-turut adalah
Fe
2
(SO
4
)
3
danCr
2
(SO
4
)
3
.
29. Jawaban: b
a. BilanganoksidasiVN=0
(1BOV)+(1BON) =0
(1BOV)+(1(3)) =0
BOV =+3
b. BilanganoksidasiVF
5
=0
(1BOV)+(5BOF) =0
(1BOV)+(5(1)) =0
BOV =+5
c. BilanganoksidasiVCl
3
=0
(1BOV)+(3BOCl) =0
(1BOV)+(3(1)) =0
BOV =+3
d. BilanganoksidasiVSO
4
=0
(1BOV)+(1BOS)+(4BOO) =0
(1BOV)+(16)+(4(2)) =0
BOV =+2
e. BilanganoksidasiVOSO
4
=0
(1BOV)+(1BOO)+(1BOS)
+(4BOO)=0
(1BOV)+(1(2))+(16)+(4(2))=0
BOV=+4
30. Jawaban: b
Pembakaran merupakan peristiwa oksidasi zat
denganoksigendiudarayangberlangsungcepat
disertai terbentuknya energi panas dan cahaya
(api).Jadi,pembakaranlilindankayumerupakan
reaksi oksidasi. Perkaratan logam besi juga
merupakanreaksioksidasikarenabesimengikat
oksigenmenjadikarat.Sementaraitu,pelarutan
kapur tohor bukan merupakan reaksi oksidasi
karenatidakterjadiperubahanbilanganoksidasi.
Persamaanreaksinyasebagaiberikut.
CaCO
3
(s)+H
2
O()Ca(OH)
2
(aq)+CO
2
(g)
+2+4 +2 +4
Bilanganoksidasinyatetap.
31. Jawaban: d
4ClO
3

+3N
2
H
4
4Cl

+6H
2
O+6NO
+5 2 1 +2
penurunanbilanganoksidasi
kenaikanbilanganoksidasi
Jadi,ClpadaClO
3

mengalamipenurunanbilangan
oksidasi(reduksi)dari+5menjadi1.
32. Jawaban: d
1) Amoniumklorida=NH
4
Cl
BilanganoksidasiNH
4
Cl=0
(1BON)+(4BOH)+(1BOCl) =0
BON+(4(+1))+(1(1)) =0
BON+41 =0
BON =3
2) Dinitrogentrioksida=N
2
O
3
BilanganoksidasiN
2
O
3
=0
(2BON)+(3BOO) =0
(2BON)+(3(2)) =0
(2BON)6 =0
2BON =+6
BON =+3
3) Kaliumnitrat=KNO
3
BilanganoksidasiKNO
3
=0
(1BOK)+(1BON)+(3BOO) =0
(1(+1))+BON+(3(2)) =0
1+BON6 =0
BON =+5
4) Asamnitrit=HNO
2
BilanganoksidasiHNO
2
=0
(1BOH)+(1BON)+(2BOO) =0
(1(+1))+BON+(2(2)) =0
1+BON4 =0
BON =+3
Jadi,senyawayangmempunyainitrogendengan
bilangan oksidasi +3 adalah dinitrogen trioksida
danasamnitrit.
41 Kimia Kelas X
33. Jawaban: d
Reaksidisproporsionasimerupakanreaksiyang
mempunyaioksidatordanreduktorsama,artinya
atomyangsamamengalamiperubahanbilangan
oksidasi. Dengan demikian, atom N yang
mengalami reaksi disproporsionasi tidak boleh
mempunyaibilanganoksidasiminimum(3)atau
maksimum(+5).
a. BONdalamN
2
=0
BONdalamNO
2
=+4
b. BONdalamN
2
=0
BONdalamNH
3
=3
c. BONdalamNO
2
=+4
BONdalamNO
3

=+5
d. BONdalamNH
3
=3
BONdalamNO
3

=+5
e. BONdalamN
2
O
3
=+3
BONdalamNO
2
=+4
34. Jawaban: b
Pereduksiartinyazatyangmengalamioksidasi
1) MnO
2
+4HClMnCl
2
+2H
2
O+Cl
2
+4 1 +2 0
reduksi
oksidasi
2) Pb
3
O
4
+8HCl3PbCl
2
+4H
2
O+Cl
2
8/3 1 +2 0
reduksi
oksidasi
3) K
2
Cr
2
O
7
+14HCl2KCl+2CrCl
3
+7H
2
O+3Cl
2
+6 1 +3 0
reduksi
oksidasi
4) SnCl
2
+2HCl+2HNO
3
SnCl
4
+2H
2
O+2NO
2
+2 1 +5 +4 1 +4
oksidasi
reduksi
HCltidakmengalamiperubahanbilanganoksidasi.
Jadi,asamkloridayangbersifatsebagaipereduksi
terdapatpadareaksi1),2),dan3).
35. Jawaban: b
4Fe+3O
2
2Fe
2
O
3
0 0 +3 2
oksidasi
reduksi
Jadi,logambesimerupakanzatyangmengalami
oksidasi (teroksidasi) atau sebagai pereduksi
(reduktor).Sementaraitu,oksigenmerupakanzat
yangmengalamireduksi(tereduksi)atausebagai
pengoksidasi (oksidator). Fe
2
O
3
merupakan
senyawahasilreduksidanhasiloksidasi.
36. Jawaban: c
a. BilanganoksidasiAlCl
3
=0
(1BOAl)+(3BOCl) =0
(13)+(3BOCl) =0
(3BOCl) =3
BOCl =1
b. BilanganoksidasiSnCl
4
=0
(1BOSn)+(4BOCl) =0
(14)+(4BOCl) =0
(4BOCl) =4
BOCl =1
c. BilanganoksidasiKClO
3
=0
(1BOK)+(1BOCl)+(3BOO) =0
(11)+(1BOCl)+(3(2)) =0
BOCl =+5
d. BilanganoksidasiNaClO=0
(1BONa)+(1BOCl)+(1BOO) =0
(11)+(1BOCl)+(1(2)) =0
BOCl =+1
e. BilanganoksidasiCa(OCl)
2
=0
(1BOCa)+(2BOO)+(2BOCl) =0
(12)+(2(2))+(2BOCl) =0
24+2BOCl =0
BOCl =+1
37. Jawaban: a
Reaksidisprosporsionasimerupakanreaksiyang
mempunyaioksidatordanreduktorsama(hanya
satu macam atom yang bilangan oksidasinya
berubah).
a. ClO
3

+Cl

Cl
2
+ClO
2

+5 1 0 +3
reduksi
oksidasi
Reaksitersebutbukanreaksidisproporsionasi
melainkanreaksiredoks.
b. I
2
O
4
+OH

IO
3

+I

+H
2
O
+4 +5 1
oksidasi
reduksi
Reaksi tersebut merupakan reaksi
disproporsionasi.
c. NO
2
+2H
2
OHNO
3
+HNO
2
+4 +5 +3
oksidasi
reduksi
Reaksi tersebut merupakan reaksi
disproporsionasi.

N
2
danNO
2
dapat
mengalami reaksi
disproporsionasi

NO
2
dapatmengalami
reaksi disproporsio-
nasi sedangkan NO
3

tidakdapatmengalami
reaksi disproporsionasi

NH
3
dan NO
3

tidak
dapat mengalami
reaksi disproporsionasi

N
2
dapatmengalami
reaksi disproporsionasi
sedangkan NH
3
tidak
dapat mengalami reaksi
disproporsionasi

N
2
O
3
dan NO
2
dapat
mengalami reaksi
disproporsionasi
42 Kunci Jawaban dan Pembahasan
d. NaOH+Cl
2
NaCl+NaClO
3
+H
2
O
0 1 +5
reduksi
oksidasi
Reaksi tersebut merupakan reaksi
disproporsionasi.
e. IPO
4
+H
+
I
2
+IO
4

+H
2
PO
4

+H
2
O
+3 0 +7
reduksi
oksidasi
Reaksi tersebut merupakan reaksi
disproporsionasi.
38. Jawaban: b
B
39. Jawaban: b
a. FeSO
4
=besi(II)sulfat/ferrosulfat
b. FeSiO
3
=besi(II)silikat/ferrosilikat
c. FeC
2
O
4
=besi(II)oksalat/ferrooksalat
d. Fe
3
(AsO
3
)
2
=besi(II)arsenit/ferroarsenit
e. Fe
3
(SbO
5
)
2
=besi(II)antimonat/ferroantimonat
40. Jawaban: c
MnO
2
+2H
2
SO
4
+2NaIMnSO
4
+Na
2
SO
4
+2H
2
O+I
2
+4 1 +2 0
reduksi
oksidasi
HasilreduksiberupaMnSO
4
.
NamakimiaMnSO
4
adalahmangan(II)sulfat.
B. Uraian
1. Larutan elektrolit adalah larutan yang dapat
menghantarkan arus listrik. Larutan ini dapat
menyalakanlampudanmenghasilkangelembung
gasjikadiujidenganalatpengujielektrolit.Larutan
nonelektrolit adalah larutan yang tidak dapat
menghantarkanaruslistrik.Larutaninitidakdapat
menyalakan lampu dan tidak menghasilkan
gelembunggasjikadiujidenganalatpengujielektrolit.
2. JikalarutanHCldiujidenganalatpengujielektroilt,
lampuakanmenyalaterangdanterbentukbanyak
gelembung gas. Sementara itu, jika larutan
CH
3
COOHdiujidenganpengujielektrolit,larutan
akan menghasilkan sedikit gelembung gas dan
menyalakanlampudenganredupataulamputidak
menyala.
3. M
r
HCN=27g/mol
massaHCN=27gram
molHCN=
27 gram
27 g/mol
=1mol
molyangterionisasi
=(molmula-mulamolsetelahkesetimbangan)
=(10,4)mol
=0,6mol
derajationisasi()=
mol terionisasi
mol mula-mula
=
0,6
1
=0,6
Jadi,asamsianida(HCN)mempunyai=0,6dan
termasuklarutanelektrolitlemahkarenaderajat
ionisasinya0<<1.
4. Bentukkristalsenyawaionsangatrapatdanbelum
terionisasi.Halinimengakibatkankristalsenyawa
ion tidak dapat menghantarkan arus listrik.
Sementaraitu,senyawaiondalambentuklelehan
dapatmengalamiionisasisehinggaion-iondalam
lelehansenyawaiondapatbergerakbebas.Oleh
karena itu, lelehan senyawa ion dapat meng-
hantarkanaruslistrik.
5. Perbedaanantarakationdananionsebagaiberikut.
6. Reaksi oksidasi adalah reaksi yang melibatkan
penggabungan oksigen. Reaksi reduksi adalah
reaksipelepasanoksigen.
a. C+O
2
CO
2
(reaksioksidasi)
b. 4Fe+3O
2
2Fe
2
O
3
(reaksioksidasi)
c. 2H
2
O
2
2H
2
O+O
2
(reaksireduksi)
d. 2KNO
3
2KNO
2
+O
2
(reaksireduksi)
e. 2KClO
3
2KCl+3O
2
(reaksireduksi)
f. CH
4
+2O
2
CO
2
+2H
2
O (reaksioksidasi)
7. 2CrBr
3
+64NaOH+27Cl
2
2Na
2
CrO
4
+6NaBrO
4
+54NaCl+32H
2
O
+3 1 0 +6 +7 1
oksidasi
oksidasi
reduksi
Oksidator =Cl
2
Reduktor =CrBr
3
Hasiloksidasi =Na
2
CrO
4
danNaBrO
4
Hasilreduksi =NaCl
No.
1)
2)
3)
4)
5)
Kation
K
+
Al
3+
Mg
2+
Fe
3+
Ba
2+
Anion
SO
4
2
OH

NO
3

Cl

PO
4
3
Nama Kimia
Kaliumsulfat
Aluminium hidroksida
Magnesium nitrat
Besi(III) klorida
Barium fosfat
Rumus
Molekul
K
2
SO
4
Al(OH)
3
Mg(NO
3
)
2
FeCl
3
Ba
3
(PO
4
)
2
Kation
Kation bermuatan positif
Selamaelektrolisis,kation
bergerak ke katode
Secara umum, hidrogen
dan logam menghasilkan
kation
Kationmenerimaelektron
darikatodedanmembentuk
atomdanmolekul
Misal:
Cu
2+
(aq)+2e

Cu(s)
Anion
Anion bermuatan negatif
Selamaelektrolisis,anion
bergerak ke anode
Secara umum, nonlogam
menghasilkan anion
Anionmenyerahkanelek-
tron ke anode dan mem-
bentukatomdanmolekul
Misal:
2Cl

(aq)Cl
2
(g)+2e

1.
2.
3.
4.
43 Kimia Kelas X
8. a. 3NaHSO
4
+8Al+3NaOH3Na
2
S+4Al
2
O
3
+3H
2
O
+602+3
reduksi
oksidasi
oksidator :NaHSO
4
reduktor :Al
b. Bi
2
O
3
+2NaOH+2NaOCl2NaBiO
3
+2NaCl+H
2
O
+3+1+51
oksidasi
reduksi
oksidator :NaOCl
reduktor :Bi
2
O
3
c. Cl
2
+2KOHKCl+KClO+H
2
O
01+1
reduksi
oksidasi
oksidator :Cl
2
reduktor :Cl
2
9. KMnO
4
=kaliumpermanganat
KI =kaliumiodida
H
2
SO
4
=asamsulfat
MnSO
4
=mangan(II)sulfat
K
2
SO
4
=kaliumsulfat
I
2
=iodin
H
2
O =air
10.
Rumus Kimia
CaC
2
O
4
XeF
4
Pb(SO
4
)
2
CoPO
3
AuCN
SnO
Nama Senyawa
Kalsium oksalat
Xenon tetrafluorida
Timbal(IV) sulfat
Kobalt(III) fosfit
Emas(I) sianida
Timah(II) oksida
Bab III Senyawa Hidrokarbon
A. Pilihan Ganda
1. Jawaban: b
FriedrichWohleradalahilmuwandariJermanyang
berhasil mensintesis urea yang merupakan
senyawaorganikdariamoniumsianat.Amonium
sianat merupakan senyawa anorganik yang
diperoleh dari hasil reaksi antara perak sianat
dengan amonium klorida. Jons Jacob Berzelius
adalahilmuwankimiadibidangelektrokimia,John
Dalton adalah penemu atom, Michael Faraday
adalah ilmuwan di bidang elektromagnetik dan
elektrokimia,sedangkanKekuleadalahpenemu
strukturbenzena.
2. Jawaban: a
Sifat-sifatsenyawaorganikdiantaranya:reaksinya
berjalanlambat,tidaktahanterhadappanas,jika
dibakar menghasilkan karbon, dan mudah larut
dalamalkoholdaripadaair.Senyawayangterurai
padasuhutinggiadalahsenyawaanorganik.
3. Jawaban: d
PemanasangulamenghasilkanH
2
O.H
2
Osaatdiuji
dengankertaskobaltakanmengubahwarnakertas
kobaltdaribirumenjadimerahmuda.Terbentuknya
airsekaligusmembuktikanbahwagulamengandung
unsurH.UnsurHmudahteroksidasiolehoksigen
membentukH
2
O.Jadi,pemanasangulamenghasil-
kanH
2
O.
4. Jawaban: e
Unsurkarbondalamsenyawahidrokarbondapat
diketahui dengan cara memanaskan senyawa
hidrokarbon.Gasyangdihasilkandariprosesini
dialirkankedalamairkapur.Jikaairkapurberubah
menjadi keruh, berarti gas yang dihasilkan dari
pemanasan senyawa hidrokarbon mengandung
CO
2
.GasCO
2
terbentuksaatunsurCyangterurai
darisenyawahidrokarbonberikatandenganO
2
.
5. Jawaban: c
Hidrokarbondenganrantaikarbonsiklismerupakan
hidrokarbondenganstrukturrantaimelingkaratau
tertutup,sepertipadapilihana,b,d,dane.Pilihan
cmerupakanhidrokarbonrantailurus.
6. Jawaban: e
Atomkarbonmempunyaiempatelektronvalensi.
Keempatelektronvalensiinidigunakanuntukmem-
bentukikatanantaratomkarbonataudenganatom-
atomlain.Ikatanantaratomkarbondapatberupa
ikatan tunggal, rangkap dua, atau rangkap tiga,
membentukrantailurusataumelingkar.Dengan
demikian,jumlahsenyawakarbonmenjadisangat
banyak.
7. Jawaban: c
Senyawa hidrokarbon adalah senyawa yang
tersusundariunsurkarbondanhidrogen,seperti
CH
4
,C
2
H
4
,danC
3
H
8
.Unsur-unsuryangtersusun
dari unsur-unsur karbon, hidrogen, dan oksigen
merupakansenyawaorganik.ContohCO
2
,H
2
O,
C
6
H
12
O
6
,danC
12
H
22
O
11
.
8. Jawaban: c
Senyawahidrokarbonjenuhadalahsenyawayang
rantaikarbonnyaberikatantunggal.Bentukrantai
ikatanuntuksenyawaC
2
H
2
,C
2
H
4
,C
3
H
8
,C
4
H
6
,dan
C
4
H
8
sebagaiberikut.
C
2
H
2
: HCCH (ikatantidakjenuh)
C
2
H
4
: H H
GC=CH (ikatantidakjenuh)
H H
44 Kunci Jawaban dan Pembahasan
C
3
H
8
: H H H
| | |
HCCCH (ikatanjenuh)
| | |
H H H
C
4
H
6
: H H
| |
HCCCCH (ikatantidakjenuh)
| |
H H
C
4
H
8
: H H H
| | |
HCC=CCH(ikatantidakjenuh)
| | |
H H H
Jadi, rumus molekul senyawa yang merupakan
hidrokarbonjenuhadalahC
3
H
8
.
9. Jawaban: e
Senyawahidrokarbonaromatikadalahsenyawa
karbonyangrantaiikatannyamelingkardengan
ikatanrangkapduaterkonjugasi/berselang-seling,
contoh:
H H H H H
| | | | |
HCCH dan HCCCH
| | | | |
H H HCHHCH
| |
H H
merupakansenyawaalifatikjenuhkarenaberikatan
|
C
l
C
l l l l
C C C C
l l l l
C
l
C
|
11. Jawaban: b
AtomCprimerpadastruktur:
9
CH
3

3
CH
3
l l
11
CH
3

10
CH
2

8
CH
4
CH
2
CH
1
CH
3
l

H
3
C
7

5
CH
6
CH
3
ada6,yaituatomCnomor1,3,6,7,9,dan11.
AtomCnomor10merupakanatomCsekunder,
atomCnomor2,4,5,dan8merupakanatomC
tersier.
12. Jawaban: d
Atomkarbonmemilikiempatelektronvalensi.Hal
inimerupakankekhasanatomkarbon.Setiapatom
karbondapatmembentukempatikatankovalen
melalui penggunaan bersama empat pasang
elektron dengan atom lain. Apabila sepasang
elektronikatandigambarkandengansatugaris,
berartiatomkarbondapatberikatandenganatom
lain menggunakan empat garis. Apabila kurang
ataulebihdariempatgarismakaterjadikesalahan.
a.
C
H
H H
H C H
H
H
C C
atomCnomor2memiliki5garis(salah)
b.
C
H
H
H C H
H
H
C C
H
H C H
atomCnomor2memiliki5garis(salah)
c. C
H
H H
H
H
C C
atomCnomor1memiliki5garis(salah)
C
| || |
H
H
C
H H
H H
C C
CH
CH
C
C
C
C
H H
| |
HCCCCHdan
| |
H HCH
|
H
tunggal,sedangkan
merupakansenyawaalifatik
tidakjenuhkarenamengandungikatanrangkaptiga
dandua.
10. Jawaban: d
Rantaikarbonterpanjangdinyatakanolehrantai
lurusnya. Rantai karbon lurus pada a dan e
berjumlah5atomC,padabberjumlah6atomC,
padacberjumlah4atomC,danpadadberjumlah
7atomC.Jadi,senyawahidrokarbonyangmem-
punyairantaikarbonterpanjangyaitu
H
|
GC=CC=CH
|
H
H
H
H
H
45 Kimia Kelas X
d.
C
H
C
H
C
C C H
H
H
H
H H
semuaatomCmemiliki4garis(benar)
e.
C
H
H H
H C H
H
H
C C
H
H
H
atomCnomor2dan3masing-masingmemiliki
6garis(salah)
13. Jawaban: c
AtomCsekundermengikatduaatomClain.Atom
C sekunder berada pada atom C nomor 7.
Sementaraitu,atomCnomor1,3,4,6,9,dan10
merupakanatomCprimer.AtomCnomor5dan8
merupakan atom C tersier. Atom C nomor 2
merupakanatomCkuarterner.
14. Jawaban: a
AtomCsekundermengikatduaatomClaindan
atomCkuarternermengikatempatatomClain.
Pasangan jenis atom C tersebut terdapat pada
senyawadenganstruktur:

p
CH
3
l

p
CH
3

s
CH
2

t
CH
k
C
p
CH
3
l l

p
CH
3

p
CH
3
Padastruktursenyawayanglainmempunyaijenis
atomCsebagaiberikut.
p
CH
3
l
p
CH
3

s
CH
2

t
CH
p
CH
3

p
CH
3
l
p
CH
3

t
CH
t
CH
p
CH
3
l

p
CH
3
p
CH
3
l
p
CH
3

s
CH
2

t
CH
s
CH
2
l
p
CH
3

p
CH
3
l
p
CH
3

k
C
p
CH
3
l

p
CH
3
15. Jawaban: a
Atom C tersier dalam strukturnya mengikat tiga
atomClain.
CH
3
l
CH
3

t
CH
t
CHCH
3
l
CH
3
B. Uraian
1. a. Senyawa organik adalah senyawa yang
mengandungunsurkarbon.
b. Senyawa organik tidak hanya berasal dari
makhlukhidupsaja,tetapidapatjugadiper-
oleh melalui sintesis senyawa-senyawa
anorganikdilaboratorium.Contohurea,dapat
disintesisdaripemanasanamoniumsianat.
Urea merupakan senyawa organik dengan
rumusCO(NH
2
)
2
,sedangkanamoniumsianat
(NH
4
OCN)merupakansenyawaanorganik.
2. Untukmembuktikanbahwagasyangdihasilkan
dariprosespembakaranadalahCO
2
,pembakaran
dilakukandidalamwadahtertutup,misaltabung
reaksiyangdiberisumbatdanslang.Saatproses
pembakaranberlangsung,slangdihubungkanke
wadahyangberisiairkapuruntukmengalirkangas
yangterbentukdaripembakaran.Apabilaairkapur
menjadikeruh,dapatdipastikanbahwagasyang
dihasilkan dari pembakaran adalah CO
2
. CO
2
bereaksidenganairkapurmembentuksenyawa
karbonat.Terbentuknyakarbonatditandaidengan
larutanyangtadinyabeningberubahmenjadikeruh.
Reaksiyangterjadisebagaiberikut.
Ca(OH)
2
(aq)+CO
2
(g)CaCO
3
(aq)+H
2
O()

keruh
3. Senyawaorganikkurangreaktifdibandingsenyawa
anorganik,kecualipadareaksipembakaran.Pada
umumnya,senyawaorganikmudahterbakar,tetapi
kurangreaktifterhadappereaksilain,misalplastik.
Plastikmudahterbakar,tetapitidakbereaksidengan
asamdanbasa.
4. Ikatan jenuh adalah ikatan tunggal pada rantai
ikatan atom karbon. Ikatan jenuh terjadi pada
alkana.
Contoh:
l l l l l l
CCC CCC
l l l l l l
C
l
Ikatan tidak jenuh adalah ikatan rangkap pada
rantaiikatanatomkarbon.Ikatantidakjenuhterjadi
padaalkenadanalkuna.
p =atomCprimer
s =atomCsekunder
t =atomCtersier
k =atomCkuartener
46 Kunci Jawaban dan Pembahasan
Contoh:
l l l l
CC=C CCC
l l
5. Atom C sekunder merupakan atom C yang
mengikat2atomClain.Ikatanyangterjadiantara
atomCtersebutdengan2atomlaindapatberupa
ikatantunggal,ikatanrangkapdua,ataupunikatan
rangkaptiga.Jadi,padastruktursenyawatersebut,
atomCsekunderterdapatpadaatomCnomor3,
5,6,7,dan9.
A. Pilihan Ganda
1. Jawaban: a
Senyawahidrokarbontidakjenuhadalahsenyawa
hidrokarbonyangmemilikirantaikarbonberikatan
rangkap. Rantai seperti ini dimiliki oleh alkena
denganrumusumumC
n
H
2n
danalkunadengan
rumus umum C
n
H
2n 2
. Contoh senyawa hidro-
karbontidakjenuhyaituC
2
H
4
danC
5
H
10
(alkena),
serta C
3
H
4
(alkuna). Sementara itu, C
3
H
8
dan
C
4
H
10
merupakan alkana. Alkana merupakan
senyawahidrokarbonjenuh.
2. Jawaban: d
isopentana:
CH
3
CHCH
2
CH
3
(5atomC)
|
CH
3
n-pentana:
CH
3
CH
2
CH
2
CH
2
CH
3
(5atomC)
2-metil-butana:
CH
3
CHCH
2
CH
2
(5atomC)
|
CH
3
2-metil-pentana:
CH
3
CHCH
2
CH
2
CH
3
(6atomC)
|
CH
3
2,2-dimetil-propana:
CH
3
|
CH
3
CHCH
3
(5atomC)
|
CH
3
Jadi,senyawakarbonyangtidakmengandunglima
atomkarbonadalah2-metilpentana.
3. Jawaban: b
Senyawahidrokarbonsatuhomologmempunyai
rumus umum sama sehingga merupakan satu
golongan. C
3
H
6
adalah alkena, C
4
H
10
adalah
alkana,C
5
H
10
adalahalkena,C
3
H
8
adalahalkana,
dan C
4
H
6
adalah alkuna. Jadi, senyawa yang
merupakansatuhomologyaitusenyawadengan
rumusC
3
H
6
denganC
5
H
10
danC
4
H
10
denganC
3
H
8
.
4. Jawaban: d
Rumusstrukturalkana
H
CH
3
CHCCH
3
| |
C
2
H
5
CH
3
Padastrukturtersebut,rantaiindukterdiriataslima
atom C dan dua alkil metil terikat pada atom C
nomor2dan3.DengandemikiannamaIUPACdari
senyawatersebutadalah2,3dimetil-pentana.
5. Jawaban: a
b=3-etil-2,2,3-trimetil-pentana
c=3,3,4-trimetil-heksana
d=3-etil-2,4-dimetil-pentana
e=3-etil-2,3-dimetil-pentana
6. Jawaban: a
a. CH
2
CH
2
CH
2
CHCH
2
CH
2
CH
3
ll
CH
3
CH
3
4-metil-oktana
b. CH
3
CH
2
CH
2
CHCHCH
2
CH
3
ll
CH
3
CH
2
CH
3
4-etil-3-metil-heptana
c. CH
3
CH
2
CHCHCH
2
CH
3
l l
CH
3
CH
2
CH
2
CH
3
3,4-dietil-heksana(sesuaiaturan)
CH
3
l
d. CH
3
CH
2
CCH
2
CH
2
CHCH
3
ll
CH
3
CH
3
2,5,5-trimetil-heptana
e. CH
2
CH
2
CHCH
2
CH
2
CH
3
ll
CH
3
CH
3
4-metil-heptana
7. Jawaban: a
Titikdidihsenyawahidrokarbonberbandinglurus
denganmassamolekulrelatifnya.Semakinbesar
M
r
senyawa,titikdidihsemakintinggi.Padajumlah
M
r
sama,senyawaberantailuruslebihtinggititik
didihnya dibanding senyawa dengan banyak
cabang.
47 Kimia Kelas X
Rumusstruktursenyawa-senyawadekana,oktana,
2-metil-heptana,2,3-dimetil-pentana,dan2,2,3,3-
tetrametil-butanasebagaiberikut.
2,3-dimetil-heksana:
CH
3
|
CH
3
CHCHCH
2
CH
2
CH
3
(C
8
H
18
)
|
CH
3
2,3,4-trimetil-pentana:
CH
3
CH
3
| |
CH
3
CHCHCHCH
3
(C
8
H
18
)
|
CH
3
2,2,3,4-tetrametil-butana:
CH
3
CH
3
| |
CH
3
CCHCH
2
(C
8
H
18
)
| |
CH
3
CH
3
(Penamaantersebutsalah.Namayangbenaruntuk
senyawatersebutadalah2,2,3-trimetil-pentana.)
Jadi,senyawayangbukanisomeroktanaadalah
2,2-dimetil-pentana.
11. Jawaban: b
n-heksana(C
6
H
14
):
CH
3
CH
2
CH
2
CH
2
CH
2
CH
3
2,2-dimetil-butana(C
6
H
14
):
CH
3
|
CH
3
CCH
2
CH
3
|
CH
3
Keduanyamemilikirumuskimiayangsama(C
6
H
14
)
tetapirumusstrukturnyaberbeda.
Sementara itu, pilihan a, c, d, dan e bukan
pasanganisomerkarenarumuskimiaantarakedua
senyawapadapasangantersebutberbeda.
Pilihana
n-butana:CH
3
CH
2
CH
2
CH
3
(C
4
H
10
)
beda
1-butena:CH
2
=CHCH
2
CH
3
(C
4
H
8
)
Pilihanc
2-metil-propana:CH
3
CHCH
3
(C
4
H
10
)
|
CH
3

2-metil-propena:H
2
C=CCH
3
(C
4
H
8
)
beda
|
CH
3
Pilihand
2,3-dimetil-pentana:
CH
3
CHCHCH
2
CH
3
(C
7
H
16
)
||
CH
3
CH
3
3-metil-pentana: beda
CH
3
CH
2
CHCH
2
CH
3
(C
6
H
14
)
|
CH
3

dekana:
CH
3
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
3
oktana:
CH
3
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
3
2-metil-heptana:
CH
3
CHCH
2
CH
2
CH
2
CH
2
CH
3
|
CH
3
2,3-dimetil-pentana:
CH
3
|
CH
3
CHCHCH
2
CH
3
|
CH
3
2,2,3,3-tetrametil-butana:
CH
3
CH
3
| |
CH
3
CCCH
3
| |
CH
3
CH
3
Jadi, senyawa yang titik didihnya paling tinggi
adalahdekana.
8. Jawaban: c
CH
3
|
CH
3
CH
2
CHCH
2
CH
2
CCH
3
| |
CH
2
CH
3
|
CH
3
Pada rumus struktur di atas terdapat lima atom
karbonprimer,empatatomkarbonsekunder,satu
atom karbon tersier, dan satu atom karbon
kuartener.
9. Jawaban: c
Senyawaalkunamengandungikatanrangkaptiga
seperti pada struktur c. Sementara itu, struktur
pada a dan d merupakan alkana karena rantai
karbonnyaberikatantunggal,sedangkanstruktur
pada b dan e merupakan alkena karena rantai
karbonnyaberikatanrangkapdua.
10. Jawaban: b
Oktana adalah senyawa hidrokarbon golongan
alkana, dengan rumus molekul C
8
H
18
. Isomer-
isomer oktana juga mempunyai rumus molekul
C
8
H
18
.
2-metil-heptana:
CH
3
CHCH
2
CH
2
CH
2
CH
2
CH
3
(C
8
H
18
)
|
CH
3
2,2-dimetil-pentana:
CH
3
|
CH
3
CCH
2
CH
2
CH
3
(C
7
H
16
)
|
CH
3
48 Kunci Jawaban dan Pembahasan
Pilihane
4-metil-2-pentuna:
CH
3
CCCHCH
3
(C
6
H
10
)
|
CH
3
4-metil-2-pentena: beda
CH
3
CH=CHCHCH
3
(C
6
H
12
)
|
CH
3
12. Jawaban: d
1) 2,2-dimetil-butana:
CH
3
CHCHCH
3
(salah)
| |
CH
3
CH
3
seharusnya:
CH
3
|
CH
3
CCH
2
CH
3
|
CH
3
2) 3-etil-2-metil-pentana:
CH
3
CHCHCH
2
CH
3
(benar)
| |
CH
3
CH
2
CH
3
3) 2-metil-3-butena:
CH
3
CHCH=CH
3
(salah)
|
CH
3
seharusnya:3-metil-1-butena
4) 5-etil-4-metil-2-heptena:
CH
3
CH
2
CHCH
2
CH
3
(benar)
|
CHCH

=CHCH
3
|
CH
3
5) 3-metil-2-heksuna:
CH
3
CCCHCH
2
CH
3
(salah)
|
CH
3
seharusnya: 4-metil-2-heksuna (metil tidak
mungkin terikat pada atom C nomor 2 dan
3karenakeduaatomtersebuttelahmemiliki
4garis).
13. Jawaban: d
Sifat-sifatkimiaalkenayaitupembakaranalkena
menghasilkangasCO
2
danH
2
O,dapatdioksidasi
oleh KMnO
4
menghasilkan glikol, mampu
membentukmolekuldenganrantaiyangsangat
panjang,dandayareaktivitasalkenalebihbesar
daripadaalkana.Sementaraitu,titiklelehalkena
berbanding lurus dengan massa rumus alkena
merupakansifatfisikaalkena.
14. Jawaban: e
CH
3
|
H
3
CCCH=CHCH
3
|
CH
2
CH
3
Rantai terpanjang mengandung enam atom C,
dengan satu ikatan rangkap dua pada atom C
nomor 2. Dua gugus metil terikat pada atom C
nomor 4 sehingga nama senyawa tersebut 4,4-
dimetil-2-heksena.Sementaraitu,rumusstruktur
untuk:
2-metil-2-etil-3-pentena:
CH
3
|
CH
3
CH=CHCCH
3
|
CH
2
CH
3
(Penamaan tersebut salah, yang benar adalah
4,4-dimetil-2-heksena.)
2,2-dimetil-4-heksena:
CH
3
|
CH
3
CCHCH=CHCH
3
|
CH
2
(Penamaan tersebut salah, yang benar adalah
5,5-dimetil-2-heptena.)
4-metil-4-etil-2-pentena:
CH
3
|
CH
3
CH=CHCCH
3
|
CH
2
CH
3
(Penamaan tersebut salah, yang benar adalah
4,4-dimetil-2-heksena.)
4-metil-4-metil-2-heksena:
CH
3
|
CH
3
CH
2
CCH=CHCH
3
|
CH
2
(Penamaan tersebut salah, yang benar adalah
4,4-dimetil-2-heksena.)
15. Jawaban: b
Isomergeometriadalahisomerruangyangdimiliki
olehalkena.IsomergeometriterjadijikaatomC
yang berikatan rangkap mengikat gugus-gugus
yangberbeda.Jikagugusyangsamadiikatdalam
satu ruang disebut isomer cis, jika gugus yang
samadiikatdalamruangberseberangandisebut
isomertrans.

49 Kimia Kelas X
CH
3
Cl
GC=CH bukanisomergeometri
Cl H
H CH
3
GC=CH isomergeometri(trans)
CH
3
H
H CH
3
GC=CH bukanisomergeometri
H CH
3
CH
3
Cl
GC=CH bukanisomergeometri
Cl H
H CH
3
GC=CH bukanisomergeometri
C
2
H
5
C
2
H
5
16. Jawaban: c
Senyawahidrokarbonyangsedikitlarutdalamair
adalahalkenadanalkuna.Senyawa3-metil-1-pentena
merupakanalkena.Jadi,senyawatersebutsedikit
larutdalamair.Sementaraitu,n-oktana,3-metil-
pentana, 2,2-dimetil-pentana, dan 4-etil-2-metil-
oktanamerupakanalkana.Alkanatidaklarutdalam
airtetapilarutdalampelarutnonpolar.
17. Jawaban: a
Alkena dapat dibuat dengan beberapa reaksi
sepertireaksidehidrogenasi,dehidrohalogenasi,
dehidrasi,daneliminasialkana.Reaksidehidro-
genasiditunjukkanolehreaksia,reaksidehidro-
halogenasiditunjukkanolehreaksib,danreaksi
dehidrasiditunjukkanolehreaksic.Sementaraitu,
reaksiddanemerupakanreaksipembuatanalkana.
18. Jawaban: a
Gasmetanadibuatdenganmereaksikanaluminium
karbidadenganair.Reaksiyangterjadi:
Al
4
C
3
+12H
2
O3CH
4
+4Al(OH)
3
SintesisWurtzdigunakanuntukmembuatalkana
darialkilhalidadenganmereaksikanalkilhalida
tersebutdenganlogamNa.
3CH
3
Cl+2NaCH
3
CH
3
+2NaCl
Sintesis Grignard digunakan untuk memperoleh
alkanadarireaksisenyawaGrignarddenganair.
CH
3
MgBr+H
2
OCH
4
+MgOHBr
SintesisDumasdigunakanuntukmembuatalkana
dengan memanaskan campuran garam natrium
karboksilatdenganNaOH.

B
O
CH
3
C+NaOHCH
4
+Na
2
CO
3

Na
19. Jawaban: b
Alkuna dapat dibuat dengan cara memanaskan
campurandihaloalkanadenganKOHmelaluireaksi
berikut.
CH
3
CHCHCH
3
(aq)+2KOH(aq)
| |
Br Br
2,3-dibromo-butana(dihaloalkana)
CH
3
CCCH
3
(g)+2KBr(aq)+2H
2
O()
2-butuna
20. Jawaban: e
M
r
propuna(C
3
H
4
)=40g/mol
molpropuna=
4 g
40 g/mol
=
1
10
mol
Jumlahmolekulpropuna
=molNA
=
1
10
6,0210
23
molekul
Jadi, jumlah molekul pada 4 gram propuna
sebanyak
1
10
6,0210
23
molekul.
B. Uraian
1. a. 2,3,3,5-tetrametil-heksana
b. 2,3-dimetil-1-pentena
c. 3,6,6-trimetil-3-etil-6-propil-4-nonuna
2. a. CH
3
CH
2
CH
2
CHCH
2
CH
2
CH
3
|
CHCH
3
|
CH
3
b. CH
3
CH=C=CHCH
3
c. CH
3
CHC=CH
2
| |
CH
3
CH

=CH
2
3. Senyawa-senyawaalkanadapatdiperolehdengan
cara-caraberikut.
a. Merekasikanaluminiumkarbidadenganair.
Reaksiyangterjadi:
Al
4
C
3
(s) + 12H
2
O() 3CH
4
(g) + 4Al(OH)
3
(aq)
b. Mereaksikan senyawa alkena dengan gas
hidrogen.
Reaksiyangterjadi:
C
n
H
2n
(g)+H
2
(g)C
n
H
2n+2
c. MelaluisintesisDumas,yaitumemanaskan
campurangaramnatriumkarboksilatdengan
basakuat.
Reaksiyangterjadisebagaiberikut.
B
O
C
3
H
7
C (aq) +NaOH(aq) C
3
H
8
(g)+Na
2
CO
3
(aq)
V
Na
50 Kunci Jawaban dan Pembahasan
Alkana yang dihasilkan tergantung garam
natriumkarboksilatyangdireaksikan.
d. MelaluisintesisGrignard,yaitumereaksikan
suatualkilmagnesiumhalidadenganair.
Reaksiyangterjadi
C
2
H
5
MgBr(aq) + H
2
O() C
2
H
6
(g) + MgOHBr(aq)
e. Melalui sintesis Wurtz, yaitu dengan cara
mereaksikanalkilhalida(haloalkana)dengan
logamnatrium.
Reaksiyangterjadisebagaiberikut.
2CH
3
Cl(aq) + 2Na(s) CH
3
CH
3
(g) + 2NaCl(aq)
4. Reaksi dehidrogenasi merupakan reaksi peng-
hilanganhidrogenpadaalkanayangdipanaskan
dengansuhu500C.ProsesinidiberikatalisCr
2
O
3
atauAl
2
O
3
untukmempercepatreaksi:
Contoh:

Al
2
O
3
CH
3
CH
2
CH
2
CH
3
(g)

n-butana

CH
3
CH=CHCH
3
(g)+H
2
(g)
2-butena
Senyawan-butanakehilanganduaatomhidrogen
membentuk2-butena.
Reaksi dehidrohalogenasi merupakan reaksi
penghilangansatuatomhalogendansatuatom
hidrogenpadasenyawamonohaloalkanadengan
KOHdalametanol.
Contoh:
alkohol
CH
3
CHCH
3
(aq)+KOH(aq)CH
3
CH=CH
2
(g)
|propena
Cl + KCl(s) + H
2
O()
2-kloro-propana (monohaloalkana)
Senyawa2-kloro-propanakehilanganatomCldan
atomHmembentukpropena.
Reaksidehidrasimerupakanreaksipenghilangan
airpadaalkoholdenganH
2
SO
4
pekat.Reaksiini
dilakukan pada suhu 170180C. H
2
SO
4
pekat
akanmenarikatomHdangugusOHdarialkohol.
Contoh:
H
2
SO
4
CH
3
CH
2
OHCH
2
=CH
2
+H
2
O

etanol

etena
SenyawaetanolkehilangansatuatomHdangugus
OHmembentuketena.
5. 1) CH
2
=CHCH
2
CH
2
CH
2
CH
3
:1-heksena
2) CH
3
CH=CHCH
2
CH
2
CH
3
:2-heksena
3) CH
3
CH
2
CH=CHCH
2
CH
3
:3-heksena
4) CH
2
=CCH
2
CH
2
CH
3
:2-metil-1-pentena
|
CH
3
5) CH
2
=CHCHCH
2
CH
3
:3-metil-1-pentena
|
CH
3
6) CH
2
=CHCH
2
CHCH
3
:4-metil-1-pentena
|
CH
3
7) CH
2
=CCHCH
3
:2,3-dimetil-1-butena
| |
CH
3
CH
3
CH
3
|
8) CH
2
=CHCCH
3
:3,3-dimetil-1-butena
|
CH
3
9) CH
2
=CCH
2
CH
3
:2-etil-1-butena
|
CH
2
CH
3
10) CH
3
C=CHCH
2
CH
3
:2-metil-2-pentena
|
CH
3
CH
3
|
11) CH
3
CH=CCH
2
CH
3
:3-metil-2-pentena
12) CH
3
CH=CHCHCH
3
:4-metil-2-pentena
|
CH
3
13) CH
3
C=CCH
3
:2,3-dimetil-2-butena
| |
CH
3
CH
3
14)
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
:sikloheksana
A. Pilihan Ganda
1. Jawaban: c
Metanamerupakansenyawahidrokarbondengan
satuatomkarbon.Sementaraitu,senyawaalkena
paling sederhana adalah etena, yaitu senyawa
hidrokarbonyangterdiriatasduaatomkarbondan
berikatanrangkapdua.Adisialkenamenghasilkan
etana. Dengan demikian, senyawa alkana yang
tidakdapatdihasilkandarireaksiadisialkenadalah
metanakarenametanahanyaterdiridarisatuatom
karbon.
2. Jawaban: a
Reaksiyangterjadisebagaiberikut.
CH
3
CH=CHCH
3
+HClCH
3
CHCH
2
CH
3
|
Cl
2-butena 2-klorobutana
PadareaksidiatasterjadipenambahanatomCl
pada ikatan rangkap kemudian ikatan rangkap
berubahmenjadiikatantunggal.Dengandemikian,
reaksitersebutmerupakanreaksiadisi.
3. Jawaban: b
Reaksi 1) merupakan reaksi substitusi karena
terjadi penukaran gugus OH dengan atom Cl.
Sementaraitu,reaksi2)merupakanreaksiadisi
51 Kimia Kelas X
karenapadareaksitersebutterjadiperubahanikatan
dariikatanrangkapduamenjadiikatantunggal.
4. Jawaban: c
MenurutaturanMarkovnikoff,atomHdariasam
halida(HCl)akanterikatpadaatomCberikatan
rangkapyangmengikatatomHlebihbanyak(atom
C nomor 3 pada senyawa 2-metil-2-butena).
Dengandemikian,atomCldariHClakanterikat
padaatomCnomor2padasenyawa2-metil-2-
butena.Reaksidiatasmerupakanreaksiadisiyang
menggantiikatanrangkapmenjadiikatantunggal.
Cl
|
CH
3
C=CHCH
3
+HClCH
3
CCH
2
CH
3
| |
CH
3
CH
3
2-metil-2-butena 2-kloro-2-metil-butana
5. Jawaban: d
Reaksi substitusi adalah reaksi penggantian
(penukaran)suatugugusatomolehgugusatom
lain. Pada reaksi tersebut satu atom H pada
propanadigantiolehsatuatomBrdariBr
2
sehingga
menghasilkanpropilbromidadanasambromida.
CH
3
CH
2
CH
3
+Br
2
CH
3
CH
2
CH
2
Br+HBr
6. Jawaban: b
Senyawahidrokarbonyangmengalamireaksiadisi
adalahsenyawayangmemilikiikatanrangkap,baik
ikatanrangkapdua(alkena)ataupunrangkaptiga
(alkuna).
Senyawa2-metil-4-heksena;2,3-pentadiena;dan
2-heksena adalah senyawa alkena sehingga
ketiganya dapat diadisi. 3-pentuna merupakan
senyawaalkunasehinggasenyawainijugadapat
diadisi.Sementaraitu,2-metilpentanamerupakan
senyawa alkana sehingga tidak dapat diadisi
karena tidak mempunyai ikatan rangkap dalam
rantaikarbonnya.
7. Jawaban: c
Reaksiadisiyangterjadi:
CH
3
CH=CH
2
+HBrCH
3
CHCH
3
|
Br
2-bromo propana
Jadi,hasiladisidaripropenadenganHBrberupa
2-bromopropana.
8. Jawaban: c
CH
3
CHCH
3
CH
3
CH=CH
2
+HBr
l
Br
2-bromo-propanapropena asam
bromida
9. Jawaban: a
Reaksi tersebut merupakan reaksi adisi. Pada
reaksi ini terjadi perubahan ikatan rangkap dua
menjadiikatantunggal.Apabilahasilreaksiberupa
butana, zat X yang bereaksi merupakan ikatan
rangkapdua(butena).Dengandemikian,reaksi
yangterjadisebagaiberikut.
H
2
/Ni
CH
3
CH
2
CH=CH
2
CH
3
CH
2
CH
2
CH
3
1-butenabutana
10. Jawaban: e
Reaksi1)merupakanreaksieliminasikarenaterjadi
perubahan ikatan, dari ikatan tunggal menjadi
ikatanrangkap.
Reaksi2)merupakanreaksisubstitusikarenaterjadi
penggantiangugusatomHpadapropanoldengan
gugusatomNadisertaipelepasangasH
2
.
B. Uraian
1. a. Reaksiadisikarenaterjadipergantianikatan
dariikatanrangkapduaketunggal.
b. Reaksi substitusi karena terjadi pergantian
gugusatomHdenganatomCl.
c. Reaksiadisikarenaterjadipergantianikatan
dariikatanrangkaptigamenjadiikatanrangkap
dua.
d. Reaksieliminasikarenaterjadipenghilangan
gugusBrdarisenyawapropanadanterjadi
perubahanikatandariikatantunggalmenjadi
ikatanrangkapdua.
2. a. CH
2
=CHCH=CHCH
3
+H
2
CH
3
CH
2
CH
2
CH
2
CH
3
1,3-pentadiena pentana
b. CH
3
CH
2
CH
3
+Cl
2
CH
3
CH
2
CH
2
Cl+HCl
propana propi l kl ori da
c. CH
2
=CHCH
2
CH
3
+6O
2
4CO
2
+4H
2
O
n-butena
3. Reaksieliminasidehidrohalogenasiadalahreaksi
eliminasiyangterjadipadasenyawaalkilhalida
denganmelepaskanunsurHdanhalogendarialkil
halidanyamembentuksenyawaalkena,air,dan
garamhalogen.
Contoh:
H H H
| | |
HCCCBr+KOH
| | |
H H H
H
|
HCC=CH+KBr+H
2
O
| | |
H H H
Alkena
propil bromida
asam
bromida
52 Kunci Jawaban dan Pembahasan
4. a. SenyawaP:CH
3
CH=CHCH
3
2-butena
SenyawaQ:CH
3
CH
2
CH
2
CH
3
butana
PersamaanreaksipadaprosesI:
H
2
/Ni
CH
3
CH=CHCH
3
CH
3
CH
2
CH
2
CH
3
2-butenabutana
b. ProsesIIterjadireaksiadisi
CH
3
CH=CHCH
3
+Br
2
CH
3
CHCHCH
3

2-butena
| |
Br Br
2,3-dibromo-butana
ProsesIIIterjadireaksisubstitusi
CH
3
CH
2
CH
2
CH
3
+Br
2
CH
3
CH
2
CH
2
CH
2
Br+HBr
butana 1-bromo-butana
c. SenyawaR:CH
3
CHCHCH
3
| |
Br Br
2,3-dibromo-butana
SenyawaS:CH
3
CH
2
CH
2
CH
2
Br
1-bromo-butana
5. Persamaanreaksi:
2C
2
H
6
+7O
2
4CO
2
+6H
2
O
Perbandingankoefisien=perbandinganmol.
Jumlahgasetanayangdibakar=5L
Jumlah volume oksigen yang diperlukan pada
pembakaran
=
Koefisien oksigen
Koefisien etana
volumeetana
=
7
2
5=17,5L
Jadi, volume oksigen yang diperlukan pada
pembakarantersebutsebesar17,5L.
A. Pilihan Ganda
1. Jawaban: d
Karbohidrattersusunatasunsurkarbon,hidrogen,
danoksigen.Olehkarenaitu,karbohidratdisebut
sebagaisenyawakarbon.
2. Jawaban: e
Fungsikarbohidratyaitusebagaisumberenergi
bagi tubuh, membantu penghematan protein,
mengatur metabolisme lemak, dan membantu
mengeluarkanfeses.Sementaraitu,memelihara
sel-sel tubuh dan cadangan energi merupakan
fungsiprotein.
3. Jawaban: b
Fungsilemakdalamtubuhdiantaranyasebagai
pengangkutvitaminyanglarutdalamlemakdan
pelindung organ-organ tubuh bagian dalam.
Sementaraitu,senyawayangmemberikanrasa
manis pada makanan adalah fungsi dari karbo-
hidrat.Pelarutpewarnamakananmenggunakan
propilenaglikol,sedangkanuntukmempercepat
proses pematangan buah menggunakan gas
asetilena.
4. Jawaban: d
Kayu merupakan senyawa karbon karena
mengandungselulosa,lignin,danhemiselulosa.
Sementara itu, protein dan lemak merupakan
senyawakarbonyangterdapatdidalammakanan.
Parafinmerupakansenyawakarbonyangdiguna-
kandibidangsenidanestetika.Propilenamerupa-
kansenyawakarbonyangbanyakdigunakandi
bidangpapan.
5. Jawaban: d
Seratalam:wol,kapas,yute,dankenaf.
Seratbuatan:rayon,poliester,krilik,dannilon.
Sutra merupakan bahan alam bukan termasuk
seratalam.
6. Jawaban: e
Plastikseringdigunakansebagaipenggantikayu
karenahargaplastiklebihmurahdaripadakayu.
Plastikdapatdiproduksidalamjumlahsangatbanyak
melaluireaksipolimerisasi.Sementaraitu,kayu
merupakan hasil alam yang memerlukan waktu
lamauntukmemperolehnya.Olehsebabitu,sebagian
besarpenggunaankayudigantikanolehplastik.
7. Jawaban: d
Polipropilenamerupakanpolimeryangberasaldari
propena.
CH=CH
2
CHCH
2

| |
CH
3
CH
3 n
propena polipropilenaataupolipropena
(monomer) (polimer)
Polipropilenamerupakanbahandasarpenyusun
plastik.Plastikmemilikibanyakfungsidiantaranya
sebagaibahaninteriorrumah.
8. Jawaban: c
Protein terdapat pada makanan. Protein sangat
diperlukan bagi tubuh untuk pertumbuhan dan
pemeliharaansel-sel.
9. Jawaban: c
Senyawa hidrokarbon yang digunakan sebagai
pelarut cat merupakan campuran dari parafin,
sikloparafin,danhidrokarbonaromatik.
10. Jawaban: a
Catinteriormerupakanbagiandaridesaininterior
(bidang seni). Cat ini mengandung unsur-unsur
pembentuksenyawakarbon.






53 Kimia Kelas X
B. Uraian
1. Karbohidrat digolongkan sebagai senyawa
hidrokarbonkarenadiperolehdarihasilfotosintesis
tumbuhanhijau.Karbohidratyangdihasilkandari
proses ini berupa glukosa dengan rumus kimia
C
6
H
12
O
6
.Olehkarenakarbohidrattersusunatas
unsurC,H,danOmakakarbohidratdigolongkan
sebagaisenyawahidrokarbon.
2. a. Proteindisebutpolimerkarenaterbentukmelalui
reaksipolimerisasidarimonomerasamamino
(RCH(NH
2
)COOH).
b. Kegunaanproteinsebagaiberikut.
1) Membantupertumbuhandanpemelihara-
ansel-seltubuh.
2) Membantu perubahan proses biokimia
dalamtubuh.
3) Mengaturkeseimbanganairdalamtubuh.
4) Membantu keseimbangan tubuh, pem-
bentukanantibodi,mengangkutzat-zat
gizi,dansebagaisumbercadanganenergi.
3. Propilena glikol dihasilkan dari reaksi hidrolisis
propilenaoksida.Propilenaoksidadiperolehdari
oksidasi propilena. Reaksi pembentukannya
sebagaiberikut.
2C
3
H
6
(g)+O
2
(g) 2C
3
H
6
O()
C
3
H
6
O()+H
2
O() HOCH
2
CH
2
CH
2
OH()
4. Gasasetilendiindustrimakanandimanfaatkan
untukmembantumempercepatprosespematang-
anbuah.
5. Kayumengandungsenyawakarbonberupalignin,
selulosa, dan hemiselulosa. Unsur karbon,
hidrogen, dan oksigen terkandung di dalam
senyawa-senyawa tersebut. Plastik merupakan
polimerdaripropilenayangmempunyaiatomC
3
.
Plastikmengandungsenyawahidrokarbonyang
terdiriatasunsurkarbondanhidrogen.
A. Pilihan Ganda
1. Jawaban: d
Senyawaorganikmengandungunsurkarbon(C).
Sementaraitu,unsurS,N,P,danKterdapatdalam
senyawaanorganik.
2. Jawaban: e
Asamkloridatersusunatasunsurhidrogendanklor
sehinggaasamkloridabukantermasuksenyawa
organik.Senyawaorganikmengandungunsurkarbon
seperti pada senyawa urea (CO(NH
2
)
2
), metana
(CH
4
),dansukrosa(C
12
H
22
O
11
).
3. Jawaban: c
Atomkarbonmempunyaiempatelektronvalensi.
Kondisi ini tidak dimiliki oleh atom unsur lain
sehinggaatomkarbonmampumembentukrantai
yangsangatpanjang.Caranyadenganmengikat
atomkarbonlainataudenganatomlain.
4. Jawaban: b
Senyawakarbonalisiklikadalahsenyawakarbon
berantaimelingkar/tertutupdenganikatantunggal/
jenuhseperti
Sementara itu, senyawa karbon alifatik adalah
senyawa karbon yang memiliki rantai karbon
terbuka.Senyawakarbonaromatikadalahsenyawa
karbosiklikyangterdiriatasenamataulebihatom
karbondenganikatanrangkapyangterletakber-
selangseling.Senyawakarbonheterosiklikadalah
senyawa karbon yang dalam rantai lingkarnya
terdapatatomlainselainatomkarbon.Senyawa
karbontidakjenuhadalahsenyawakarbonyang
mengandungikatanrangkap.
5. Jawaban: a
AtomCsekunderadalahatomCyangmengikat
duaatomClain.AtominiterdapatpadaatomC
bernomor10.Sementaraitu,atomCbernomor8,
5,dan2adalahatomCtersier,sedangkanatomC
bernomor1adalahatomCprimer.
6. Jawaban: d
CH
3
C
2
H
5
CH
3
| | |
CH
3
CCHCHCHCH
3
| |
CH
3
CH
3
Rantaiindukpadastrukturdiatasterdiriatasenam
atomkarbon(heksana),mengikatduagugusmetil
di atom C nomor 2, satu gugus etil di atom C
nomor3,satugugusmetildiatomCnomor4,dan
satu gugus metil di atom C nomor 5. Dengan
demikian nama IUPAC untuk senyawa tersebut
3-etil-2,2,4,5-tetrametil-heksana.
7. Jawaban: d
Padasuku-sukuhomologtersebutjumlahatomC
sebanyakn,sedangkanjumlahatomHsebanyak
(2 n) + 1. Dengan demikian, rumus umum
homologtersebutC
n
H
2n+1
.C
n
H
2n+1
merupakan
alkil.
H
2
C
H
2
C CH
2
| |
H
2
C CH
2
C
H
2
1 2 3 4 5 6
54 Kunci Jawaban dan Pembahasan
8. Jawaban: a
Titikdidihsenyawakarbonberbandinglurusdengan
M
r
danbentukrantaikarbonnya.Untuksenyawa
hidrokarbon dengan M
r
sama, senyawa yang
berantaikarbonlurusmempunyaititikdidihlebih
tinggidaripadasenyawabercabang.
isobutana: CH
3
CHCH
3
(C
4
H
10
)
|
CH
3
n-pentana: CH
3
CH
2
CH
2
CH
2
CH
3
(C
5
H
12
)
n-pentuna: CH
3
CH
2
CH
2
CCH (C
5
H
8
)
n-heksana: CH
3
CH
2
CH
2
CH
2
CH
2
CH
3
(C
6
H
14
)
isopentana:CH
3
CHCH
2
CH
3
(C
5
H
12
)
|
CH
3
Senyawa isobutana mempunyai M
r
terkecil dan
berantai cabang. Oleh karena itu, isobutana
mempunyaititikdidihpalingrendah.
9. Jawaban: c
2-metil-butana:
CH
3
CHCH
2
CH
3
(sesuaiIUPAC)
|
CH
3
2-metil-propana:
CH
3
CHCH
3
(sesuaiIUPAC)
|
CH
3
3-metil-butana:
CH
3
CH
2
CHCH
3
(tidaksesuaiIUPAC.
| Penamaanyangbenar
CH
3
2-metil-butana)
3-metil-pentana:
CH
3
CH
2
CHCH
2
CH
3
(sesuaiIUPAC)
|
CH
3
3-metil-heksana:
CH
3
CH
2
CHCH
2
CH
2
CH
3
|
(sesuaiIUPAC)
CH
3
Jadi,senyawayangtidaksesuaidengantatanama
IUPACadalah3-metil-butana.
10. Jawaban: a
Isomerstrukturmerupakansenyawayangmemiliki
rumusstrukturberbeda,tetapirumusmolekulnya
sama.
CH
3
l
CH
3
CHCH
2
CHCH
3
memilikirumus
l molekulC
9
H
20
CH
3
CHCH
3
CH
3
CH
2
CH
2
CHCH
2
CH
2
CH
2
CH
3
|
CH
3
SenyawadiatasjugamemilikirumusmolekulC
9
H
20
.
Jadi,keduasenyawatersebutberisomerstruktur.
Sementaritu,
CH
3
CCCH
3
(C
4
H
6
)
CH
2
=CHCH
2
CH
3
(C
4
H
8
)
bukanisomer
CH
3
CHCH
3
(C
4
H
10
)
|
CH
3
CH
2
=CCH
3
(C
4
H
8
)
bukanisomer
|
CH
3
CH
2
=CH
2
(C
2
H
4
)
CH
3
CH
3
(C
2
H
6
)
bukan isomer
CH
2
=CHCH=CH
3
(C
4
H
7
)
bukanisomer
CHCCH
3
(C
3
H
4
)
11. Jawaban: b
Rumusstrukturisoheksana:
CH
3
CHCH
2
CH
2
CH
3
|
CH
3
Rumusmolekulisoheksana:C
6
H
14
Isomer-isomer isoheksana mempunyai rumus
molekulC
6
H
14
.
heksana:
CH
3
CH
2
CH
2
CH
2
CH
2
CH
3
(C
6
H
14
)
isopentana:
CH
3
CHCH
2
CH
3
(C
5
H
12
)
|
CH
3
3-metil-pentana:
CH
3
CH
2
CHCH
2
CH
3
(C
6
H
14
)
|
CH
3
2,2-dimetil-butana:
CH
3
|
CH
3
CCH
2
CH
3
(C
6
H
14
)
|
CH
3
2,3-dimetilbutana:
CH
3
|
CH
3
CHCHCH
3
(C
6
H
14
)
|
CH
3
Jadi, senyawa yang bukan isomer isoheksana
adalahisopentana.
12. Jawaban: c
CH
3
CH
2
CCCHCH
3
|
H
3
CCHCH
3

7 6
1 2 3 4 5
55 Kimia Kelas X
Rantaiterpanjangterdiriatastujuhatomkarbon,
denganikatanrangkaptigapadaatomCnomor3.
AtomCnomor5dan6mengikatalkilmetil.Dengan
demikian, nama IUPAC senyawa tersebut
5,6-dimetilheptuna.
13. Jawaban: c
Reaksi adisi pada butena oleh asam klorida
sebagaiberikut.
CH
2
=CHCH
2
CH
3
+HClCH
3
CHCH
2
CH
3
|
Cl
Gugus Cl memutuskan ikatan rangkap menjadi
ikatantunggaldanterikatpadaatomCnomor2.
Sementaraitu,atomHterikatpadaatomCnomor1
yaitu atom C berikatan rangkap yang mengikat
atomHlebihbanyak.
14. Jawaban: c
Rumusstruktur:
CH
2
BrCH
2
Br:
H H
| |
HCCH bukanisomergeometri
| |
Br Br
CH
3
CH
2
Br:
H H
| |
HCCBr bukanisomergeometri
| |
H H
CHBrCHBr:
H H
GC=CH isomercis
Br Br
BrCHCHBr:
Br H
GC=CH isomertrans
H Br
C
2
H
5
COH:
H H
| |
HCCCOH bukanisomergeometri
| |
H H
C
2
H
5
CHO:
H H
| |
B
O
HCCC bukanisomergeometri
| | V

H
H H
CHBrCHBr:
H H
GC=CH isomercis
Br Br
CH
2
CHBr:
H H
GC=CH bukanisomergeometri
H Br
C
2
H
5
COOCH
3
:
H H
| |
B
O
HCCC bukanisomergeometri
| | V

O
H H
CH
3
COOC
2
H
5
:
H
|
B
O
HCC bukanisomergeometri
| V

O
H
Jadi,pasangansenyawayangmerupakanisomer
geometriyaituCHBrCHBrdanBrCHCHBr.
15. Jawaban: e
Persamaanreaksipembuatandiklorometanadari
gasmetanadanklorinsebagaiberikut.
CH
4
+Cl
2
CH
3
Cl+HCl
Reaksi tersebut merupakan reaksi substitusi
karenaatomClmenukarsatuatomHpadaCH
4
sedangkan atom Cl yang lain mengikat atom H
yangdilepasCH
4
membentukHCl.
H H
| |
HCH+ClClHCCl+HCl
| |
H H
16. Jawaban: b
H
|
CH
3
CCH=CHCH
3
+HClCH
3
CHCH
2
CHCH
3
| | |
CH
3
CH
3
Cl
2-pentena 2-kloro-4-metil-pentana
Padareaksitersebutmengalamiperubahanikatan
dariikatanrangkapduamenjadiikatantunggal.
Dengandemikianreaksitersebutmerupakanreaksi
adisi.
17. Jawaban: c
Reaksi 1) terjadi penggantian gugus atom
substitusi.
Reaksi 2) terjadi penggantian ikatan tunggal
menjadiikatanrangkapeliminasi.
Reaksi 3) terjadi penggantian ikatan rangkap
menjadiikatantunggaladisi.
18. Jawaban: a
CH
3
C=CHCH
2
CHCH
3
| |
CH
3
CH
3
2,5-dimetil-2-heksena
56 Kunci Jawaban dan Pembahasan
CH
3
CHCH=CHCH
3
|
CH
2
|
CH
3
4-metil-2-heksena
CH
3
CHCH
2
CH
2
CHCH
3
| |
CH
3
CH
3
2,5-dimetil-heksana
CH
3
CCCHCHCH
3
| |
CH
3
CH
3
4,5-dimetil-2-heksuna
CH
3
CHCH
2
CHCH
3
| |
CH
3
CH=CH
2
3,5-dimetil-1-heksena
19. Jawaban: c
H
|
HCH
H H
| |
HCC=CH
|
H
1) Senyawa tersebut memiliki deret homolog
alkena(C
n
H
2n
).
2) NamaIUPAC:2-metil-1-propena.
3) Senyawa tersebut merupakan isomer dari
C
4
H
8
.
4) GugusfungsisenyawatersebutadalahC=C.
20. Jawaban: b
2-butena merupakan hasil reaksi eliminasi dari
2-kloro-butana.Reaksiyangterjadiadalah:

CH
3
ONa
CH
3
CHCH
2
CH
3
CH
3
CH=CHCH
3
+HCl
l
Cl
21. Jawaban: b
Reaksi pada a, c, d, dan e merupakan reaksi
eliminasi karena pada keempat reaksi tersebut
terjadiperubahanikatan,dariikatantunggalmen-
jadi ikatan rangkap. Sementara itu, reaksi b
merupakanreaksisubstitusikarenapadareaksi
tersebut terjadi pergantian atom H dengan
atomNa.
22. Jawaban: b
Fungsiproteindalamtubuhsebagaiberikut.
1) Membantu pertumbuhan dan pemeliharaan
sel-seldalamtubuh.
2) Pembentukanzatantibodi.
3) Mengangkutzat-zatgizi.
4) Cadanganenergi.
Sementara itu, mengatur metabolisme lemak
merupakanfungsikarbohidrat,pelindungtubuhdari
perubahan cuaca, membantu pengeluaran sisa
pencernaan, dan melindungi organ-organ tubuh
bagiandalammerupakanfungsilemak.
23. Jawaban: b
Propilenaglikoldigunakandalamindustrimakanan
sebagai penyedap rasa, pelarut makanan, dan
humektan.Asetilenadanetilenamerupakangas
yangbanyakdigunakanuntukmembantuproses
pematanganbuah.Sukrosamerupakanpemanis
alami, digunakan untuk menambah rasa manis
padaprodukmakanan.Sementaraitu,etilenglikol
digunakansebagaizataditifuntukmenurunkantitik
bekupadaradiatormobil.
24. Jawaban: b
CH
3
CHCH
2
CH
3
|
OH
Senyawa tersebut bernama 2-butanol karena
gugusOHterikatpadaatomCnomor2,sedang-
kanrantaiutamaterdiriatasempatatomkarbon.
CH
2
=CHCH
2
CH
3
Senyawa tersebut bernama 1-butena karena
terdapatikatanrangkapduadiatomCnomor1
danrantaiutamaterdiriatasempatatomkarbon.
25. Jawaban: b
IsomerposisiCH
2
=CHCH
2
CH
3
(1-butena)
yaitu:
CH
3
CH=CHCH
3
2-butena
Jadi,1-butenamempunyaiisomerposisisebanyak2.
26. Jawaban: e
RumusstrukturIsalahkarenaatomCnomor3
mempunyai5ikatankovalen,seharusnyaatomC
hanyamemiliki4ikatankovalen.Rumusstruktur
II memiliki nama yang salah. Nama kimia dari
rumusstrukturIIseharusnya2-pentena.
27. Jawaban: a
H CH
3
CH
3
CH
3
GC=CH GC=CH
CH
3
H HH
trans cis
28. Jawaban: b
Senyawaaromatikmerupakansenyawahidrokarbon
yangterdiriatasenamatomCberstrukturcincin
yang berikatan jenuh dan tidak jenuh secara
berselang-seling.Contohsenyawabenzena.

57 Kimia Kelas X
Benzena: H (aromatik)
C
X Z
HC CH
| ||
HC CH
Z X
C
H
asetilena:CHCH (alifatik)
polipropilena:CH
2
CHCH
2
CH (alifatik)
| |
n
CH
3
CH
3
polietilena:(CH
2
CH
2
CH
2
CH
2
)
n
(alifatik)
siklopentana: CH
2
(alisiklik)
X Z
H
2
C CH
2
| |
H
2
C CH
2
29. Jawaban: c
H
3
C
Z
CHCH
3
X
H
3
CCH
Z
C=CH
2
X
H
3
C
2,3,4-trimetil-1-pentena
30. Jawaban: c
Hidrokarbonjenuhmerupakanhidrokarbonyang
memiliki ikatan jenuh dalam rantai karbonnya.
Syarattersebutdimilikiolehalkana.
RumusumumalkanaC
n
H
2n+2
.
ApabilajumlahH=38maka:
38=2n+2
36=2n
n=18
Dengan demikian, atom C memiliki jumlah
sebanyak18.Hargax=18.
B. Uraian
1. CH
3
|
CH
3
CCH=CHCHCH
3
| |
CH
2
CH
3
CH
3
AtomCnomor1,2,8,9,dan10merupakanatom
CprimerkarenaatomCtersebutmengikatsatu
atomClain.AtomCnomor3merupakanatomC
kuartenerkarenaatomCtersebutmengikatempat
atomClain.AtomCnomor4,5,dan6merupakan
atomCsekunderkarenaatomCtersebutmengikat
duaatomClain.AtomCnomor7merupakanatom
C tersier karena atom C tersebut mengikat tiga
atomClain.
2. Sifat-sifatsenyawaorganiksebagaiberikut.
a. Mudahteruraimeskipunpadasuhurendah.
b. Reaksinyaberjalanlambat.
c. Titikdidihdantitikcairrendahsehinggatidak
tahanpanas.
d. Mudah larut dalam pelarut nonpolar tetapi
sukarlarutdalampelarutpolar.
e. JikadibakarmenghasilkangasCO
2
,karbon,
danuapair.
3. Titik-titikairyangmenempelpadadindingtabung
reaksihasilpembakaransenyawaorganikmampu
mengubahwarnakertaskobalt(II)daribirumenjadi
merahmuda.Peristiwainimenunjukkanbahwatitik-
titikairtersebutadalahair.Air(H
2
O)mengubah
warna kertas kobalt(II) dari biru menjadi merah
muda.Kesimpulanpercobaaniniadalahpembakaran
senyawaorganikmenghasilkanair.
4. a. 5-etil-2,2,4,6,6-pentametil-oktana
b. 3,3-dimetil-1,4-pentadiuna
c. 2,5,7-trimetil-1,3,6-oktatriena
5.
CH
3
|
a.
3
C
4
C
5
CH
2

6
CH
2

7
C
8
CH
3
| |
2
CH
2
CH
3
|
1
CH
3
NamaIUPAC:7,7-dimetil-3-oktuna
CH
3
|
b. CH
3
CHCH
2
CH
2
CCCH
| |
CH
3
CH
3
NamaIUPAC:3,3,6-trimetil-1-heptuna
c. CH
3
C=CH

CH

=CH
2
|
CH
3
NamaIUPAC:4-metil-1,3-pentadiena
d. CH
2
CH

=CH
2
|
CH=CH
2
NamaIUPAC:1,4-pentadiena
6. Alkadienamerupakansenyawahidrokarbonyang
dalamrantaiikatannyamengandungduaikatan
rangkapdua,contohCH
2
=CHHC=CH
2
(1,3-
butadiena).
Alkuna merupakan senyawa hidrokarbon yang
dalamrantaiikatannyamengandungikatanrangkap
tiga,contohCHCCH
2
CH
3
(butuna).



X
Z
2
1 3 5 6 7 9
4 8
10
3 4 5
2 1
58 Kunci Jawaban dan Pembahasan
7. a. Padareaksi
CH
3
CH=CH
2
+HBrCH
3
CHBrCH
3
terjadi perubahan ikatan rangkap menjadi
ikatan tunggal sehingga reaksi tersebut
merupakanreaksiadisi.
b. Padareaksi
CH
3
CH
2
CH
2
Br + C
2
H
5
ONa NaBr
+CH
3
CH
2
CH
2
OCH
2
CH
3
terjadipertukarangugusBrdengangugus
OCH
2
CH
3
. Dengan demikian, reaksi
tersebutmerupakanreaksisubstitusi.
c. Padareaksi
CH
3
CHBrCH
3
+NaOHNaBr+H
2
O
+CH
2
CH=CH
2
terjadi penghilangan atom H dan Br pada
senyawaCH
3
CHBrCH
3
sehinggareaksiini
merupakanreaksieliminasi.
8. 1) CH
3
CH
2
CH
2
CH
2
CH
2
CH
3
:n-heksana
2) CH
3
CHCH
2
CH
2
CH
3
:2-metil-pentana
|
CH
3
3) CH
3
CH
2
CHCH
2
CH
3
:3-metil-pentana
|
CH
3
4) CH
3
CHCHCH
3
:2,3-dimetil-butana
| |
CH
3
CH
3
5) CH
3
|
CH
3
CCH
2
CH
3
:2,2-dimetil-butana
|
CH
3
9. massasenyawahidrokarbon=4,2kg=4.200gram
volumeruang=0,672m
3
=672L
molsenyawa=
672L
22,4 L
=30mol
M
r
senyawa=
4.200 g
30 mol
=140
M
r
=C
n
H
2n
140=C
n
H
2n
140=(nA
r
C)+(2nA
r
H)
=12n+2n
140=14n
n =10
SenyawahidrokarbonC
n
H
2n
dengann=10maka
jumlahatomCsenyawatersebut=10danH=20.
Jadisenyawatersebutadalahdekena,termasuk
golonganalkena.
10. a. Rumusempiris=CH
2
M
r
senyawa=70
(Rumusempiris)
n
=rumusmolekul=M
r
(CH
2
)
n
=70
12n+2n =70
14n =70
n =5
(CH
2
)
n
=(CH
2
)
5
=C
5
H
10
(pentena)
b. Isomer-isomerpentena
CH
2
=CHCH
2
CH
2
CH
3
1-pentena
CH
3
CH=CHCH
2
CH
3
2-pentena
CH
2
=CCH
2
CH
3
2-metil-1-butena
|
CH
3
CH
2
=CHCHCH
3
3-metil-1-butena
|
CH
3
CH
3
C=CHCH
3
3-metil-2-butena
|
CH
3
Bab IV Minyak Bumi
A. Pilihan Ganda
1. Jawaban: a
Minyak bumi tersusun dari 8387% karbon,
1014% hidrogen, 0,051,5% oksigen, 0,12%
nitrogen,dan0,056%belerang.
2. Jawaban: b
Berdasarkankomponenterbanyakdalamminyak
bumi, minyak bumi dibedakan menjadi tiga
golonganyaituparafin,naftalena,dancampuran
parafin-naftalena.Minyakbumigolongannaftalena
digunakan untuk pengeras jalan dan pelumas.
Minyak bumi naftalena berupa senyawa
hidrokarbon rantai siklis atau rantai tertutup.
Sementara itu, minyak bumi golongan parafin
digunakanuntukbahanbakarkarenamerupakan
penghasilgasolin.
3. Jawaban: e
Senyawametilsiklopentanamerupakansenyawa
hidrokarbonberbentuksiklisdanterdiriataslima
atomkarbonyangmengandunggugusmetil.Gugus
metilterikatpadapertamaatomcpertamaseperti
pada struktur e. Sementara itu, senyawa pada
rumusstrukturamerupakanisooktana,senyawa
59 Kimia Kelas X
padarumusstrukturbmerupakansiklopentana,
senyawa pada rumus struktur c merupakan
sikloheksana,dansenyawapadarumusstruktur
dmerupakanetilsikloheksana.
4. Jawaban: c
Etil benzena merupakan senyawa hirdrokarbon
aromatik karena mempunyai rantai jenuh dan
berbentukcincin.Rumusstrukturetilbenzena
adalah.Sementaraitu,n-alkanadan
n-oktanamerupakanhidrokarbongolonganalkana.
Siklopentana dan etil siklopentana merupakan
hidrokarbongolongansikloalkana.
5. Jawaban: d
Desaltingmerupakanprosespengolahanminyak
mentah untuk menghilangkan garam yang ter-
campur dalam minyak mentah. Sementara itu,
refineriesmerupakantempatpengilanganminyak,
distilasimerupakanprosespemisahankomponen
minyak bumi, desulfuring adalah proses meng-
hilangkanunsurbelerangpadakomponenminyak
bumi, sedangkan treating adalah proses peng-
hilangankotoranpadafraksi-fraksiminyakbumi.
6. Jawaban: b
Isooktana yang menyusun minyak bumi berupa
2,2,4-trimetilpentana.Rumusstrukturnyasebagai
berikut.
CH
3
l
CH
3
CHCH
2
CCH
3
l l
CH
3
CH
3
CH
3
CHCH
2
CH
2
CH
2
CH
2
CH
3
l
CH
3
nama:2-metilheptana
CH
3
CHCH
2
CH
2
CHCH
3
l l
CH
3
CH
3
nama:2,5-dimetilheksana
CH
3
CHCHCHCH
3
l l l
CH
3
CH
3
CH
3
nama:2,3,4-trimetilpentana
CH
3
CH
3
l l
CH
3
CCCH
3
l l
CH
3
CH
3
nama:2,2,3,3-tetrametilbutana
7. Jawaban: b
Naftadigunakansebagaibahanbakudiindustri
petrokimia.Sementaraitu,gasdigunakansebagai
bahanbakarkomporgasdangastabung,solar
digunakanuntukbahanbakarkendaraanbermesin
disel serta avtur dan kerosin digunakan untuk
bahanbakarbermesinjet.
8. Jawaban: c
Lilindiperolehdaripengolahanfraksiminyakbumi
yang berupa residu. Lilin merupakan senyawa
hidrokarbonyangmengandungatomCsejumlah
2628.Lilindiperolehdariprosesdistilasiresidu.
Padaprosesinijugadihasilkanminyakgosok.Lilin
dipisahkan dari minyak gosok dengan cara
ekstraksipelarut.
9. Jawaban: c
Urutanfraksiminyakbumidariyangringankeberat
adalahbensin,nafta,dansolar.Semakinberatfraksi
minyakbumi,titikdidihnyasemakintinggi.
10. Jawaban: c
Proses pemecahan molekul senyawa yang
panjangmenjadimolekulpendekdinamakancrack-
ing. Blending adalah proses pencampuran atau
penambahan zat aditif pada bensin agar mutu
bensin lebih baik. Treating adalah proses
menghilangkanpengotorpadaminyaksupayalebih
murni.Reformingadalahmengubahbentukstruktur
(isomer)darirantaikarbonlurusmenjadibercabang
untuk meningkatkan mutu bensin. Polimerisasi
adalah penggabungan molekul-molekul kecil
menjadi molekul besar bensin yang berkualitas
tinggi.
B. Uraian
1. Senyawahidrokarbonyangterdapatdalamminyak
bumisebagaiberikut.
a. Alkana,misaln-oktanadanisooktana.
b. Sikloalkana, misal siklopenta dan siklo-
heksana.
c. Senyawaaromatik,misalbenzena.
2. Minyakmentah(crude oil)hasilpengeborandari
sumur eksplorasi belum dapat dimanfaatkan
karenamasihberupacampuran.Olehkarenaitu,
minyakmentahharusdiolahterlebihdahuluuntuk
memisahkan komponen-komponen penyusun
minyak bumi dari minyak bumi dan pengotor-
pengotornya.
3. a. Desalting adalah proses pengolahan untuk
menghilangkankotoranyangberupagaram
yangtercampurdidalamminyakmentah.
b. Proses desalting perlu dilakukan untuk
mencegah terjadinya korosi di pipa-pipa
minyakdanmencegahtersumbatnyalubang-
lubangdimenarafraksinasi.
C
2
H
5
60 Kunci Jawaban dan Pembahasan
4. Kegunaandarifraksi-fraksiminyakmentahtersebut
sebagaiberikut.
a. Gas-gaspetroleumbahanbakarelpiji
b. Petroleumeterbahanpelarut(dry cleaning)
c. Bensinbahanbakarmesinbermotor
d. Kerosinbahanbakarpesawat
e. Minyaksolarbahanbakarmesindiesel
f. Minyakdieselbahanbakarmesindiesel
g. Minyakpelicinbahanpelumas
h. Lilinbahanpenerangan
i. Minyakbakarbahanbakarkapal
j. Bitumenbahanpengerasjalan
5. Macam-macam pengolahan lebih lanjut fraksi
minyakbumisebagaiberikut.
a. Reforming,yaitumengubahbentukstruktur
(isomer)rantaikarbonlurusmenjadibercabang
untukmeningkatkanmutubensin.
b. Cracking, yaitu proses pemecahan molekul
senyawa yang panjang menjadi molekul
pendek.
c. Polimerisasi, yaitu penggabungan molekul-
molekulkecilmenjadimolekulbesar.Molekul
besaryangdihasilkandapatmenaikkankualitas
bensinkarenabilanganoktannyatinggi.
d. Treating,yaituprosesmenghilangkanpengotor
padaminyaksupayalebihmurni.
e. Blending, yaitu proses pencampuran atau
penambahanzataditifpadabensinagarmutu
bensinlebihbaik.MisalmenambahkanTEL
(tetraetillead),MTBE(metiltersierbutileter),
AlCl
3
,H
2
SO
4
,dan1,2-dibromoetana.
A. Pilihan Ganda
1. Jawaban: c
Cracking adalah proses pemecahan senyawa
hidrokarbon berantai panjang menjadi senyawa
hidrokarbon berarti pendek. Proses ini dilakukan
untukmemperolehfraksibensin.Distilasimerupakan
prosespenyulinganuntukmemisahkanfraksi-fraksi
minyakbumi.Reformingadalahprosesmengubah
bentukstrukturisomerrantaikarbonlurusmenjadi
bercabang. Polimerisasi adalah proses
penggabungan molekul-molekul kecil menjadi
molekulbesar.Treatingadalahprosespemurnian
minyak dengan cara menghilangkan zat
pengotornya.
2. Jawaban: b
Ketukanpadamesinkendaraandikarenakanbensin
mengandunghidrokarbonrantailurus.Hidrokarbon
rantai lurus menghasilkan ketukan keras pada
mesin,sedangkanhidrokarbonbercabangseperti
isooktanatidakmenghasilkanketukan.
3. Jawaban: d
Bilanganoktanpertamakssekitar92.Sementara
itu, bilangan oktan antara 8088 merupakan
bilanganoktanpremium,sedangkanbilanganoktan
95merupakanbilanganoktanpertamaksplus.
4. Jawaban: e
Nilaioktandari:
butana=91
1-pentena=84
pentana=62
n-heksana=25
n-heptana=0
Jadi, senyawa hidrokarbon yang memiliki nilai
oktanterendahyaitun-heptana.
5. Jawaban: c
Bensin terdiri atas senyawa n-heptana dan
isooktana.n-heptanadiberinilaioktan0karena
menimbulkanketukanpalingbanyak,sedangkan
isooktana diberi nilai oktan 100 karena tidak
menimbulkanketukan.
6. Jawaban: a
Perengkahan termal adalah proses memecah
senyawahidrokarbonrantaipanjangsepertikerosin
menjadisenyawahidrokarbonrantaipendekseperti
heksanadanheksenapadasuhu500C.Senyawa
heksenamampumenaikkanbilanganoktansebesar
10satuan.Sementaraitu,distilasibertingkatadalah
proses pemisahan komponen-komponen minyak
bumiberdasarkanperbedaantitikdidih.Desulfuring
adalahprosespenghilanganunsurbelerangpada
bahan bakar. Polimerisasi adalah proses
penggabungan molekul-molekul kecil menjadi
molekulbesar.Crackingadalahprosespemecahan
senyawa hidrokarbon berantai panjang menjadi
senyawa hidrokarbon berantai pendek untuk
memperolehfraksibensin.
7. Jawaban: c
Visconmerupakanzataditifyangditambahkanke
dalambensinuntukmeningkatkanbilanganoktan
bensin.ViscondigunakansebagaipenggantiTEL
karenalebihramahlingkungan,mengurangiemisi
gasCO,HC,danNO
x
.
8. Jawaban: b
(C
2
H
5
)
4
Pbatautetraetiltimbalmerupakanzataditif
yang ditambahkan ke dalam bensin untuk
menaikkan bilangan oktan. Namun senyawa ini
dapatmenimbulkankerugian,yaitumelepaskan
partikulat timbal (Pb) ke udara pada proses
pembakaran bensin. Partikulat Pb merupakan
polutanyangbersifatracun.Olehkarenaitu,saat
ini (C
2
H
5
)
4
Pb dilarang ditambahkan ke dalam
bensin.
61 Kimia Kelas X
9. Jawaban: c
Senyawa yang berfungsi sebagai bahan
antiketukan pada mesin kendaraan bermotor
adalahTELdenganrumusmolekul(CH
3
CH
2
)
4
Pb
atauMTBE(metiltersierbutileter).C
7
H
16
(heptana)
danC
8
H
18
(oktana)merupakansenyawaalkana
yang menyusun bensin. Sedangkan C
5
H
10
dan
C
6
H
12
merupakansenyawasikloalkanapenyusun
minyakbumi.
10. Jawaban: e
Knocking atau ketukan pada mesin disebabkan
olehrantaikarbonlurusatausedikitbercabang.
Contohnya n-heptana. Adapun senyawa hidro-
karbon dengan banyak cabang umumnya tidak
atausedikitmenimbulkanknocking.
B. Uraian
1. Fraksi bensin selain diperoleh dari distilasi
bertingkat minyak mentah, juga dapat diolah
dengan berbagai cara guna menambah jumlah
bensinagarmemenuhikebutuhanbahanbakar.
Cara yang digunakan adalah cracking atau
perengkahan dan polimerisasi. Cracking adalah
prosespemutusanhidrokarbonberantaipanjang
sehinggadihasilkanfraksibensinberantaipendek.
Sementaraitu,polimerisasiadalahkebalikandari
proses cracking yaitu proses menggabungkan
hidrokarbonberantaipendekmenjadifraksibensin
berantailebihpanjang.
2. Bensindengannilaioktan92dapatdibuatdengan
cara mencampurkan senyawa isooktan dan
n-heptanadengankadar92%isooktandan8%n-
heptana. Bilangan oktan dihitung berdasarkan
jumlahkadarisooktanadalamcampuranbensin
tersebut.
3. Knockingterjadisebagaiakibatdaripembakaran
bahanbakardalamsilinderpiston.Pembakaran
semakincepatjikabensinyangdigunakansebagai
bahanbakarmengandungcampuranhidrokarbon
rantai lurus dan berantai panjang. Pembakaran
bensinyangtelalucepatiniakanmengakibatkan
penurunanefisiensienergiyangdihasilkandanjuga
akanmenimbulkanknockingyangsemakinkeras.
4. Knockingatauketukanbensinpadamesinterjadi
karenabensinmempunyaibilanganoktanrendah.
Ketukan ini dapat dikurangi dengan menaikkan
bilanganoktanbensin.Caranyadenganmenambah-
kan senyawa MTBE (metil tersier butil eter),
metanol,etanol,viscon,atautersierbutilalkohol
ke dalam bensin. Senyawa-senyawa tersebut
merupakan zat aditif yang dapat menaikkan
bilanganoktanbensin.
5. Kualitasbensinditentukanolehbilanganoktandan
jumlah gas CO yang dihasilkan pada proses
pembakaranbensin.Semakintinggibilanganoktan
dansemakinsedikitjumlahgasCOyangdihasilkan
maka kualitas bensin tersebut semakin baik.
Sebaliknya,semakinrendahbilanganoktandan
semakinbanyakjumlahgasCOyangdihasilkan
makakualitasbensintersebutsemakinrendah.
A. Pilihan Ganda
1. Jawaban: c
Gas hasil pengolahan minyak mentah yang
digunakansebagaiLPGterdiriataspropanadan
butana.Metanamerupakankomposisigasalam.
2. Jawaban: e
Proses distilasi bertingkat pada pengolahan
minyak mentah bertujuan untuk memisahkan
fraksi-fraksi minyak mentah yang titik didihnya
berdekatan. Sementara itu, menghilangkan
senyawahidrokarbondanmelarutkanmineral-min-
eraldalamminyakmentahkedalamairdilakukan
padaprosesdesalting.Menggabungkanmolekul-
molekul hidrokarbon merupakan proses
polimerisasi untuk memperoleh fraksi bensin.
Menghilangkan lumpur yang tercampur dalam
minyak merupakan proses treating dilakukan
setelahprosesdistilasi.
3. Jawaban: d
Isooktana merupakan hasil polimerisasi antara
isobutana dan isobutena. Reaksinya sebagai
berikut.
CH
3
CHCH
3
+CH
3
C=CH
2

||
CH
3
CH
3
CH
3
CHCH
2
CH
2
CHCH
3
||
CH
3
CH
3
4. Jawaban: c
Sikloalkanamerupakansenyawayangberbentuk
cincin dan bersifat jenuh, misal siklopentana.
Senyawan-alkanatidakbercabangdanbersifat
jenuh, misal n-oktana. Senyawa isoalkana
merupakansenyawabercabangdanbersifatjenuh,
misalisooktana.Senyawaorganologammisalnya
vanadiumdannikel.Hidrokarbonaromatikadalah
senyawaberbentukcincinberikatanrangkap,misal
benzena.
62 Kunci Jawaban dan Pembahasan
5. Jawaban: c
Minyakgosokdanaspalmerupakanfraksiminyak
mentahhasilpengolahfraksiresidu.Minyakgosok
diperolehdengancaramendistilasiresidu.Pada
prosesdistilasiinidihasilkanuapdanresidu.Uap
yang dihasilkan merupakan campuran lilin dan
minyakgosok.Minyakgosokdipisahkandarililin
dengan cara ekstraksi pelarut. Sementara itu,
residuyangtertinggalpadaprosesinimerupakan
aspal.
6. Jawaban: c
Kerosinadalahfraksiminyakmentahyangdiguna-
kanuntukbahanbakarpesawatterbang,kompor
minyak,danindustri.Sementaraitu,bahanbakar
kendaraanbermotormenggunakanbensin,bahan
bakuindustripetrokimiamenggunakannafta,bahan
bakar mesin diesel menggunakan solar, dan
pelumasmesinmenggunakanoli.
7. Jawaban: d
Minyakdieselatausolardihasilkandaripengolahan
minyakmentahmelaluiprosesdistilasibertingkat
pada suhu 250340C. Sementara itu, residu
dihasilkanpadasuhu>500C,kerosindihasilkan
padasuhu170250C,gasalamdihasilkanpada
suhu(160(40))C,danminyakpelumasatauoli
dihasilkanpadasuhu350500C.
8. Jawaban: c
Proses desalting dilakukan dengan cara
mencampur minyak mentah dengan air. Tujuan
dilakukanprosesdesaltingyaitumenghilangkan
senyawa-senyawa hidrokarbon, mencegah
terjadinya korosi pada pipa minyak, mencegah
terjadinya penyumbatan pada lubang-lubang di
menara, dan melarutkan mineral-mineral dalam
minyakmentahkedalamair.Sementaraitu,meng-
hilangkan senyawa-senyawa nonhidrokarbon
dilakukan dengan cara penambahan asam dan
basakedalamminyakmentah.
9. Jawaban: e
Minyakbumiyangsebagianbesarkomponennya
berupasenyawahidrokarbonrantaitertutupadalah
golongan naftalena. Minyak bumi jenis ini
digunakan sebagai bahan pelumas. Kerosin
merupakanminyaktanah.Parafinmerupakanjenis
minyakbumiyangsebagianbesardisusunoleh
senyawa hidrokarbon rantai terbuka. Senyawa
benzena mempunyai rantai tertutup (siklik)
berikatanrangkap.Senyawaaromatikmempunyai
cincinaromatik.
10. Jawaban: d
Uapminyakmentahakanmencairdanmengalir
melalui pelat pengembun. Pelat pengembun ini
dilengkapialatsepertikondensorataupendingin
yangmencairkanuapminyakmentah.
11. Jawaban: a
Senyawahidrokarbonaromatikadalahsenyawa
hidrokarbontidakjenuhberbentukcincin,contoh
etil benzena. Sementara itu, siklopentana,
sikloheksana, etil sikloheksana, dan metil
siklopentana merupakan senyawa hidrokarbon
golongansikloalkanakarenaberantaijenuhdan
berbentukcincin.
12. Jawaban: c
Metiltersierbutileter,tersierbutilalkohol,metanol,
dan viscon adalah bahan kimia yang jika
ditambahkankedalambensindapatmenaikkan
bilanganoktan.Bahan-bahantersebutamankarena
tidak menimbulkan partikulat timbal (Pb).
Sementaraitu,tetraetiltimbaldapatmenaikkan
bilanganoktantetapimenimbulkanpartikulat(Pb).
13. Jawaban: a
Fraksi minyak mentah yang terakhir dipisahkan
dengan distilasi bertingkat berupa residu. Residu
dapatberupaaspaldigunakanuntukpengerasjalan.
Sementaraitu,pelumasmesinmenggunakanoli.
Pelarutorganikberupapetroleumeter.Bahanbakar
memasak menggunakan gas alam yang telah
dicairkan (elpiji). Bahan bakar kendaraan berupa
bensin.
14. Jawaban: e
Bensin beroktan rendah jika dibakar banyak
menghasilkanjelaga.Sebaliknya,bensinberoktan
tinggimenghasilkansedikitgaskarbonmonoksida
jelaga,dangaskarbondioksidaserta,menimbul-
kansedikitketukanpadamesin.
15. Jawaban: c
GasCOsebagaihasilpembakarantidaksempurna
bahan bakar bersifat sangat berbahaya karena
mampumenggantikanikatanoksigenpadahemo-
globin. Akibatnya, tubuh menjadi kekurangan
oksigensehinggametabolismesel-selterganggu.
Akhirnya, timbul rasa pusing, muntah, pingsan,
bahkan dapat mengakibatkan kematian. Unsur
yang mengendap di mesin sebagai sisa pem-
bakaranberupatimbal.
16. Jawaban: b
Bensinsuper98artinyabensintersebutterdiridari
campuran98%isooktanadengan2%n-heptana
atau98ccisooktanadengan2ccn-heptana.
17. Jawaban: e
Kataliskonverterdipasangdiknalpotmobildengan
tujuan untuk mengubah polutan yang beracun
sepertisisabensin,gasCO,danoksidanitrogen
menjadiprodukyanglebihamansepertigasN
2
,
CO
2
,danH
2
O.
63 Kimia Kelas X
18. Jawaban: d
Pertamaks plus memiliki nilai oktan > 95. Nilai
oktann-heptana=0,n-heksana=25,n-heptena=
60, sikloheksana = 97, dan 2-metil heksana
= 44. Jadi, senyawa yang memiliki nilai oktan
setaradengannilaioktanpertamaksplusadalah
sikloheksana.
19. Jawaban: b
Kerosindapatdiubahmenjadifraksibensindengan
caracracking(kertakan).Crackingadalahproses
pemecahan molekul hidrokarbon yang panjang
menjadi molekul hidrokarbon pendek.
Reformingadalahcaramengubahbentukstruktur
rantaikarbonlurusmenjadibercabang.Treating
adalah proses menghilangkan pengotor pada
minyaksupayalebihmurni.Blendingadalahproses
pencampuran atau penambahan zat aditif pada
bensin. Polimerisasi adalah penggabungan
molekul-molekulkecilmenjadimolekulbesar.
20. Jawaban: c
Ketukanpadamesinkendaraandisebabkanoleh
pembakaranbensinyangterlalucepatsehingga
efisiensienergiyangdihasilkanberkurang.
21. Jawaban: c
GasbuangpenyebabhujanasamyaituSO
2
dan
NO
x
.Keduagasinidapatberikatandenganuapair
diudaramembentukasamdalamawan.Apabila
awanyangmengandungasamturunmenjadihujan,
airhujantersebutbersifatasam.Sementaraitu,
gas CO merupakan gas beracun yang mudah
berikatan dengan hemoglobin. Gas CO
2
mengakibatkan terjadinya global warming,
sedangkan uap air (H
2
O) merupakan gas yang
tidak beracun, hasil dari proses pembakaran
senyawakarbon.
22. Jawaban: b
Komponen bensin berasal dari isomer-isomer
heptana dan oktana. Isomer-isomer heptana
mempunyaijumlahatomC=7danatomH=16.
Sementaraitu,isomer-isomeroktanamempunyai
jumlahatomC=8danatomH=18.Jadi,senyawa
hidrokarbon yang terdapat dalam bensin yaitu
2,3-dimetilpentana(C
7
H
16
)dan2,2,3,3-tetrametil
butana(C
8
H
18
).
23. Jawaban: a
Gas CO merupakan gas beracun sehingga
keberadaannyadiudaraharusdibatasi.GasCO
diudarabelummenimbulkandampaknegatifbagi
kesehatanjikaberkadar<100ppm.Apabilakadar
COdiudaramelebihi100ppmakanmengakibat-
kancepatmerasalelahdansakitkepala.
24. Jawaban: d
CO dan partikel timah hitam merupakan bahan
kimiaberbahayayangdihasilkanolehpembakaran
bahan bakar fosil seperti bensin. Bahan-bahan
tersebut dikeluarkan dalam asap kendaraan
bermotor.
25. Jawaban: e
PeningkatankadarCO
2
diudaramengakibatkan
terjadinya global warming atau pemanasan
global. Sementara itu, gangguan pernapasan
diakibatkan oleh kabut asap, hujan asam
diakibatkan oleh gas SO
2
dan oksida nitrogen,
sedangkangangguanfungsihemoglobindiakibat-
kanolehgasCO.
26. Jawaban: d
Nafta yang merupakan hasil fraksinasi minyak
bumidigunakanuntukbahanbakuindustrikimia.
Bahanbakarkompordanbahanbakarpesawat
berupakerosinatauminyaktanah.Bahanbakar
kendaraan berupa bensin. Bahan bakar rumah
tanggaberupaelpiji.
27. Jawaban: e
1-pentena lebih sedikit menimbulkan ketukan
daripada n-heptana karena angka oktan
1-pentena lebih tinggi daripada bilangan oktan
n-heptana,sehingga1-pentenalebihberkualitas
daripadan-heptana.
28. Jawaban: e
Senyawa 1,2dibromo etana ditambahkan ke
dalambensinber-TELuntukmengikattimbalsisa
pembakaran bensin yang mengendap di mesin
menjadisenyawaPbBr
2
.
29. Jawaban: e
Zatantiketukanyangberupaethyl fluid digunakan
untukmeningkatkanbilanganoktanbensin.Ethyl
fluidterdiriatascampuran65%TEL(tetra ethyl
lead),25%1,2-dibromoetana,dan10%1,2-dikloro
etana.MTBE,etanol,metanol,danvisconmerupa-
kanpenggantiTEL.
30. Jawaban: e
GasPbBr
2
berasaldaripembakaranbensin.Gas
inimudahmenguapdanmenimbulkanpencemaran
udara. Jika terhirup partikulat Pb-nya akan
mengendapdidalamtubuhsebagairacun.
B. Uraian
1. Gas alam, minyak bumi, dan batu bara disebut
bahanbakarfosilkarenaketiganyaterbentukdari
jasadreniklautan,tumbuhan,danhewanyangmati
sekitar 150 juta tahun yang lampau. Sisa-sisa
organismetersebutmengendapdidasarlautandan
tertutuplapisanlumpurhinggamenjadifosil.Oleh
64 Kunci Jawaban dan Pembahasan
karena adanya pengaruh tekanan lapisan di
atasnya, lapisan lumpur tersebut lambat laun
berubahmenjadibatuan.Denganmeningkatnya
tekanandansuhu,bakterianaerobmenguraikan
sisa-sisajasadrenikitudanmengubahnyamen-
jadiminyakdangas.Olehkarenaberasaldarifosil
jasadrenikitulahmakagasalam,minyakbumi,
danbatubaradisebutsebagaibahanbakarfosil.
2. Pemurnianminyakbumimerupakanpemisahan
komponen-komponenpenyusunminyakbumiyang
berupa senyawa hidrokarbon berdasarkan
perbedaantitikdidih.Fraksi-fraksidalamminyak
bumi dapat dipisahkan dengan proses distilasi
bertingkatsebabfraksi-fraksidalamminyakbumi
mempunyaititikdidihyangberdekatan.Prosesini
diawalidenganmemanaskanminyakmentahpada
suhu400C,kemudianmengalirkannyakedalam
menarafraksinasi.Komponenyangtitikdidihnya
lebihtinggiakantetapberupacairandanturunke
bawah,sedangkankomponenyangtitikdidihnya
lebihrendahakanmenguapdannaikkebagian
atasmelaluisungkupgelembungudara.Semakin
keatas,suhudalammenarafraksinasiitusemakin
rendah.Komponenyangmencapaipuncakmenara
adalahkomponenyangpadasuhukamarberupa
gas.
3. a. Minyakbumigolonganparafin
Minyak bumi golongan parafin komponen
terbesarnya berupa senyawa hidrokarbon
rantaiterbuka,misalalkana.
b. Minyakbumigolongannaftalena
Minyakbumigolongannaftalenakomponen
terbesarnya berupa senyawa hidrokarbon
rantaisiklis,misalsikloalkana.
c. Minyakbumigolongancampuran
Minyak bumi ini komponen penyusunnya
terdiri atas senyawa hidrokarbon rantai
terbukadanrantaitertutup.
4. Naftamerupakanbagiandarifraksiminyakbumi
yangdiperolehpadatitikdidihantara70170C.
Nafta digunakan sebagai bahan baku industri
petrokimiasepertiplastik,seratsintetis,nilon,karet
sintetis, detergen, pestisida, obat-obatan,
kosmetik,danpelarut.
5. Visconbaikdigunakansebagaizataditifbensin
karenavisconmemilikibanyakkeunggulansebagai
berikut.
a. Dapatmenaikkanbilanganoktanbensin.
b. Mengurangikonsumsibensin.
c. MengurangiemisigasHC,CO,danNO
x
.
d. Meningkatkandayadorongmesin.
e. Menurunkansuhugaspembakaran.
6. Senyawatetraetiltimbal(TEL)dilarangditambah-
kanpadabensinkarenapadaprosespembakaran
bensin yang menggunakan senyawa ini akan
dihasilkan partikulat Pb atau timbal. Partikut Pb
merupakanpolutanudarayangbersifatracunyang
jika terhirup akan menimbulkan dampak negatif
terhadapkesehatan.
7. Bensin super dengan bilangan oktan 98 artinya
bensin tersebut terdiri atas campuran 98%
isooktanadan2%n-heptana.
8. Pada knalpot sering terlihat adanya endapan
berwarnahitamsebabpadamesinterjadiproses
pembakaransenyawakarbonyaitubensin.Pem-
bakaran bensin mengakibatkan terbentuknya
karbonataujelagapadasisapembakaran.Endapan
berwarnahitamdalamknalpotmerupakanunsur
karbonyangteruraidarisenyawakarbonakibat
prosespembakaran.
9. Penggunaanbensinsebagaibahanbakardapat
menimbulkandampaknegatifkarenamengakibat-
kantimbulnyagasCOsebagaiakibatpembakaran
tidak sempurna pada bensin. Gas CO dapat
mengakibatkankematianseseorangkarenagas
COlebihreaktifterhadapHb,dibandingkandengan
O
2
.Olehkarenaitu,jikaHbhanyamengikatCO,
tubuh akan kekurangan O
2
. Kurangnya kadar
oksigendalamtubuhmengakibatkanterhambatnya
prosesmetabolismedalamtubuh.Akibatnya,tubuh
akanmudahlelahdanlemas.
10. Kitaharusberhematdalammenggunakanbahan
bakar karena bahan bakar bersifat tidak dapat
diperbarui (unrenewable). Sementara itu,
kebutuhanbahanbakarpadaindustri,kendaraan,
danmasyarakatsemakinmeningkat.Jikakitatidak
berusahaberhematdalammenggunakanbahan
bakardapatterjadikelangkaanbahanbakar.
Latihan Ulangan Akhir Semester
A. Pilihan Ganda
1. Jawaban: b
Natriumhidroksidapadatjumlahnyalebihsedikit
daripadaairsehingganatriumhidroksidamerupakan
zatterlarut.Massanatriumhidroksida=5gram.
2. Jawaban: b
Asamkarbonatdapatmenghantarkanaruslistrik
karena dalam air terionisasi sebagian dengan
derajationisasi0<<1sehinggaasamkarbonat
merupakanelektrolitlemah.
65 Kimia Kelas X
3. Jawaban: a
Saatdielektrolisis,CaSO
4
akanteruraimenjadiion
Ca
2+
danionSO
4
2
.IonCa
2+
akanmenujukatode
dan menangkap elektron. Sementara itu, ion
SO
4
2
akanmenujuanodedanmelepaselektron.
4. Jawaban: d
Reaksiionisasisenyawa-senyawatersebut
sebagaiberikut.
HCl(aq) H
+
(aq)+Cl

(aq)
NaOH(aq) Na
+
(aq)+OH

(aq)
HNO
3
(aq) H
+
(aq)+NO
3

(aq)
H
2
SO
4
(aq) 2H
+
(aq)+SO
4
2
(aq)
NH
4
OH(aq) NH
4
+
(aq)+OH

(aq)
Jadi,senyawayangmenghasilkanjumlahion
palingbanyakadalahH
2
SO
4
,yaitu2ionH
+
dan
1ionSO
4
2
.
5. Jawaban: b
Pasangan ion yang akan membentuk senyawa
elektrolitdanberikatanionadalahionAl
3+
dengan
ionOH

.
Persamaanreaksinya:
Al
3+
+3OH

Al(OH)
3
Sementaraitu,antaraionH
+
denganionBr

,ion
H
+
denganionSO
4
2
,ionNH
4
+
denganionOH

,
sertaionNH
4
+
denganionCl

membentuksenyawa
kovalenpolar.
6. Jawaban: b
Senyawa kovalen polar hanya dapat meng-
hantarkan arus listrik jika berada dalam bentuk
larutannya.Dalambentukkristaldanlelehannya,
senyawakovalenpolartidakdapatmenghantarkan
aruslistrikkarenatidakdapatmenghasilkanion-
iondanmasihdalambentukmolekul.Olehkarena
tidak terionisasi, senyawa kovalen polar dalam
bentuk kristal dan lelehannya tidak dapat
menghantarkanaruslistrik.
7. Jawaban: b
Oksidatorartinyazatyangmengalamireduksi.
a. I
2
IO
3

0 +5
oksidasi
perubahanbilanganoksidasi+5
b. ClO
3

Cl

+5 1
reduksi
Perubahanbilanganoksidasi6
c. Al
2
O
3
Al
3+
+3 +3
tetap
d. Cr
2
O
7
2
Cr
3+
+6 +3
reduksi
Perubahanbilanganoksidasi3
e. MnO
4

Mn
2+
+7 +2
reduksi
Perubahanbilanganoksidasi5
Jadi,oksidatoryangmempunyaihargaperubahan
bilangan oksidasi sama dengan 6 adalah ClO
3

menjadiCl

.
8. Jawaban: b
BilanganoksidasiNH
4
+
=+1
(1BON)+(4BOH) =+1
BON+(4(+1)) =+1
BON =3
BilanganoksidasiNO
2

=1
(1BON)+(2BOO) =1
BON+(2(2)) =1
BON =+3
BilanganoksidasiNO
3

=1
(1BON)+(3BOO) =1
BON+(3(2)) =1
BON =+5
BilanganoksidasiNdalamN
2
=0
Jadi,urutanbilanganoksidasinitrogendalamNH
4
+
,
NO
2

,NO
3

,danN
2
adalah3,+3,+5,dan0.
9. Jawaban: c
4HCl(aq)+2S
2
O
3
2
(aq)2S(s)+2SO
2
(g)+2H
2
O()+4Cl

(aq)
+2 0 +4
reduksi
oksidasi
Reaksi autoredoks merupakan reaksi yang
mempunyai reduktor (pereduksi) dan oksidator
(pengoksidasi) sama. Pada reaksi tersebut, zat
yang bertindak sebagai pengoksidasi dan
pereduksi adalah S
2
O
3
2
. Bilangan oksidasi S
berubahdari+2menjadi0dan+4.
10. Jawaban: d
Reduktoradalahzatyangmengalamioksidasi.
a. S+O
2
SO
2
00+42
oksidasi
reduksi
O
2
bertindaksebagaioksidator
b. 2Al+Fe
2
O
3
Al
2
O
3
+2Fe
0+3+30
oksidasi
reduksi
Fe
2
O
3
bertindaksebagaioksidator
66 Kunci Jawaban dan Pembahasan
c. 2FeCl
3
+H
2
S2FeCl
2
+2HCl+S
+32+20
reduksi
oksidasi
FeCl
3
bertindaksebagaioksidator
d. 6CuSO
4
+12KI6K
2
SO
4
+6CuI+3I
2
+21+10
reduksi
oksidasi
KIbertindaksebagaireduktor
e. MnO
2
+4HClMnCl
2
+2H
2
O+Cl
2
+41+20
reduksi
oksidasi
MnO
2
bertindaksebagaioksidator
Jadi,zatyangdigarisbawahidalamreaksitersebut
yangbertindaksebagaireduktoradalahKI.
11. Jawaban: b
a. sengklorit =Zn(ClO
2
)
2
b. timbal(II)klorat =Pb(ClO
3
)
2
c. timbal(II)perklorat =Pb(ClO
4
)
2
d. tembaga(II)klorat =Cu(ClO
3
)
2
e. timbal(IV)perklorat =Pb(ClO
4
)
4
12. Jawaban: d
a. (NH
4
)
2
CO
3
=amoniumkarbonat
b. (NH
4
)
2
C
2
O
4
=amoniumoksalat
c. (NH
4
)
2
CrO
4
=

amoniumkromat
d. (NH
4
)
2
Cr
2
O
7
=amoniumdikromat
e. CH
3
COONH
4
=amoniumasetat
13. Jawaban: b
Rumus alkena adalah C
n
H
2n
. Dengan demikian
senyawa yang merupakan alkena adalah C
2
H
4
,
C
3
H
6
,danC
4
H
8
.Sementaraitu,C
4
H
10
mempunyai
rumusumumC
n
H
2n+2
sehinggamerupakanalkana,
sedangkanC
5
H
8
mempunyairumusumumC
n
H
2n2
sehinggamerupakanalkuna.
14. Jawaban: c
ReaksiCH
2
=CHCH
3
denganHBrmerupakan
reaksiadisipadaalkenaasimetris.Menurutaturan
Markovnikoff,atomHdariasamhalidaakanterikat
pada atom C berikatan rangkap yang mengikat
atomHlebihbanyak
CH
3
=CHCH
3
+HBrCH
2
CH
2
CH
3
1-propena|
Br
1-bromo-propana
15. Jawaban: d
Senyawa hidrokarbon dengan rumus C
n
H
2n + 2
adalahalkana.Reaksiantaraalkanadengangas
klorinadalah:
CH
3
CH
2
CH
3
+Cl
2
CH
3
CH
2
CH
2
Cl+HCl
PadareaksidiatasgugusHpadaalkanadiganti
dengangugusCldarigasCl
2
.Dengandemikian,
reaksitersebuttermasukreaksisubstitusi.
16. Jawaban: a
Senyawa hidrokarbon yang berikatan jenuh
mempunyairumusumumC
n
H
2n+2
.Senyawaini
termasuk golongan alkana. Senyawa alkana
mempunyairumusC
2
H
6
,C
3
H
8
,C
4
H
10
,C
5
H
12
,dan
C
6
H
14
.Sementaraitu,C
2
H
4
,C
3
H
6
,C
4
H
6
,C
4
H
8
,dan
C
5
H
10
merupakansenyawahidrokarbontidakjenuh.
17. Jawaban: a

1
CH
3

8
CH
3
| |
4
CH
3

2
CH
7
CH
9
CH
3
| |

3
CH
2

6
CH
|

5
CH
3
AtomCnomor1,4,5,8,dan9merupakanatomC
primer.AtomCnomor2,6,dan7merupakanatom
C tersier. Atom C nomor 3 merupakan atom C
sekunder. Dengan demikian, jumlah atom C
sekunderpadastrukturdiatassebanyak1.
18. Jawaban: c
Reaksisubstitusiterjadipadasenyawaalkana.Contoh
senyawaalkanaadalahCH
3
CH
2
CH
2
CH
3
.
Sementaraitu,CH
2
=CH
2
merupakanalkena,
CH
2
=CHCH=CH
2
merupakanalkadiena,dan
CH
3
C CCH
2
CH
3
merupakanalkuna.
19. Jawaban: c
Struktursenyawa3-metil-1-pentuna
CH
3
CH
2
CHCCH
|
CH
3
Padasenyawatersebutterdapat10ikatanCH,
4ikatanCC,dan1ikatanCC.
20. Jawaban: e
1
CH
3
CH
3
||
2
CH
3
CH
4
CH
2

5
CH
6
CHCH
3
|||
CH
3
CH
3

7
CH
2

8
CH
3
NamasenyawatersebutmenurutIUPACadalah
2,3,5,6-tetrametil-oktana.
21. Jawaban: c
Rumusstrukturpropana:
CH
3
CH
2
CH
3
(3atomC)
Rumusstrukturpropena:
CH
2
=CHCH
3
(3atomC)
67 Kimia Kelas X
KeduasenyawatersebutmempunyaitigaatomC
dalamrumusmolekulnya.Propanadanpropena
merupakansenyawanonpolarsehinggatidaklarut
dalamair.PropanamempunyairumusumumC
n
H
2n+2
sedangkanpropenamemilikirumusumumC
n
H
2n
.
Dengandemikian,derethomologkeduanyasesuai
dengan rumus umumnya dan keduanya juga
memilikijumlahatomhidrogenyangberbeda.
22. Jawaban: b
CH
3
|
2,2-dimetil-propana:CH
3
CCH
3
(C
5
H
12
)
|
CH
3
CH
3
|
2-metil-propana:CH
3
CHCH
3
(C
4
H
10
)
2-metil-butana:CH
3
CHCH
2
CH
3
(C
5
H
12
)
|
CH
3
n-pentana:CH
3
CH
2
CH
2
CH
2
CH
3
(C
5
H
12
)
n-butana:CH
3
CH
2
CH
2
CH
3
(C
4
H
10
)
Titikdidihterendahdimilikiolehsenyawadengan
massa molekul relatif terkecil dan bercabang.
Senyawatersebutdimilikioleh2-metil-propana.
23. Jawaban: c
SenyawadenganrumusC
n
H
2n
merupakanalkena.
Senyawa alkena dapat mengalami reaksi
polimerisasi menjadi senyawa alkana dan
membentukmolekul-molekuldenganrantaiyang
sangat panjang. Sementara itu, oksidasi alkena
olehKMnO
4
menghasilkansenyawaglikol.
24. Jawaban: d
C
5
H
8
merupakan alkuna, dengan rumus umum
C
n
H
2n2
.Isomer-isomerC
5
H
8
sebagaiberikut.
1) CHCCH
2
CH
2
CH
3
1-pentuna
2) CH
3
C CCH
2
CH
3
2-pentuna
3) CH CCCH
3
|
CH
3
3-metil-butana
4) CH
2
=CH

CH
2
CH=CH
2
1,4-pentadiena
5) CH
2
=CHCH=CHCH
3
1,3-pentadiena
6) CH
3
CH=C=CHCH
3
2,3-pentadiena
7) CH
2
=CCH=CH
2
|
CH
3
2-metil-1,3-butadiena
Sementaraitu,CH CC CCH
3
adalah
1,3-pentadiuna.Senyawainimempunyairumus
molekulC
5
H
4
sehinggabukanisomerdariC
5
H
8
.
25. Jawaban: d
CH
3
CHCH
2
CHCH
3

||
CH
3
Cl
2-kloro-4-metil-pentana
CH
3
CHCH==CHCH
3
+HCl
|
CH
3
4-metil-2-pentena
26. Jawaban: c
CH
3
CH
2
CH
2
CH
3
+Cl
2
CH
3
CHCHCH
3
||
ClCl
2,3-dikloro-butana
Isomersenyawahasilreaksi:
1) CH
3
CHCHCH
3
:2,3-dikloro-butana
||
ClCl
2) CH
3
CH
2
CHCH
2
:1,2dikloro-butana
||
ClCl
3) ClCH
2
CH
2
CH
2
CH
2
:1,4-dikloro-butana
|
Cl
4) CH
3
CHCH
2
CH
2
:1,3-dikloro-butana
||
ClCl
5) Cl
|
CH
3
CCH
2
CH
3
:2,2-dikloro-butana
|
Cl
6) CH
3
|
CH
3
CCH
3
||
ClCl
1,2-dikloro-2-metil-propana
27. Jawaban: d
Titik didih senyawa dipengaruhi oleh massa
molekul relatif dan struktur rantai karbonnya.
Semakinkecilmassamolekulrelatifdansemakin
banyak cabang, titik didih senyawa semakin
rendah. Dengan demikian, titik didih tertinggi
dimilikiolehsenyawadenganmassamolekulrelatif
terbesar dengan struktur rantai lurus. Senyawa
CH
3
CH
2
CH
2
CH
2
CH
3
memilikititikdidih
tertinggi.
68 Kunci Jawaban dan Pembahasan
28. Jawaban: c

1
CH
3
CH
3
||
CH
3

2
CH
5
CH
6
CH
3
||

3
CH
2

4
CH
2
Rantaiterpanjangterdiriatas6atomC(heksana),
2 cabang (metil) terikat pada atom C nomor 2
dan 5 sehingga nama senyawa tersebut
2,5-dimetil-heksana.
29. Jawaban: c
RCH=CH
2
merupakanalkenaasimetris.Reaksi
padaalkenaasimetrisberlakuhukumMarkovnikoff.
AtomHdariasamhalidaakanterikatpadaatom
CberikatanrangkapyangmengikatatomHlebih
banyak. Namun, aturan Markovnikoff dapat
dibalikkan.Artinya,atomHdariasamhalidaakan
terikat pada atom C berikatan rangkap yang
mengikatatomHlebihsedikitsepertipadareaksi
diatasdenganmenambahkankatalisperoksida.
30. Jawaban: a
IsomercisterjadiapabilaatomCberikatanrangkap
mengikat gugus-gugus atom yang sama dalam
saturuangsepertipada .Sementara
itu, dan
merupakanisomertrans.
31. Jawaban: b
LPG (Liquified Petroleum Gases) terdiri atas
campuransenyawa-senyawahidrokarbondengan
jumlahatomCrendah,yaitupropanadanbutana.
32. Jawaban: a
Naftadihasilkandaripengolahanminyakbumipada
suhu70170C,bensindihasilkanpadasuhu35
75C,kerosindihasilkanpadasuhu3575C,so-
lardihasilkanpadasuhu250340C,sedangkan
aspaldihasilkanpadasuhu>500C.
33. Jawaban: d
Fraksiminyakmentahyangpertamadipisahkan
prosesdistilasibertingkatberupagasalam.Gas
alam dari proses ini diolah dan dicairkan,
digunakan sebagai bahan pengisi tabung untuk
bahanbakarkomporgas.Sementaraitu,pengeras
jalan menggunakan aspal, pelumas mesin
menggunakan oli, pelarut senyawa karbon
menggunakanpetroleumeter,sedangkanbahan
bakarmesindieselmenggunakansolar.
34. Jawaban: d
Fraksiminyakmentahyangdimanfaatkansebagai
insektisida adalah kerosin. Kerosin merupakan
fraksiminyakmentahyangmempunyairantaiatom
C
10
C
14
.Kerosinjugadigunakansebagaibahan
bakarpesawatterbang,minyakbakaruntukrumah
tangga,dansebagiandikertakmenjadibensin.Oli
digunakan sebagai pelumas mesin. Bensin
digunakansebagaibahanbakarkendaraanber-
motor.Solardigunakansebagaibahanbakarmesin
diesel.Parafindigunakansebagailampupenerangan.
35. Jawaban: c
Jumlahatomkarbon:
Nafta =812
Bensin =510
Residu =2628
Gasalam =14
Minyaktanah =1014
Jadi, fraksi minyak mentah yang mempunyai
jumlahatomkarbonpalingbanyakadalahresidu.
36. Jawaban: e
Minyakbumigolongannaftalenasebagianbesar
komponennyamerupakansenyawahidrokarbon
rantaitertutupatausiklis.Minyakbumigolongan
naftalenadigunakansebagaipengerasjalandan
bahanpelumas.
37. Jawaban: c
Cracking merupakan proses untuk memperoleh
bensin dengan cara pemecahan molekul besar
menjadimolekul-molekulkecilsepertipadareaksi
tersebut.Sementaraitu,distilasimerupakanproses
penyulingan bertingkat minyak mentah untuk
memisahkan fraksi-fraksinya. Knocking adalah
ketukanpadamesinyangditimbulkanolehproses
pembakaran bensin. Disosiasi adalah reaksi
penguraiansuatusenyawamenjadiunsur-unsur
penyusunnya.
38. Jawaban: c
n-heptanadiberibilanganoktan=0karenazatini
menimbulkanketukanyangsangattinggi.Bahan
bakaryangbernilaioktanrendahakanterbakar
tidak sempurna sehingga menghasilkan banyak
gasCO.
39. Jawaban: d
Bensindenganbilanganoktan82berartibensin
tersebutterdiriatascampuran82%isooktanadan
18% n-heptana. Jadi, perbandingan senyawa
isooktana:n-heptana=82:18.
40. Jawaban: d
Hasil pembakaran tidak sempurna dari minyak
bumiberupagasCOdanpartikulatPb.Keduazat
ini bersifat racun dan mengakibatkan dampak
negatifterhadapkesehatan.
69 Kimia Kelas X
B. Uraian
1. Larutanasamcukamerupakanlarutanelektrolit
lemahyangterionisasisebagiandalamair.Larutan
elektrolitlemahkurangbaikdalammenghantarkan
arus listrik. Oleh karena itu, larutan asam cuka
tidak dapat menyalakan lampu dan hanya
menghasilkansedikitgelembunggas.
2. a. Larutan elektrolit kuat berasal dari larutan
asamkuat,basakuat,dangaramyaituKBr,
NaOH,danCa(OH)
2
.
b. Larutanelektrolitlemahberasaldarilarutan
asam lemah dan basa lemah yaitu H
2
CO
3
,
H
2
S,danNH
4
OH.
c. Larutannonelektrolitberasaldarilarutanselain
asam, basa, dan garam yaitu CH
3
OH dan
CO(NH
2
)
2
.
3. a. Sn+4HNO
3
SnO
2
+4NO
2
+2H
2
O
0+5+4+4
oksidasi
reduksi
Oksidator=HNO
3
reduktor=Sn
Hasiloksidasi=SnO
2
Hasilreduksi=NO
2
b. Zn+2MnO
2
+2NH
4
ClZnCl
2
+Mn
2
O
3
+2NH
3
+H
2
O
0+4+2+3
oksidasi
reduksi
Oksidator=MnO
2
Reduktor=Zn
Hasiloksidasi=ZnCl
2
Hasilreduksi=Mn
2
O
3
4. Pb+PbO
2
+2H
2
SO
4
2PbSO
4
+2H
2
O
0+4+2
oksidasi
reduksi
Reaksikoproporsionasimerupakankebalikandari
reaksidisproporsionasi,yaitureaksiredoksdengan
hasil reduksi dan oksidasi sama. Pada reaksi
tersebut, hasil reduksi dan oksidasi berupa
senyawaPbSO
4
.
5. Senyawaalkanadisebutparafinkarenasenyawa
alkana memiliki ikatan yang sangat kuat pada
ikatanCCdanCH.Ikataninitidakmudah
putus meskipun dipanaskan pada suhu tinggi.
Selain itu, alkana juga sukar bereaksi dengan
pereaksikimiasepertizatreduktordanoksidator.
Olehkarenaalkanasukarbereaksi,alkanadisebut
parafin.
6. SenyawaGrignardadalahsenyawaberupaalkil
magnesiumhalidadenganrumusumumRMgX.
Senyawa ini digunakan untuk pembuatan
senyawa-senyawaorganiksepertialkana.Alkana
dapatdibuatdenganmereaksikanalkilmagnesium
halidadenganair.
Contoh:
CH
3
MgI(aq)+H
2
O()CH
4
(g)+MgOHI(aq)
Metil Metana
magnesium
iodida
7. Isomergeometriadalahisomeryangterjadipada
senyawa alkena. Isomer geometri dibedakan
menjadiduayaitucisdantrans.Isomercisterjadi
apabilaatomCberikatanrangkapmengikatgugus-
gugusatomyangsamadalamsaturuang.
Contoh:
CH
3
CH
3
GC=CH cis-2-butena
HH
Sementaraitu,isomertransterjadiapabilaatom
Cberikatanrangkapmengikatgugus-gugusalkil
yangberbedadalamsaturuang.
Contoh:
HBr
GC=CH trans-1,2-dibromo-etena
BrH
8. C
4
H
6
memiliki3isomer:
a. CH
3
CH
2
C

CH :1-butuna
b. CH
3
C

CCH
3
:2-butuna
c. CH
2
==CHCH==CH
2
:1,3-butadiena
9. Penggunaan senyawa n-heksana dapat
menurunkan efisiensi bensin karena n-heksana
memiliki nilai oktan sebesar 25. Keberadaan
senyawadengannilaioktanrendahdalambensin
dapatmenimbulkanketukanpadamesinselama
prosespembakaranbensin.Adanyaketukanini
mengakibatkanmesinbergetarsangathebatdan
menimbulkanpanasterlalutinggisehinggamesin
cepatrusak.
10. Kedalambensinberoktan65tersebutditambahkan
zataditifuntukmengurangiketukanpadamesin.
Misalnyaethyl fluidyangterdiriatascampuran65%
TEL,25%1,2-dibromoetana,dan10%1,2-dikloro
etana. Penambahan zat aditif ini mampu
meningkatkanefisiensibensindenganmenaikkan
bilangan oktan. Pada premium terjadi kenaikan
bilanganoktanantara8090.Sementaraitu,pada
bensinsuperbilanganoktannyanaikmenjadi98.