Anda di halaman 1dari 1158

KNJIGA JE KOMPLETNA

U TOKU JE LEKTURA I KOREKTURA TEKSTA


Poslednja izmena izvrena dana 21.10.2013.
Osho-Patanali
Izreke o jogi
Deset knjiga predavanja Oshoa o Patanjalijevim Joga sutrama,
odranih od 25.12.1973. do 10.5.1976. godine,
izdatih pod nazivom: Yoga, The Alpha and the Omega
Prevod:
Ivan Anti
Ivana Beker
Lektura, korektura i napomene:
Ivan Anti
2
PREDGOVOR
Kao da je posle vie hiljada godina sam Patanjali ponovo doao i progovorio o
svojim uvenim Joga sutrama, ali sada sve to nije prvi put rekao, sve to treba rei tako da
nita ne preostane, tako da i savremenom oveku budu savreno jasne. Takav se utisak stie
dok itamo ove Oshoove komentare.
Patanjalijeve Izreke o jogi ili Joga sutre su "Biblija za meditante", apsolutno
neophodne svakome ko namerava da medititra, ko ve medititra i onome ko misli da je ve
savladao meditaciju. Samo ovde moe saznati sutinu i svrhu prave meditacije i duhovnosti.
Joga sutre su najznaajnije delo na svetu koje iznosi ljudsku sutinu i praksu za
njenu aktuelizaciju ili konano ostvarenje. Nigde nije tako objektivno i precizno u rei
pretoena sutina ljudskog duha i svrha ljudske egzistencije kao u teorijskim postavkama
Sankhye, i nigde nije tako precizno dato reenje za ostvarenje smisla egzistencije u samom
oveku, korak po korak, usavravanjem oveka da on sam bude olienje ishoda stvarnosti,
praktinom primenom postavki Sankhye u jogi, kao to je to sainio Patanjali u ovom delu,
Joga sutre.
Ovo je jedini tekst u kome je sutina duhovnosti izneta potpuno objektivno, kao
nauka. Patanjali je sutinu duhovnosti i religioznosti - i praksu njenog ostvarenja u oveku -
izrazio na nauno precizan i izvodljiv nain. Savremena nauka tek danas otkriva neke istine o
oveku i svesti koje je on opisao tako davno. Zapravo, u tim vremenima, pre oko pet hiljada
godina, duhovnost je i bila samo nauka i praksa: joga. Tek kasnije je degradirana u religijske
kultove, mitove i rituale sa dolaskom Veda na indijski potkontinent. Vede predstavljaju
degradaciju i propast duhovne prakse probuenja koja se razvijala pre toga kod starosedelaca
u dolini Inda, a ostala je delimino ouvana i specifino prikazana samo u tradiciji sufija,
aina, jogina i budista, kao doktrina probuenja, ili ovekove pobede nad nesvesnim
uslovljavanjem. Ta degradacija je zatrla tu istu praksu ovekovog probuenja, i donela
procvat religija i teologija, od hinduizma do judeo-hrianstva i masovne kontrole uma koju
danas imamo na delu u mnogim oblicima.
Zahvaljujui Osho-vim prosvetljenim uvidima Patanjalijeve Izreke o jogi su u ovoj
knjzi postale najvea riznica svih znanja i uvida u sva iskustva bivstvovanja koja ljudsko bie
mora da proe da bi dolo do konanog uvida, osloboenja ili probuenja. Onom oveku koji
je dozreo do takvog uvida i osea neodoljivu tenju za meditacijom i duhovnom
posveenou, ova e knjiga pruiti konanu podrku i nepogreive, detaljne zavrne smernice
na tom putu osloboenja. Onima koji jo nisu stigli do kraja tog puta, ali napreduju na njemu,
koji jo uvek imaju neke sumnje i iskustva koja moraju da proive, ali ih istinska duhovnost
sve jae privlai, ova e knjiga pruiti neophodan pregled i kontekst celog tog procesa i
snano e ubrzati njihovo sazrevanje i buenje.
Daleko bolje od svih drugih komentatora Patanjalijevih Joga sutri, Osho je ovde
pokazao da o iskonskom putu ovekovog probuenja moe da svedoi samo onaj koji ga je
proao. Samo takav ovek moe snano da povue i druge da ostvare sopstveno probuenje.
Moda vie nego u ijednoj drugoj knjizi svojih govora, Osho je ovde dokazao da je najvei,
boanski propovednik. Jedinstvenost Oshoa je u tome, u ovoj knjzi snano izraena kao i u
celokupnom njegovom delu, to sve druge tradicije duhovnost nameu u principima i
okvirima svoje tradicije, dok Osho stalno i na sve naine beskompromisno naglaava da se
jedina prava duhovnost nikako ne moe prenositi i nametati tradicijom i verom, da je ona
samo rezultat linog probuenja kroz proces individuacije ili samospoznaje.
I kao da nije sluajno to se ovakav savreni svetionik od knjige javlja danas, kada je
opte buenje oveanstva u pogledu svih verskih, ideolokih i politikih manipulacija, i
prirode samog sveta u kome ivimo, vee i jae nego ikada.
Ivan Anti
Swami Anand Kapila
3
Osho
JOGA: ALFA I OMEGA
Knjiga prva
Poglavlje 1
UVOENJE NA STAZU JOGE
25. decembar 1973.
1
I, l: atha yognuasanam.
[Neka bi se upravo ovo to] sada [sledi uzelo za] jogistiko uenje.
I, 2: yogacittavrttinirodhah.
Yoga je u obustavljenosti [zamuujuih partikularnih] obrta u s-vesti
(cittavrtti).
I, 3: tada dratuh svarupe vasthanam.
[Samo] tada [u toj obustavljenosti partikularnih obrta] onaj koji vidi (dratr)
biva u skladu sa svojom pravom prirodom (svarupa).
I, 4: vrttisarupyamitaratra.
Inae se [ovek] poistoveuje sa [partikularnim] obrtima (vrtti) [vlastite
svesti].
2
Mi ivimo u dubokoj iluziji - iluziji o nadi, budunosti, sutranjici. ovek, ovakav
kakav jeste, ne moe da ivi bez samoobmane. Nie je negde rekao da ovek ne moe iveti
sa istinom; njemu trebaju snovi, trebaju mu obmane, potrebne su mu lai da bi postojao. Nie
je u pravu. ovek kakav je sada ne moe postojati sa istinom.
3
Ovo treba shvatiti vrlo duboko,
jer bez razumevanja toga, ne moe biti ulaska u istraivanje koje se zove joga.
Um treba duboko razumeti - um kome trebaju lai, um kome trebaju iluzije, um koji
ne moe postojati sa realnim, um kome trebaju snovi. Vi ne sanjate samo nou. ak i dok ste
budni, sanjate neprekidno. Moda gledate u mene, moda me sluate, ali struja sna tee unutra
u vama. Neprekidno um stvara snove, slike, fantazije.
Sada naunici kau da ovek moe iveti bez spavanja, ali ne moe iveti bez snova.
Odavno je shvaeno da je spavanje potrebno, ali sada moderno istraivanje kae da spavanje
nije zaista nuno. Spavanje je potrebno samo da biste mogli sanjati. Ako vam nije dozvoljeno
da sanjate a dozvoljeno da spavate, neete se ujutru oseati sveim, bodrim. Oseaete umor,
kao da uopte niste spavali.
U noi ima perioda - perioda za duboko spavanje i perioda za sanjanje. Postoji ritam -
upravo kao dan i no, postoji ritam. U poetku padate u dubok san oko 40-45 minuta. Onda
dolazi faza sanjanja, tada sanjate. Posle toga opet spavanje bez snova, pa onda opet sanjanje.
1
Predavanja su drana usmeno, snimljena i naknadno zapisana, stoga treba imati u vidu da ovaj prevod tih
predavanja, iako veran originalu, u nekim delovima nije jeziki ispravan sa duhom pisanog knjievnog jezika.
2
Ovde, i na poetku svakog poglavlja, dajemo najbolji prevod Joga sutri na srpski jezik sa sanskrita od Zorana
Zeca (Patanjali: Izreke o Jogi, Beograd, 1977) Ceo prevod te knjige dat je na kraju ove knjige. Oshov prevod sa
engleskog jezika nalazi se u tekstu njegovih komentara gde se esto ponavlja, tako da su oba prevoda sauvana i
mogu da se dopunjuju radi boljeg razumevanja sutri. Poneki komentari iz prevoda Zorana Zeca obeleeni su u
napomeni kao: Komentar Z.Z.
3
Ako je ovek nesvestan, neprobuen, onda je njegova potreba za iluzijama prirodan odraz njegovog stanja.
4
itave noi se to odvija. Ako je vae spavanje ometano za vreme dok spavate duboko bez
snova, ujutru neete oseati da vam je ita nedostajalo. Ali dok sanjate, ako je va san ometen,
onda ete se ujutru oseati sasvim umorni i iscrpljeni.
Sada se ovo moe znati spolja. Ako neko spava, vi moete oceniti da li sanja ili spava.
Ako sanja, njegove oi e se neprestano kretati - kao da gleda neto sa zatvorenim oima.
Kada on duboko spava, oi se nee kretati; one e ostati smirene. Dakle, dok se vae oi
pokreu, ako je vae spavanje tada ometano, ujutru ete oseati umor. Onda kada se vae oi
ne kreu, spavanje moe biti ometano, i ujutru neete oseati da vam ita nedostaje.
Mnogi istraivai su dokazali da se ljudski um hrani za vreme snova, san je nuan, a
san je totalna samoobmana. A to nije samo tokom noi; dok ste budni takoe isti obrazac
sledi; danju to ak moete primetiti. Ponekad e u umu ploviti san, ponekad nee biti snova.
Kada ima snova vi ete initi neto, ali ete biti odsutni. Unutra ete biti okupirani. Na
primer, vi ste ovde. Ako va um prolazi kroz stanje sanjanja, vi ete sluati mene a da me
uopte ne ujete, jer va um e biti okupiran unutra. Ako niste u stanju sanjanja, samo me
onda moete uti.
Danju, nou, um se stalno kree od nesanjanja do sna, onda od sna do nesanjanja. To
je jedan unutranji ritam. Ne samo da mi svesno sanjamo, u ivotu mi takoe projektujemo
nade u budunost.
Dananjica je gotovo uvek pakao. Moete produavati to samo zbog nade koju ste
projektovali u budunosti. Moete iveti danas zbog sutra. Nadate se da e se neto sutra
dogoditi - neka vrata raja e se sutra otvoriti. Ona se nikada ne otvaraju danas, a kada sutra
doe ono nee doi kao sutra, ono e doi kao danas, ali dotle va um se ponovo pomerio. Vi
se stalno kreete ispred sebe; to je ono ta znai sanjanje. Vi niste jedno sa realnim, onim to
je u blizini, onim to je ovde i sada, vi ste negde drugde - kreete se unapred, skaete napred.
A to sutra, tu budunost, vi ste imenovali na tako mnogo naina. Ljudi to nazivaju
nebom, neki ljudi to zovu moka (osloboenje), ali to je uvek u budunosti. Neko misli u
terminima bogatstva, ali to bogatstvo e biti u budunosti. Neko misli u terminima raja, a taj
raj e biti posle vae smrti - daleko u budunosti. Vi gubite svoju sadanjost za ono to nije; to
je ono ta sanjanje znai. Vi ne moete biti ovde i sada. To izgleda da je teko, da se bude
upravo u sadanjem trenutku.
Moete biti u prolosti zato to je opet to sanjanje - seanja, pamenje stvari kojih
nema vie, ili moete biti u budunosti, koja je projekcija, koja je opet kreiranje neega iz
prolosti. Budunost nije nita do opet projektovana prolost - mnogo ivopisnija, mnogo
lepa, ali to je profinjena prolost.
Ne moete misliti ni o emu drugom nego o prolosti. Budunost nije nita drugo do
ponovo projektovana prolost, a obe nisu. Sadanjost jeste, ali vi nikada niste u dananjici. To
je ono ta znai sanjanje. Nie je u pravu kada kae da ovek ne moe iveti sa istinom.
Njemu su potrebne lai, on ivi kroz njih. Nie kae da mi stalno govorimo da elimo istinu,
ali je niko ne eli. Nae takozvane istine nisu nita do lai, lepe lai. Niko nije spreman da
vidi golu stvarnost.
Takav um ne moe ui na stazu joge, jer joga oznaava metodologiju za otkrivanje
istine. Joga je metod da se doe do nesanjajueg uma. Joga je nauka da se bude u ovde i sada.
Joga znai da ste sada spremni da se ne kreete u budunost. Joga znai da ste sada spremni
da se ne nadate, da ne iskaete napred iz vaeg bia. Joga znai sresti se s realnou kakva
jeste.
Prema tome ovek moe ui u jogu, ili na stazu joge, samo kada je totalno izigran i
frustriran od svog vlastitog uma kakav on jeste. Ako se jo nadate da moete dobiti neto
kroz svoj um, joga nije za vas. Potrebna je totalna frustracija - otkrie da ovaj um koji
projektuje jeste beskoristan, um koji se nada jeste besmislica, on ne vodi nigde. On
jednostavno zatvara vae oi; on vas opija; on nikada ne dozvoljava realnosti da vam bude
otkrivena. On vas titi od realnosti.
Va um je opojno sredstvo, droga. On je protiv onoga to jeste. Stoga dok ne budete
totalno frustrirani sa svojim umom, sa svojim nainom postojanja, nainom na koji ste
postojali do sada, ako ga moete ostaviti bezuslovno, onda moete ui na stazu.
5
Mnogi su postali zainteresovani, ali vrlo mali broj ulazi jer vae interesovanje moe
biti samo radi vaeg uma. Vi se moda sada nadate, kroz jogu, da moete dobiti neto, ako
motiv postizanja postoji - da moete postati savreni kroz jogu, da moete postii blaeno
stanje savrenog postojanja, da moete postati jedno s brahmanom, da moete postii sat chit
anandu.
4
Ovo moe da bude uzrok zato se interesujete za jogu. Ako je to sluaj onda ne
moe biti susreta izmeu vas i staze koja je joga. Onda ste vi sasvim protiv nje, kreete se u
potpuno suprotnoj dimenziji.
Joga znai da sada ne postoji nada, da sada ne postoji budunost, da nema vie elja.
ovek je spreman da zna ta jeste. ovek nije zainteresovan za ono ta moe biti, ta treba da
bude, da bi ita trebao da bude. ovek nije zainteresovan! ovek je zainteresovan samo za
ono to jeste, jer samo realno moe da vas oslobodi, samo realnost moe da postane
osloboenje.
Potrebna je potpuna beznadenost. Buda (Buddha)
5
je oajanje nazvao dukha. Ako ste
zaista u patnji, ne nadajte se, jer vaa nada e samo prolongirati jad. Vaa nada je opojno
sredstvo. Moe vam pomoi samo da stignete do smrti i nigde vie. Sve vae nade mogu vas
dovesti samo do smrti. One tamo vode.
Postanite potpuno beznadeni - nema budunosti, nema nade. Teko razumljivo.
Potrebna je odvanost da se hrabro podnese realnost. Meutim, takav trenutak dolazi
svakome, pre ili kasnije. Svakom ljudskom biu doe trenutak kada se osea potpuno
beznadeno. Dogodi mu se apsolutna besmislenost. Kada on postane svestan da je beskorisno
ta god da ini, gde god da ide, to ne vodi nikuda, itav ivot je bez znaaja - iznenada nade
ga ostavljaju, budunost naputa, i po prvi put vi ste usaglaeni sa sadanjim, po prvi put ste
licem u lice sa realnou.
Dok taj trenutak ne doe vi moete nastaviti da radite asane, poloaje; ali to nije
joga. Joga je okretanje unutra. To je totalan zaokret. Kada se ne kreete u budunost, ne
kreete se prema prolosti, onda zapoinjete da se kreete ka sebi - jer vae bivanje je ovde i
sada, ono nije u budunosti. Vi ste prisutni ovde i sada, vi moete ui u ovu realnost. Ali onda
um mora biti ovde.
Ovaj momenat je oznaen prvom Patanjalijevom sutrom. Pre nego to zaponemo
govoriti o prvoj sutri, nekoliko stvari treba razumeti. Prvo, joga nije religija - zapamtite to.
Joga nije hinduistika ili muslimanska. Joga je ista nauka, ba kao matematika, fizika ili
hemija. Fizika nije hrianska, fizika nije budistika. Ako su hriani otkrili zakone fizike,
onda nije zato fizika hrianska. Samo su sluajno hriani otkrili zakone fizike. Ali fizika
ostaje samo nauka. Joga je nauka - samo ju je sluajno otkrio hindus.
6
Ona nije hinduistika.
To je ista matematika o unutranjem bivanju. Tako musliman moe biti jogi, ain moe biti
jogi, hrianin moe biti jogi, budista moe biti jogi.
Joga je ista nauka, a Patanjali je najvee ime to se tie sveta joge. Taj ovek je
izuzetan. Niko se ne moe uporediti sa njim. Po prvi put u istoriji oveanstva ovaj ovek je
doveo religiju do stanja nauke; on je nainio religiju naukom, oevidnim zakonima; nikakva
vera nije potrebna.
Takozvane religije trebaju verovanje. Ne postoje druge razlike izmeu jedne religije i
druge; razlika je samo u verovanju. Musliman ima odreena verovanja, hindu neka druga, a
hrianih neka trea. Razlika je u verovanjima. Joga nema niega to se tie verovanja; joga
4
Sat - bitak, chit - svest, ananda - blaenstvo. To je klasian opis stvarnosti ili budnosti u vedanti po kojoj je
ovekova sutina jedno sa brahmanom - apsolutom.
5
Buddha je ispravan nain pisanja imena osnivaa budizma Sidarte Gautame. Izgovara se sa dva sloga: 'bud' i
'dha', i znai 'probueni'. Ipak ovde emo se drati ve prihvaenog pisanja i izgovora: Buda.
6
Ovde je potrebna mala ispravka: joga je mnogo starija od pojave hinduizma. Ona potie iz kulture Mohendo
Daro civilizacije u dolini Inda, koja nema nieg zajednikog sa hinduizmom i vie hiljada godina je starija od
naseljavanja indijskog potkontinenta. Zapravo, kada su arijevci sa iranske visoravni naseljavali indijski
potkontinent, i nosili sa sobom osnove hinduizma, Vede, sukobili su se sa kulturom u dolini Inda i porazili je. To
je opisano u epu Mahabharata, tanije u delu tog epa koji je poznat kao Bhagavad Gita. Sutina duhovnosti u
Bhagavad Giti potie od starosedelaca, a to je uenje o sankhyi i yogi. To je uenje ateistika praksa duhovnog
probuenje ovekovog. Arijevci su je samo preuzeli i pomeali sa svojim vedskim uenjima posveenim raznim
bogovima i rtvovanjima. Iz te meavine nastao je hinduizam kakvog danas znamo.
6
ne kae da veruje ni u ta. Joga iskazuje iskustvo. Upravo kao to nauka kazuje
eksperimentom; joga govori iskustvom. Eksperiment i iskustvo su oboje isti, njihova podruja
su razliita. Eksperiment znai neto to vi moete vriti spolja; a iskustvo oznaava neto to
vi moete initi unutra. Iskustvo je jedan unutranji eksperiment.
Nauka kae: ne verujte, sumnjajte onoliko koliko moete. I takoe, nemojte da ne
verujete, jer neverovanje je opet vrsta verovanja. Vi moete verovati u Boga, vi moete
verovati u koncept ne-Boga. Moete rei Bog postoji, sa fanatinim gleditem, moete rei
sasvim suprotno, da Bog ne postoji s istim fanatizmom. Ateisti, teisti, svi su vernici, a vera
nije oblast za nauku. Nauka znai iskusiti neto, ono to jeste; nije potrebna vera. Dakle,
druga stvar koju treba zapamtiti: joga je egzistencijalna isksutvena i eksperimentalna.
Nikakva vera se ne zahteva, nikakva vera nije potrebna - samo odvanost da se iskusi. A to je
ono to nedostaje. Vi moete verovati lako jer u verovanju neete biti preobraeni. Vera je
neto vama dodato, neto povrno. Vae bie se ne menja; vi ne prolazite kroz neku promenu.
Moete biti hindu, moete postati hrianin sledeeg dana. Jednostavno promenite: promenite
Gitu za Bibliju. Moete da je promenite za Kuran, meutim ovek koji je drao Gitu a sada
dri Bibliju, ostaje isti. On je promenio svoja verovanja.
Verovanja su kao odea. Nita bitno se ne preobraava; vi ostajete isti. Analizirajte
hindusa, ispitajte muslimana, unutra su oni isti. On odlazi u hram, musliman mrzi hram.
Musliman ide u damiju, a hindus mrzi damiju, ali iznutra oni su ista ljudska bia.
Vera je laka jer se od vas ne zahteva zapravo da inite nita - samo povrinsko
doterivanje, dekorisanje, neto to moete odloiti na stranu svakog momenta kada hoete.
Joga nije verovanje. Zbog toga je teka, naporna, ponekad izgleda nemogua. To je jedan
egzistencijalni pristup. Vi ete doi do istine, ali ne kroz veru, nego kroz svoje vlastito
iskustvo, kroz vae vlastito ostvarenje. To znai da ete morati potpuno da se promenite. Vaa
gledita, va nain ivota, va um, vaa psiha kakva jeste mora potpuno da se razbije. Neto
novo mora da se stvori. Samo s tim novim vi ete doi u kontakt s realnou.
Dakle, joga je oboje, i smrt i novi ivot. Ovakvi kakvi jeste vi ete morati umreti, a
dok ne umrete novo se ne moe roditi. Novo je skriveno u vama. Vi ste samo seme za to, a
seme mora pasti dole, apsorbovano od zemlje. Seme mora da umre; samo onda novo e se
pojaviti iz vas. Vaa smrt e vam doneti novi ivot. Joga je oboje: smrt i novo roenje. Dok
niste spremni da umrete, ne moete biti preporoeni. Dakle to nije pitanje promene verovanja.
Joga nije filozofija. Ja tvrdim da nije religija, kaem i da nije filozofija. To nije neto
o emu moete razmiljati. To je neto to morate biti; razmiljanje nee biti dovoljno.
Miljenje se odvija u vaoj glavi. Ono ne zadire duboko do korena vaeg bia; ono nije vaa
celokupnost. Ono je samo deo, funkcionalni deo; ono se moe uvebati. I vi moete da
rasuujete logino, moete misliti racionalno, ali vae srce e ostati isto. Vae srce je va
najdublji centar, va glava je samo grana. Moete biti bez glave, ali ne moete biti bez srca.
Vaa glava nije osnovna.
Joga se odnosi na vae celokupno bie, s vaim korenom. To nije filozofiranje. Dakle,
sa Patanjalijem neemo postati mislioci, spekulativci. Sa Patanjalijem pokuaemo da
saznamo najvie zakone bivanja; zakone transformacije bia, zakone kako umreti i kako se
ponovo roditi, zakone novog poretka postojanja. Zbog toga ja jogu nazivam naukom.
Patanjali je izuzetan. On je prosvetljena osoba, kao Buda, kao Krina, kao Hrist, kao
Mahavira, Muhamed, Zaratustra, ali je razliit na jedan nain. Niko od Bude, Krine,
Mahavire, Zaratustre, Muhameda nema nauno gledite. Oni su veliki osnivai religija. Oni su
izmenili ceo obrazac ljudskog uma i njegovu strukturu, ali njihov pristup nije nauan.
Patanjali je kao Ajntajn u svetu Buda. On je fenomen. On bi lako dobio Nobelovu
nagradu kao Ajntajn, ili Bor, Maks Plank ili Hajzenberg. On ima isto gledite, isti pristup
strogog naunog uma. On nije pesnik; Krina je pesnik. On nije moralista; Mahavira je
moralista. On je u osnovi naunik, koji razmilja u terminima zakona. On je doao da izvede
apsolutne zakone ljudskog postojanja, najviu radnu strukturu ljudskog uma i realnosti.
I ako sledite Patanjalija, saznaete da je on tako taan kao matematika formula.
Jednostavno inite ono ta on kae i rezultat e se postii. Rezultat se garantovano postie; to
je upravo kao dva plus dva, oni postaju etiri. To je ba kao kada zagrevate vodu do 100
7
stepeni celzijusovih i ona isparava. Vera nije potrebna; jednostavno inite to i znate. To je
neto to treba uraditi i znati. Zbog toga ja kaem ne postoji poreenje. Na ovoj planeti nikada
nije postojao ovek kao Patanjali.
Vi moete nai u Budinim govorima, poeziju - garantovano da je tamo. Mnogo puta
dok je Buda izraavao sebe, on je postajao pesnik. Kraljevstvo ekstaze, podruje najvieg
saznavanja, takoe je lepo, iskuenje je tako veliko da se postane poetian, lepota je takva,
blagoslov je takav, blaenstvo je takvo da ovek zapoinje da misli poetskim jezikom.
Meutim, Patanjali se odupreo tome. On je sasvim razliit. Niko nije mogao da se
odupre. Isus, Krina, Buda, svi su postali pesnici. Sjaj, lepota, kada to bukne u vama, poeete
da pleete, poeete da pevate. U tom stanju vi ste kao ljubavnik koji se zaljubio u itav
univerzum.
Patanjali se odupreo tome. On nje koristio poeziju; nikada nije upotrebio nijedan
pesniki simbol. Nije se bavio poezijom; nije govorio u terminima lepote. On je govorio samo
u matematikim terminima. On je bio egzaktan, i dao vam je maksime (mudre izreke). Ove
izreke su samo naznake ta treba da se uradi. On nije buknuo u ekstazi; nije rekao stvari koje
se ne mogu rei; nije istraivao nemogue. On je samo poloio temelj, a ako sledite temelj
dospeete do vrha koji je iznad. On je strog matematiar - zapamtite to.
Prva sutra:
A sada, disciplina joge
Atha joganushasanam
A sada disciplina joge. Svaku pojedinu re treba shvatiti jer Patanjali nije koristio
nijednu suvinu re.
A sada, disciplina joge.
Prvo pokuajte da razumete re sada. Ovo sada pokazuje stanje uma o kome vam
upravo govorim.
Ako ste se oslobodili iluzija, ako ste bez nade, ako ste potpuno postali svesni
nitavnosti svih elja, ako vidite svoj ivot kao besmislen - bilo ta da ste radili do sada
jednostavno je umrlo, nita nee ostati u budunosti, vi ste u apsolutnoj beznadenosti - to
Kjerkegor zove agonijom. Ako ste u agoniji, patnji, neznajui ta da inite, neznajui gde da
idete, neznajui u koga da gledate, upravo na ivici ludila, samoubistva ili smrti, ceo va
obrazac ivota iznenada je postao nitavan. Ako takav trenutak nastupi, Patanjali kae: "Sada
disciplina joge." Samo tada moete razumeti nauku o jogi, disciplinu joge.
Ako taj trenutak ne doe, moete nastaviti da izuavate jogu, moete postati veliki
uenjak, ali neete biti jogi. Moete napisati rasprave o jogi, moete drati predavanja o njoj,
ali neete biti jogi. Nije doao taj trenutak za vas. Intelektualno moete postati zainteresovani,
kroz va um moete biti povezani s jogom, ali joga nije nita ako nije disciplina. Joga nije
shastra; to nije spis. To je disciplina. To je neto to morate da uinite. To nije neobinost, to
nije filozosko mozganje. Ona je dublja od toga. To je pitanje ivota i smrti.
Ako je doao trenutak kada oseate da su svi pravci ometeni, svi putevi su iezli;
budunost je mrana, a svaka elja je postala gorka, i kroz svaku elju ste upoznali samo
razoarenje; svi pokreti u nade i snove su obustavljeni:
A sada, disciplina joge.
Ovo sada moda nije dolo. Onda ja mogu govoriti o jogi, ali vi neete sluati. Vi
moete sluati samo ako je taj trenutak prisutan u vama.
Jeste li zaista nezadovoljni? Svako e rei: "Da", ali to nezadovoljstvo nije stvarno. Vi
ste nezadovoljni sa ovim, moete biti nezadovoljni sa onim, ali niste totalno nezadovoljni. Vi
se jo nadate. Nezadovoljni ste zbog svojih prolih nadanja, ali za budunost se jo nadate.
Vae nezadovoljstvo nije potpuno. Jo uvek prieljkujete neko zadovoljstvo negde, neku
nagradu negde.
Ponekad se oseate beznadeno, ali ta beznadenost nije istinita. Oseate
beznadenost jer odreena nada nije ostvarena, odreena nada je propala. Ali nadanje je jo
uvek prisutno; nadanje nije propalo. Vi ete se jo nadati. Nezadovoljni ste s ovom nadom,
8
onom nadom, ali niste nezadovoljni sa nadom kao takvom. Ako ste s nadom kao takvom
razoarani, doao je trenutak kada moete ui u jogu. Onda ovaj ulazak nee biti samo
mentalna, spekulativna pojava. Ovaj ulazak e biti ulazak u disciplinu.
ta je disciplina? Disciplina oznaava kreiranje reda u vama. Kakvi jeste, vi ste haos.
Kakvi jeste, vi ste neuredni. Gurijev je imao obiaj da kae - a Gurijev je na mnogo naina
slian Patanjaliju: on je opet pokuao da naini sr religije naukom - Gurijev kae da vi
niste jedan, vi ste gomila, ak i kada kaete: "Ja", ne postoji neko ja. U vama ima mnogo
ja, ali nikada ne postajete svesni ovog nereda jer ko e postati svestan toga? Ne postoji
centar koji moe postati svestan.
"Joga je disciplina" znai joga eli da stvori kristalisani centar u vama. Takvi kakvi
jeste, vi ste gomila, a gomila ima mnogo pojava. Jedna je da ne moete verovati gomili.
Gurijev bi obino rekao da ovek ne moe obeati. Ko e obeati? Vi niste prisutni. Ako
obeate, ko e ispuniti obeanje? Sledeeg jutra onog koji je obeao vie nema.
Ljudi dou kod mene i kau: "Sada u poloiti zavet. Obeavam da u uiniti ovo." Ja
im kaem: "Razmislite dva puta pre nego to obeate neto. Jeste li sigurni da e sledeeg
jutra biti tu onaj ko je obeao?" Vi odluite da ustajete rano ujutru od sutra - u etiri sata. A u
etiri sata neko u vama kae: "Ne sekiraj se. Tako je hladno napolju. Zato se toliko uri? Mi
to moemo uraditi ujutru." I ponovo zaspite.
Kada ustanete vi se kajete. Mislite, "Ovo nije dobro, trebao sam to da uradim."
Odluujete ponovo "Sutra u to uraditi", a isto e se desiti i sutra jer u etiri ujutru onaj koji je
obeao nije vie tu, neko drugi je u krevetu. Vi ste Rotary Club: predsedavajui se stalno
menja. Svaki lan postaje rotirajui predsedavajui. Postoji kruenje. Svakog momenta neko
drugi je glavni.
Gurijev je obino govorio: "Ovo je glavna karakteristika oveka, da on ne moe
obeati." Vi ne moete ispuniti obeanje. Nastavljate da dajete obeanja, a dobro znate da ih
ne moete ispuniti, jer vi niste jedan: vi ste nered, haos. Otuda, Patanjali kae: "A sada
disciplina joge." Ako je va ivot postao apsolutna patnja, ako ste shvatili da ta god uinite
stvara pakao, onda je trenutak doao. Ovaj trenutak moe promeniti vau dimenziju, pravac
vaeg postojanja.
Do sada ste iveli kao haos, gomila. Joga znai, sada ete morati biti harmonija,
moraete da postanete jedan. Nuna je kristalizacija; potrebno je usreditavanje. Dok ne
dostignete centar, sve to inite jeste beskorisno. To je traenje ivota i vremena. Centriranje
je prvo potrebno, a jedino moe biti blaen onaj ko je zadobio sredite. Svako trai to, ali vi
ne moete zahtevati. Vi treba to da zasluite! Svako ezne za blaenim stanjem postojanja, ali
samo centar moe biti blaen. Mnotvo ne moe biti blaeno, gomila nema Sopstvo, nema
atmana koji e biti blaen.
Blaenstvo podrazumeva apsolutnu tiinu, a tiina je mogua samo kada postoji
harmonija - kada su svi neskladni fragmenti postali jedno, kada ne postoji mnotvo, ve
jedno. Kada ste vi sami u kui i niko drugi nije tu, biete blaeni. Upravo sada svako drugi je
u vaoj kui, samo vi niste tamo. Samo gosti su tamo, domain je uvek odsutan. A samo
domain moe biti blaen.
Usreditavanje Patanjali naziva disciplinom - anushasanam. Re disciplina je lepa.
Ona dolazi iz istog korena odakle i re disciple dolazi. Disciplina znai sposobnost da se
ui, kapacitet da se zna. Inae vi ne moete znati, vi ne moete uiti, dok niste dostigli
sposobnost da budete ili postojite.
Jednom je jedan ovek doao kod Bude i rekao Mora da je bio drutveni reformator,
revolucionar. Rekao je Budi: "Svet je u patnji. Slaem se s vama". Buda nikada nije rekao da
je svet u patnji. Buda kae: "Vi ste patnja", ne svet. "ivot je patnja", ne svet. "ovek je
patnja", ne svet. "Um je patnja", ne svet. Ali taj revolucionar je rekao: "Svet je u patnji. Ja se
slaem s vama. Kaite mi sada ta mogu uiniti? Imam duboko saoseanje, i elim da sluim
oveanstvu."
Sluenje mora da je njegov moto. Buda ga je pogledao i ostao nem. Budin uenik
Ananda je rekao: "Taj ovek izgleda da je iskren. Uputite ga. Zato utite?" Onda je Buda
rekao buntovniku: "Vi elite da sluite svetu, ali gde ste vi? Ja ne vidim nikoga unutra.
9
Gledam u vas, tamo nema nikoga."
"Vi nemate nikakvo sredite, a dok ne budete usrediteni ta god da inite stvarae
vie smutnje." Svi vai drutveni reformatori, vai revolucionari, vai lideri, oni su veliki
stvaraoci smutnje, trgovci smutnjom. Svet bi bio bolji da nije bilo lidera. Inae oni ne mogu
pomoi. Oni moraju uiniti neto zato to je svet u patnji. A oni nisu usrediteni, tako da ta
god uine stvaraju vie patnje. Samo saoseanje nee pomoi, samo sluenje nee pomoi.
Saoseanje kroz usrediteno postojanje je neto sasvim razliito. Saoseanje kroz mnotvo je
propast. Takva samilost je otrov.
A sada, disciplina Joge.
Disciplina oznaava sposobnost da se postoji, sposobnost da se zna, kapacitet da se
ui. Moramo nauiti ove tri stvari.
Sposobnost da se bude. Svi joga poloaji ne bave se stvarno s telom, bave se
sposobnou da se postoji. Patanjali kae da ako moete sedeti tiho bez kretanja vaeg tela
za nekoliko sati, raste vaa sposobnosti da postojite. Zato se kreete? Ne moete sedeti bez
kretanja ak ni za nekoliko sekundi. Vae telo zapoinje da se kree. Negde oseate svrab,
noge postaju umrtvljene; mnoge stvari zapoinju da se dogaaju. Ovo su samo izgovori za vas
da se pokreete.
Vi niste gospodar. Ne moete rei telu: "Sada za jedan sat se neu pokretati." Telo e
se odmah pobuniti. Odmah e vas prisiliti da se pokrenete, da uradite neto, a ono e dati
razloge: "Morate se pokrenuti jer vas komarac ujeda." Moda neete nai komarca kada
pogledate. Vi niste bie, vi ste strepnja - neprekidna grozniava aktivnost. Patanjalijeve
asane, poloaji, se ne bave ni sa kojom vrstom fiziolokog treninga, ve unutranjim
treningom bia, samo da se bude - bez injenja iega, bez ikakvih pokreta, bez ikakve
aktivnosti, samo da se postoji. Samo to ostajanje u postojanju pomoi e u usreditenju.
Ako moete ostati u jednom poloaju, telo e postati rob; sledie vas. A to vas vie
telo sledi, imaete vee postojanje unutar sebe, jae postojanje unutar vas. I zapamtite, ako se
telo ne pokree, va um ne moe da se kree, jer um i telo nisu dve stvari. Oni su dva pola iste
pojave. Vi niste telo i um, vi ste telo-um. Vaa linost je psiho-somatska - psiho-fizika. Um
je najsuptilniji deo tela. Ili moete rei obrnuto, da je telo najgrublji deo uma.
Tako ta god da se desi u telu deava se i u umu. I obrnuto: to god se desi u umu
deava se i telu. Ako se telo ne pokree i vi moete ostati u jednom poloaju, ako moete rei
telu: "Budi mirno", um e ostati miran. Zaista, um zapoinje kretanje i pokuava da pokrene
telo, jer ako se telo kree onda i um moe da se kree. U nepokretnom telu, um se ne moe
pokretati; njemu je potrebno pokretno telo.
Ako se telo ne kree, um se ne kree, vi ste usrediteni. Ovaj nepokretan poloaj nije
samo fizioloko treniranje. On samo stvara situaciju u kojoj usreditenje moe da se dogodi, u
kojoj moete postati disciplinovani. Kada vi jeste, kada ste postali usrediteni, kada saznate
ta znai postojati, onda moete uiti, jer ete biti ponizni, skromni. Onda se moete predati.
Onda nikakav lani ego nee prianjati uz vas jer kada ste jednom usrediteni vi znate da su svi
egoi lani. Onda se moete pokloniti. Onda se raa disciplina.
Disciplina je veliko postignue. Samo kroz disciplinu moete postati uenik. Samo
bivajui usrediteni vi moete postati ponizni, prijemivi, postati prazni, i guru, uitelj, moe
sebe izliti u vas. U vaoj praznini, ako ste tihi, on moe doi i dopreti do vas. Komunikacija
postaje mogua.
Uenik je onaj ko je usrediten, ponizan, prijemiv, otvoren, spreman, budan, usluan,
poboan. U jogi, uitelj je vrlo, vrlo vaan, apsolutno vaan, jer samo kada ste u neposrednoj
blizini bia koje je usrediteno vae vlastito usreditenje e se desiti.
To je znaenje satsanga. Jeste li uli re satsang? Ona je sasvim pogreno koriena.
Satsang oznaava neposrednu blizinu istine; ona znai blizu istine, znai blizu uitelja koji je
postao jedno s istinom - samo biti blizu njega, otvoren, prijemiv i ekati. Ako je to u vama
postalo duboko i jako, duboka prisnost e se dogoditi.
Uitelj nee initi nita. On je jednostavno tu, na raspolaganju. Ako ste vi otvoreni, on
e strujati unutar vas. Ovo strujanje se naziva satsang. S uiteljem vi ne treba da uite nita
drugo. Ako moete nauiti satsang, to je dovoljno - ako samo moete biti pokraj njega bez
10
pitanja, bez razmiljanja, bez raspravljanja; samo prisutni tu, na raspolaganju, tako da bie
uitelja moe da se izlije u vas. A bie moe da tee. Ono ve tee. Kad god osoba postigne
integritet, njeno bie postaje zraee.
Ono nadolazi. Bilo da ste vi prisutni da primate ili ne, to nije vano. Ono tee kao
reka. Ako ste vi prazni kao posuda, spremni, otvoreni, ono e se uliti u vas.
Uenik oznaava nekoga ko je spreman da prima, ko je postao materica - uitelj moe
da prodre u njega. Ovo je znaenje rei satsang. To u osnovi nije propoved, predavanje;
satsang nije rasprava. Rasprava moe biti prisutna, ali raspravljanje je samo jedan izgovor. Vi
ste ovde, a ja u govoriti o Patanjalijevim sutrama. To je samo jedan izgovor. Ako ste vi
zbilja ovde, onda rasprava, razgovor, postaje samo jedan izgovor za vas da budete ovde. To je
samo jedan izgovor. A ako ste vi zaista ovde, satsang poinje. Ja mogu tei a to strujanje je
snanije od bilo kog govora, svake komunikacije kroz jezik, od svakog intelektualnog susreta
s vama.
Dok je va um angaovan, ako ste uenik, ako ste disciplinovano bie, va um je
uposlen u sluanju mene, vae bie moe biti u satsangu. Onda je vaa glava zauzeta, vae
srce je otvoreno. Onda na dubljem nivou, susret se deava. Taj susret je satsang, a sve drugo
je samo jedno opravdanje, samo da se nau putevi da se bude blizu uitelja.
Bliskost je sve, ali samo uenik moe biti blizak. Bilo ko i svako ne moe biti blizak.
Bliskost znai odano poverenje. Zato nismo bliski? Jer ima straha. Prevelika blizina moe
biti opasna, prevelika otvorenost moe biti opasna, jer vi postajete ranjivi, a onda e biti teko
odbraniti se. Stoga samo radi sigurnosne mere mi drimo svakog na ostojanju, nikada ne
dozvoljavamo da pree dozvoljeno rastojanje.
Svako ima teritoriju oko sebe. Kad god neko ue u vau teritoriju vi postanete
uplaeni. Svako ima prostor za zatitu. Vi sedite sami u svojoj sobi. Stranac ue u sobu. Samo
posmatrajte kako postajete zaista uplaeni. Postoji jedna taka, a ako on pree tu taku, iza te
take vi ete biti preplaeni. Osetie se iznenadno drhtanje. Izvan odreene teritorije on se
moe kretati.
Biti blizak znai da sada nema vae vlastite teritorije. Biti blizak znai biti ranjiv, biti
blizak znai da ta god da se dogodi vi ne razmiljate u terminima sigurnosti.
Uenik moe biti blizak iz dva razloga. Jedan je da je on usrediten, on pokuava da
bude usredsreen. Osoba koja pokuava da bude usreditena postaje neuplaena, ona postaje
neustraiva. Ona ima neto to se ne moe ubiti. Vi nemate nita, otuda strah. Vi ste gomila,
mnotvo. Mnotvo moe biti rasuto svakog momenta. Vi nemate neto kao stena to e biti tu
ta god da se dogodi. Bez stene, bez temelja vi postojite kao kua od karata, obavezna da bude
uvek u strahu. Bilo kakav vetar, ak svaki povetarac, moe da je uniti, tako da morate da
zatitite sebe.
Zbog ove konstantne bezbednosti, vi ne moete voleti, ne moete verovati, vi ne
moete biti prijatelj. Moete imati mnogo prijatelja ali tu ne postoji prijateljstvo, jer
prijateljstvu je potrebna bliskost. Moete imati ene i mueve i takozvane ljubavnike, ali tu
nema ljubavi, jer ljubav trai bliskost, ljubavi treba poverenje. Moete imati gurue, uitelje,
ali nema uenitva, jer vi ne moete dozvoliti sebi da budete totalno odani neijem biu, u
blizini njegovog bia, bliski njegovom biu, tako da on ne moe da vas nadvlada, da vas
preplavi.
Uenik oznaava tragaoca koji nije mnotvo, koji pokuava da bude usrediten i
kristalizovan, barem pokuavajui, inei napor, iskreni napor da postane individua, da osea
svoje bie, da postane svoj vlastiti gospodar. Sva disciplina joge je jedan napor da vas naini
gospodarem vas samih. Takvi kakvi jeste vi ste samo rob mnogih, mnogih bolesti. Mnogi,
mnogi gospodari postoje, a vi ste samo rob - i razvueni ste u mnogim pravcima.
A sada, disciplina joge.
Joga je disciplina. To je jedan napor s vae strane da promenite sebe. Mnoge druge
stvari moraju se razumeti. Joga nije terapija. Na zapadu mnogi psiholoke terapije su
rasprostranjene danas, i mnogi zapadni psiholozi misle da je joga takoe terapija. Ona to nije!
Ona je disciplina. A kakva je razlika? Ovo je razlika: terapija je potrebna ako ste bolesni,
terapija je potrebna ako ste oboleli, terapija je potrebna ako ste u patolokom stanju.
11
Disciplina je potrebna ak i kada ste zdravi. Zaista, kada ste zdravi samo disciplina moe
pomoi onda.
To nije za patoloke sluajeve. Joga je za one koji su potpuno zdravi, ukoliko je
medicinska nauka u pitanju, normalni. Oni nisu izofrenini; oni nisu ludi, oni nisu neurotini.
Oni su normalni ljudi, zdravi ljudi bez odreene patologije. Pri svemu tome oni su svesni da
ta god da se naziva normalnou jeste beskorisno, ma ta da se naziva zdravljem nije od
koristi. Neto vie je potrebno, neto vee je potrebno, neto svetije i celovitije je potrebno.
Terapije su za bolesne ljude. Terapije vam mogu pomoi da doete do joge, ali joga
nije za terapiju. Joga je za vii red zdravlja, razliit od sree - razliitog tipa bitisanja i
celovitosti. Terapija moe, uglavnom, da vas uini prilagoenim. Frojd kae da mi ne
moemo uiniti vie. Mi vas moemo uiniti prilagoenim, normalnim lanom drutva - ali
ako je drutvo samo patoloko, ta onda? A to i jeste! Samo drutvo je bolesno. Terapija vas
moe uiniti normalnim u smislu da ste prilagoeni drutvu, ali samo drutvo je bolesno!
Tako ponekad se deava da se u jednom bolesnom drutvu za zdravu osobu misli da je
bolesna. Mislilo se da je Isus bolestan, i svi napori su uloeni da se on dovede u red. A kada
se nalo da je on beznadean sluaj, onda je razapet na krst. Kada se nalo da se nita ne moe
uiniti, da je taj ovek neizleiv, onda je raspet. Drutvo je samo bolesno jer nije nita drugo
nego vaa zajednica. Ako su svi lanovi bolesni, drutvo je bolesno, a svaki lan mora biti
podeen prema njemu.
Joga nije terapija; joga nije ni na koji nain pokuaj da vas uini prilagoenim
drutvu. Ako elite da definiete jogu u terminima prilagoavanja, onda to nije podeavanje sa
drutvom, ve je to izmirenje sa samom egzistencijom. To je usklaivanje sa boanskim!
Dakle, moe se dogoditi da vama savreni jogi izgleda lud. Moe izgledati da je van
svoje ulnosti, izvan svog uma, jer je on sada u dodiru sa monijim, s viim umom, viim
redom stvari. On je u dodiru sa univerzalnim umom. Uvek se deavalo tako: Buda, Isus,
Krina, oni su uvek izgledali nekako ekscentrini. Oni ne pripadaju nama; izgledaju kao
strana lica.
Zbog toga mi njih nazivamo avatarima, stranim licima. Oni kao da su doli s druge
planete; oni ne pripadaju nama. Oni mogu biti vii, mogu biti ispravni, mogu biti boanski, ali
oni ne pripadaju nama. Oni su doli odnekuda drugde. Oni nisu deo i paket naeg postojanja,
oveanstva. Ostalo je oseanje da su oni strana lica; a oni to nisu. Oni su stvarni insajderi jer
su dotakli najskriveniju sr egzistencije. Ali nama oni tako izgledaju.
A sada, disciplina joge.
Ako je va um shvatio da ta god ste radili do sada je bilo potpuno besmisleno, da je
bilo nona mora u najgorem, a lep san u najboljem sluaju, onda se staza discipline otvorila
pred vama. Kakva je ta staza?
Osnovna definicija je,
Joga je obustava aktivnosti uma -
Chitta vritti nirodha.
Rekao sam vam da je Patanjali samo matematiar. U jednoj jedinoj reenici, a sada
disciplina joge, on je zavrio sa vama. Ovo je jedina reenica koja je koriena za vas. Sad on
uzima zdravo za gotovo da ste vi zainteresovani za jogu, ne kao nadu, ve kao disciplinu, kao
preobraaj upravo ovde i sada. On nastavlja da objanjava:
Joga je obustava aktivnosti uma.
Ovo je definicija joge, najbolja. Na mnogo naina je opisana joga, ima mnogo
definicija. Neki kau joga je susret uma sa boanskim; otuda, ona je nazvana joga - joga znai
spoj, spajanje zajedno. Neki kau da joga znai odbacivanje ega; ego je prepreka; onog
momenta kada napustite ego vi ste spojeni sa boanskim. Vi ste ve povezani, samo zbog
vaeg ega vama izgleda da ste bili rastavljeni. Ima ih mnogo, ali Patanjalijeva je najnaunija.
On kae:
Joga je obustava aktivnosti uma.
Joga je stanje u kome nema uma. Re 'um' pokriva sve - va ego, vae elje, vae
nade, vae filozofije, vae religije, vae spise. 'Um' pokriva sve. ta god vi moete zamisliti
12
jeste um. Sve to je znano, sve to moe da se zna, sve to je saznajno, jeste unutar uma.
Prestajanje uma oznaava obustavu znanog, prekid saznajnog. To je skok u nepoznato. Kada
nema uma, vi ste u nepoznatom. Joga je skok u nepoznato. Nee biti ispravno rei
nepoznato, pravilnije je, nesaznajno.
ta je um? ta um radi ovde? ta je to? Obino mi mislimo da je um neto
supstancijalno tamo u glavi. Patanjali se ne slae - i niko ko je ikada saznao unutranjost
uma se nee sloiti. Savremeni naunici se takoe ne slau sa tim. Um nije neto
supstancijalno unutar glave. Um je upravo delovanje, samo aktivnost.
Vi hodate i kaete da etate. ta je hodanje? Ako stanete, gde je hodanje? Ako
sednete, gde je hodanje otilo? Hodanje nije nita supstancijalno; to je jedna aktivnost. Tako
dok vi sedite, niko ne moe da pita, "Gde ste metnuli svoje hodanje? Upravo sada ste bili
hodali, dakle gde je hodanje otilo?" Vi ete se smejati. Rei ete: "Hodanje nije neto
supstancijalno, to je samo aktivnost. Ja mogu etati. Mogu opet hodati i mogu se zaustaviti.
To je aktivnost."
Um je takoe aktivnost, ali usred rei um, izgleda kao da je neto supstancijalno tu.
Bolje je nazvati to "umovanje" - upravo kao hodanje. Um znai "umovanje", um znai
razmiljanje. To je jedna aktivnost.
Citiram ponovo Bodhidharmu.
On je otiao u Kinu, i kineski car je doao da ga vidi. Car je rekao: "Moj um je vrlo
uznemiren, smeten. Vi ste veliki mudrac, i ja sam vas oekivao. Kaite mi ta treba da inim
da bih smirio svoj um."
Bodhidharma je rekao: "Ne inite nita. Prvo donesite svoj um meni." Car ga nije
mogao shvatiti pa je rekao: "ta mislite pod tim?" On je rekao: "Doite ujutru u etiri sata
kada niko nije ovde. Doite sami, i setite se da ponesete svoj um sa vama."
Car nije mogao da spava cele noi. Mnogo puta je odbacivao celu zamisao: "Ovaj
ovek izgleda da je lud. ta je on mislio kada je rekao, "Doi sa svojim umom, ne zaboravi
ga?" ovek je bio tako zanosan, tako harizmatian da nije mogao da otkae sastanak.
Privlaio ga je kao magnet, u etiri sata je iskoio iz kreveta i rekao: "ta god da se dogodi,
moram ii. Ovaj ovek moda ima neto, njegove oi govore da ima neto. Izgleda pomalo
luckasto, ali ipak moram otii da vidim ta e se dogoditi."
Tako je stigao kod njega, a Bodhidharma je sedeo sa svojim velikim tapom. Rekao je:
"Dakle doli ste? Gde je va um? Jeste li ga doneli ili ne?"
Car je rekao: "Vi govorite besmislicu. Kada sam ja ovde moj um je ovde, i to nije
neto to ja mogu zaboraviti negde. To je u meni". Stoga je Bodhidharma rekao: "U redu.
Dakle prva stvar je jasna - da je um u vama." Car je rekao: "U redu, um je u meni."
Bodhidharma je rekao: "Sada zatvorite svoje oi i naite gde je on. Ako ga moete nai gde
je, odmah ga pokaite meni. Ja u ga umiriti."
Tako je car zatvorio svoje oi, pokuavao i pokuavao, traio i traio. to je vie
traio, vie je postao svestan da nema uma, um je samo jedna aktivnost. To nije neto tamo
to vi moete pokazati. Onog momenta kada je on shvatio da to nije neto, onda je apsurdnost
njegovog traganja njemu bila jasna. Ako to nije neto, nita se oko toga ne moe uraditi. Ako
je to samo jedna aktivnost, onda ne vrite tu aktivnost; to je sve. Ako je to kao hodanje;
nemojte hodati.
On je otvorio svoje oi. Poklonio se Bodhidharmi i rekao: "Ne postoji um koji bi se
naao." Bodhidharma je rekao: "Onda sam ga ja umirio. I kad god osetite da ste uznemireni,
samo pogledajte unutra, gde je ta neprijatnost." Samo gledanje je ne-um, jer gledanje nije
miljenje. I ako gledate duboko cela vaa energija postaje gledanje, a ista energija postaje
kretanje i miljenje.
Joga je obustava aktivnosti uma.
Ovo je Patanjalijeva definicija. Kada ne postoji um, vi ste u jogi; kada je um tu, vi
niste u jogi. Dakle, vi moete raditi sve poloaje, ali ako um nastavi da deluje, ako vi nastavite
sa miljenjem, vi niste u jogi. Joga je stanje nemanja uma. Ako moete biti bez uma bez
izvoenja ikakvih poloaja, vi ste postali savreni jogi. To se dogodilo mnogima bez
izvoenja ikakvih poloaja, asana, a to se nije dogodilo mnogima koji su radili poloaje
13
(asane) tokom mnogo ivota.
Budui da osnovna stvar koju treba razumeti jeste da, kada aktivnost miljenja nije
prisutna, vi ste tu; kada aktivnost uma nije prisutna, kada misli ieznu, kada su samo kao
oblaci, kada i oni ieznu, vae postojanje, upravo kao nebo, je otkriveno. Ono je uvek tu -
samo prekriveno oblacima, pokriveno mislima.
Joga je obustava aktivnosti uma.
Na Zapadu sada, postoji veliko zanimanje za Zen - japansku metodu joge. Re zen
dolazi od rei dhyana. Bodhidharma je uveo ovu re u Kinu. U Kini re dhyana postaje
jhan, onda chan, a onda je re prela u Japan i postala zen.
Koren je dhyana. Dhyana znai nemanje uma, tako ceo trening zena u Japanu nije
nita do kako zaustaviti umovanje, kako da ne bude uma, kako da se bude jednostavno bez
miljenja. Pokuajte to! Kada ja kaem pokuajte to, to e izgledati kontradiktorno, jer ne
postoji drugi nain da se to kae. Jer ako vi pokuate, sam pokuaj, napor dolazi od uma.
Moete sedeti u poloaju i pokuati neko apa pevanje, mantru - ili moete samo pokuati da
sedite smireno, da ne mislite. Ali onda ne misliti postaje miljenje. Onda vi nastavljate da
govorite: "Ja ne mislim; nemoj razmiljati; prestani razmiljati." Ali to je sve razmiljanje.
Pokuajte da razumete. Kada Patanjali kae, nemanje uma, obustava uma, on
podrazumeva potpunu obustavu. On vam nee dozvoliti da vrite apu, "Ram-Ram-Ram." On
e rei da to nije obustava; vi koristite um. On e rei: "Jednostavno prestanite!" ali vi ete
pitati: "Kako? Kako jednostavno prekinuti?" Um nastavlja. ak i ako sedite, um nastavlja.
ak i ako ne radite, to nastavlja da se radi.
Patanjali kae samo posmatrajte. Pustite da um ide, pustite da um ini ta god da on
ini. Vi samo posmatrajte. Ne meajte se. Vi samo budite svedok, samo budite jedan
nezainteresovani posmatra, kao da um ne pripada vama, kao da to nije va posao, nije vaa
stvar. Ne budite zainteresovani! Samo posmatrajte i pustite um da tee. To je kretanje usled
prolog impulsa,
7
jer ste uvek pomagali to da tee. Aktivnost je preuzela svoj vlastiti impuls,
tako ona tee. Vi samo nemojte saraivati. Posmatrajte i pustite um da se kree.
Tokom mnogo, mnogo ivota, moda milion ivota, vi ste saraivali sa umom, vi ste
ga pomagali, vi ste mu davali svoju energiju. Reka e tei za neko vreme. Ako ne saraujete,
ako samo posmatrate nezainteresovano - Budina re je ravnodunost, upekha: gledajui bez
ikakvog zanimanja, samo posmatrajui, ne inei nita ni na koji nain - um e tei za kratko i
zaustavie se sam od sebe. Kada je impuls izgubljen, kada je energija istekla, um e se
zaustaviti. Kada se um zaustavi, vi ste u jogi; vi ste postigli disciplinu. To je definicija: Joga
je obustava aktivnosti uma.
8
Onda je svedok utvren u sebi.
Kada se um obustavi, svedok je utvren u sebi.
Kada moete jednostavno posmatrati unutra ne bivajui identifikovani sa umom, bez
rasuivanja, bez ocenjivanja, bez osuivanja, bez odabiranja - vi jednostavno posmatrate i um
7
Podsvesnih utisaka (vasana) i na njima zasnovanih predispozicija (samskara).
8
Joga je disciplina meditacije s kojom nadilazimo iluziju o sebi kao posebnom biu. Sutina meditacije je u
smirenju aktivnosti uma koji odrava sve iluzije. Um ne moe sam sebe da smiri, jer on nije razliit od nas, on je
naa aktivnost, kao hodanje. Jedini nain da smirimo um je da prestanemo da ulaemo energiju u umnu
aktivnost, da se odvratimo od toga. Da bismo se odvratili od stalnog ulaganja energije u umnu aktivnost moramo
najpre da prestanemo da verujemo da to moramo da radimo, da nam je zamiljanje i razmiljanje potrebno, da
prestanemo da verujemo u svoje snove. Da se bar za trenutak uverimo u to. Ovakvi kakvi smo prirodno dati,
nemamo iskustvo takve odvraenosti jer smo s umnom aktivnou i svojim snovima, dnevnim i nonim,
identifikovani od najranijeg detinjstva. Potrebno nam je kratko direktno iskustvo potpune odvraenosti od umne
aktivnosti kako bismo se uverili u njega i prepoznali. To kratko iskustvo ne-uma je disciplina meditativnog
smirenja. Smirujui sebe smirujemo um, iskljuujemo mu utika, dovod energije. To je jedini nain. Tada se on
sam smiruje, jer mi smo ga i pokretali. U tom kratkotrajnom iskustvu uviamo da nismo um, da moemo da
postojimo kao isto bie koje nadilazi sve umne predstave, da smo neto mnogo vie od malog uma i njegovih
iluzija da smo izdvojeno, malo bie sa neurotinim sadrajima koje je dotle nosilo. To je iskustvo nae
autentinosti, naeg jedinstva sa apsolutnim biem koje sve omoguava. Takvo iskustvo nas jaa da tu svesnost u
meditaciji proirimo na stalnu prisutnost danju i nou, u svim aktivnostima, a ne samo za vreme meditativnog
zadubljenja. Ostali tekst Joga sutri opisuje detalje prakse proirivanja takve svesti sve do trajne nezavisnosti i
autentinosti koja se naziva Kaivalya.
14
tee, vreme dolazi kada se sam od sebe, iz sebe, um zaustavlja.
Kada nema uma, vi ste utvreni u vaem svedoenju. Onda ste postali svedok - samo
videlac - dratra, sakin. Onda niste inilac, onda niste mislilac. Onda ste jednostavno isto
bie, najistije od bia. Onda je svedok utvren u sebi samom.
U svim drugim stanjima postoji identifikacija sa modifikacijama uma.
Izuzev svedoenja, u svim stanjima, vi ste identifikovani s umom. Vi postajete jedno
sa tokom misli, postajete jedno sa oblacima; ponekad sa belim oblakom, ponekad sa tamnim
oblakom, ponekad sa kiom ispunjenim oblakom, ponekad sa praznim oblakom, ma kako
bilo, vi postajete jedno s miljenjem, vi postajete jedno s oblakom, i ne primeujete vau
istotu neba, istotu prostora. Vi postajete naoblaeni, a to naoblaenje se deava jer vi
postajete identifikovani, postajete jedno s tim.
Misao doe. Vi ste gladni, i misao projuri u umu. Misao je samo to, da postoji glad, da
stomak osea glad. Odmah postajete identifikovani; kaete: "Ja sam gladan." Um je bio
potpuno ispunjen milju da je glad prisutna; vi postajete identifikovani i kaete: "Ja sam
gladan." Ovo je identifikacija.
Buda takoe osea glad, Patanjali takoe osea glad, ali on nikada nee rei: "Ja sam
gladan." On e rei: "Telo je gladno"; on e rei: "Moj stomak osea glad"; on e rei;
"Postoji glad. Ja sam svedok. Ja sam doao da svedoim ovoj misli, koja je iznenadno iz
stomaka sevnula u mozgu, da sam gladan." Stomak je gladan; Patanjali e ostati svedok. Vi
postajete identifikovani, vi postajete jedno s miljenjem.
Onda je svedok utvren u sebi samom.
U svim drugim stanjima, postoji identifikacija sa modifikacijama uma.
Ovo je definicija:
Joga je obustava aktivnosti uma.
Kada um prestane, vi ste utvreni u vaem svedoeem Sopstvu. U svim drugim
stanjima, izuzev ovog, vi ste identifikovani. A sve identifikacije obrazuju samsaru; one su
svet. Ako ste identifikovani, vi ste u svetu, u patnji. Ako ste transcendirali identifikacije, vi ste
osloboeni. Vi ste postali siddha, vi ste u nirvani. Vi ste transcendirali ovaj svet patnje i uli
ste u svet blaenstva.
A taj svet je ovde i sada - upravo sada, ba ovog trenutka! Nije potrebno ekati ga ak
nijedan trenutak. Samo postanite svedok uma, i biete uneti u taj svet. Postanite identifikovani
sa umom, i vi ete ga izgubiti. Ovo je osnovna definicija.
Zapamtite sve, jer docnije, u drugim sutrama, ui emo u detalje ta treba da se uradi,
kako treba da se uradi - ali uvek imajte na umu da je ovo temelj.
ovek treba da postigne stanje bez uma: to je cilj.
15
Poglavlje 2
JOGA, STAZA BEZ ELJA
26. decembar 1973, posle podne.
Prvo pitanje:
Rekli ste prole noi da su potpuno oajanje, frustracija i beznadenost poetne
osnove za jogu. Ovo daje jogi pesimistiki izgled. Da li je to pesimistiko stanje zaista
potrebno da zapone staza joge? Da li optimista takoe moe poi stazom joge?
Nije ni jedno ni drugo. To nije pesimistino, to nije optimistino, jer pesimizam i
optimizam su dva aspekta istog novia. Pesimista oznaava oveka koji je bio optimista u
prolosti; a optimista oznaava onoga ko e biti pesimista u budunosti. Svaki optimizam vodi
do pesimizma, jer svaka nada vodi do beznadenosti.
Ako se jo nadate, onda joga nije za vas. Postoji elja, ima nade; samsara je tu, svet je
tu. Vaa elja je svet, vaa nada je ropstvo, jer nada vam nee dozvoliti da ivite u sadanjosti.
Nastavljae da vas prisiljava ka budunosti; nee vam dozvoliti da budete usrediteni. Ona e
potezati i potiskivati, ali vam nee dozvoliti da ostanete mirni u sadanjem trenutku, u tiini.
To vam nee dozvoliti.
Tako kada kaem totalna beznadenost, ja mislim da je nada oslabila, a i beznadenost
je takoe postala uzaludna. Onda je to totalna beznadenost. Totalna beznadenost znai da ni
sama beznadenost nije prisutna, jer kada oseate beznadenost, suptilna nada je prisutna.
Inae, zato biste oseali beznadenost? Nada postoji, vi jo prianjate uz nju; otuda
beznadenost.
Totalna beznadenost znai da sada nema nade. A kada ne postoji nada ne moe biti
beznadenosti. Vi ste jednostavno odbacili celu pojavu. Obe strane su odbaene, ceo novi je
baen. U ovom stanju uma vi moete ui na stazu joge; nikada pre. Pre toga nije mogue.
Nada je protiv joge.
Joga nije pesimistika. Vi moete biti optimista ili pesimista; joga nije ni jedno ni
drugo. Ako ste pesimista, ne moete ui na stazu joge jer pesimista se vezuje uz svoje nevolje.
On nee dozvoliti svojim nevoljama da ieznu. Optimista se lepi uz svoje nade, a pesimista
se lepi za svoju patnju, za svoju beznadenost. Ta beznadenost mu je postala pratilac. Joga je
za nekoga ko nije ni jedno ni drugo, ko je postao tako potpuno beznadean da je ak
nekorisno da osea beznadenost.
Suprotno moe da se oseti samo ako nastavite da prianjate negde duboko dole uz
pozitivno. Ako prianjate uz nadu moete se oseati beznadeno. Ako prionete uz oekivanje
vi moete oseati frustraciju. Ako jednostavno shvatite da nema mogunosti da oekujete
nita, onda gde je frustracija? Onda je priroda egzistencije da nema mogunosti bilo ta de se
oekuje, ne postoji mogunost za nadu. Kada ovo postane sigurna injenica, kako moete
oseati beznadenost? Onda oboje ieznu.
Patanjali kae, a sada, disciplina joge. To 'sada' e se dogoditi kada niste nijedno.
Pesimistika gledita ili optimistika gledita, oba su bolesna, ali postoje uitelji koji stalno
govore u terminima optimizma - naroito ameriki hrianski misionari. Oni stalno govore u
terminima nade, optimizma, budunosti, raja. U oima Patanjalija to su samo prie za malu
decu, jer vam jednostavno daju novu bolest. Zamenjujete novu bolest za staru. Vi ste nesreni
i traite na neki nain sreu. Stoga ko god vam da uverenje da je to staza koja e vas voditi do
sree, vi ete slediti to. On vam daje nadu. Ali vi oseate tako veliku patnju zbog vaih prolih
nada. On vam opet stvara budui pakao.
Joga oekuje od vas da budete vie odrasli, vie zreli. Joga kae da ne postoji
mogunost da se oekuje ita, ne postoji mogunost ma kakvog ispunjenja u budunosti. Ne
postoji nebo u budunosti i nema Boga koji vas eka sa boinim darovima. Nema nikog da
vas oekuje, stoga ne udite vie za budunou.
16
A kada postanete svesni da nema niega to e se dogoditi negde u budunosti, vi ete
postati spremni za sve ovde i sada jer nema nikuda da se krene. Onda ne postoji mogunost za
strepnju. Onda vam se deava smirenost. Iznenada ste duboko oputeni. Ne moete ii nikuda,
vi ste kod kue. Kretanje prestaje; uznemirenost iezava. Sada je vreme da se ue u jogu.
Patanjali vam nee dati nikakvu nadu. On potuje vas vie nego to vi potujete sebe.
On misli da ste zreli i da vam igrake nee pomoi. Bolje je biti spreman za ono to se deava.
Inae odmah im ja kaem: "Potpuna beznadenost" va um e rei: "Ovo izgleda
pesimistino", jer va um ivi kroz nadu, jer va um se lepi uz elje, nadanja.
Vi ste tako nesreni upravo sada da ete poiniti samoubistvo ako nema nade. Ako je
stvarno Patanjali u pravu, ta e vam se dogoditi? Ako nema nade, nema budunosti, i vi ste
baeni natrag u vau sadanjost, vi ete poiniti samoubistvo. Nema niega zata bi se onda
ivelo. Vi ivite za neto to e se dogoditi negde, nekada. To se nee dogoditi, ali oseanje
da se to moe dogoditi pomae vam da budete ivi.
Zbog toga kaem da kada doete do take gde je samoubistvo postalo najznaajnije
pitanje, gde je ivot izgubio svako svoje znaenje, gde moete ubiti sebe, u tom trenutku joga
postaje mogua, jer neete biti spremni da preobrazite sebe dok vam se ova silna nitavnost
ivota dogaa. Biete spremni da preobrazite sebe samo kada oseate da ne postoji drugi put -
ili samoubistvo ili sadhana (duhovna praksa, meditacija), ili da poinite samoubistvo ili da
preobrazite svoje bie. Kada preostanu samo ove dve alternative, samo onda se bira joga,
nikada pre. Meutim, joga nije pesimistina. Vi ste optimistini, zato vam joga izgleda kao
pesimistina. To je zbog vas.
Buda je uzet na Zapadu kao vrhunac pesimizma, jer Buda kae: "ivot je dukkha,
patnja". Tako su zapadni filozofi tumaili da je Buda pesimista. ak i osoba poput Alberta
vajcera (A. Schweitzer), osoba od koje moemo oekivati da zna izvesne stvari, ak i on je u
zabuni. On misli da je itav Istok pesimistian. A ovo je velika kritika od njega. itav Istok -
Buda, Patanjali, Mahavira, Lao Ce, za njega su svi pesimisti. Oni samo tako izgledaju jer su
uvideli da je va ivot besmislen. Ne kau da je sam ivot besmislica - nego ivot koji vi
znate. A dok va ivot ne postane sasvim besmislen, vi ga ne moete transcendirati. Vi ete se
lepiti uz njega.
I dok ne transcendirate takav ivot, ovaj oblik egzistencije, neete znati ta je
blaenstvo. Ali Buda, Patanjali, oni nee govoriti mnogo o blaenstvu jer imaju duboko
saoseanje prema vama. Ako zaponu da govore o blaenstvu, vi opet stvarate nadu. Vi ste
neizleivi: vi opet kreirate nadu. Kaete: "U redu! Onda moemo ostaviti ovaj ivot. Ako je
bolji i bogatiji ivot mogu, onda moemo ostaviti elje. Ako je kroz ostavljanje elja mogue
ostvariti najdublju elju dostizanja krajnjeg vrhunca blaenstva, onda moemo napustiti elje.
Ali ih moemo samo napustiti radi vee elje."
Onda gde je vae naputanje? Nita ne ostavljate. Vi jednostavno zamenjujete
drugaiju elju za stare elje. A nova elja e biti mnogo opasnija nego stara jer ste sa starom
ve prevareni. Da biste postali izigrani sa novom, moete proi puno ivota da biste doli do
take gde moete rei 'Bog je beskoristan', gde moete rei 'raj je besmislen', gde moete rei
'sva budunost je bezumnost'.
Nije to pitanje samo svetovnih elja, to je pitanje elje kao takve. eljenje mora
prestati. Samo onda postajete spremni, samo onda skupite hrabrost, samo onda se vrata
otvaraju i vi moete ui u nepoznato. Otuda je Patanjalijeva prva sutra: "A sada, disciplina
joge".
Drugo pitanje:
Reeno je da je joga ateistiki sistem. Da li se vi slaete s tim?
Jo jednom, joga nije ni jedno ni drugo. Ona je jednostavno nauka. Nije ni teistika
niti ateistika. Patanjali je zaista velianstven, udesan ovek. On nikada ne govori o Bogu.
A ak i ako pominje jednom, onda takoe kae da je to samo jedna od metoda da se dostigne
ono najvie, vera u Boga je samo metoda da se dostigne krajnje; Bog kao objekat ne postoji.
Verovanje u Boga jeste samo tehnika, jer kroz verovanje u Boga molitva postaje mogua,
17
kroz verovanje u Boga predanost postaje mogua. Znaaj je u predanosti i molitvi, ne u Bogu
kao njihovom objektu.
Patanjali je zaista neverovatan! On je rekao Bog - vera u Boga, koncept Boga -
takoe je jedna od metoda, meu mnogim metodama, da bi se postigla istina. Ivara
pranidhan - verovanje u Boga samo je staza. Ali to nije nuno. Moete odabrati i neto drugo.
Buda je dospeo do te krajnje realnosti bez verovanja u Boga. On je odabrao drugaiju stazu
gde Bog nije potreban.
Vi ste doli u moju kuu. Proli ste kroz odreenu ulicu. Ta ulica nije bila cilj; ona je
samo bila pomono sredstvo. Mogli ste doi do iste kue kroz neku drugu ulicu; drugi su
stigli do nje kroz druge ulice. U vaoj ulici moda postoji zelena trava, veliko drvee; u
drugim ulicama ih nema. Dakle Bog je samo jedna staza. Zapamtite tu razliku. Bog nije cilj.
Bog je samo jedna od staza.
Patanjali nita ne porie; on nita ne namee. On je apsolutno nauan. Hrianima je
teko da zamisle kako je Buda mogao da dostigne krajnju istinu, jer nikada nije verovao u
Boga. Teko je hindusu da veruje kako je Mahavira postigao osloboenje; on nikada nije
verovao u Boga.
Pre nego to su zapadni mislioci postali upoznati sa istonim religijama, oni su uvek
definisali religiju kao usmerenost ka Bogu. Kada su doli do istonjakog miljenja, i onda su
postali svesni da tamo postoji tradicionalni put prema istini na kome nema Boga, oni su bili
okirani; to je nemogue.
H. G. Wells je pisao o Budi da je Buda najbezboniji ovek, a ipak najpoboniji. On
nikada nije verovao i nikada nije rekao nikome da veruje u Boga, ali je on sam najvii
fenomen deavanja boanskog postojanja. Mahavira je takoe iao stazom gde Bog nije bio
nuan.
Patanjali je potpuno nauan. On kae da mi nismo povezani sa sredstvima; postoji
hiljadu i jedno sredstvo. Cilj je istina. Neki su je postigli kroz Boga, dakle to je u redu -
verujte u Boga i postignite cilj, jer kada se cilj postigne vi ete odbaciti svoju veru. Dakle,
vera je samo instrument. Ako ne verujete, to je u redu; nemojte verovati, idite stazom
bezvernosti, i dostignite cilj.
On nije ni teista niti ateista. On ne kreira religiju, on vam jednostavno pokazuje sve
staze koje su mogue i sve zakone koji dejstvuju u vaoj transformaciji. Bog je jedna od tih
staza; tu nema prisile. Ako ste ateista, nije potrebno da budete i nereligiozni. Patanjali kae
da vi takoe moete dostii - budite ateista, ne brinite o Bogu. Ovo su zakoni, ovo su
eksperimenti; to je meditacija - proite kroz to.
On nije insistirao ni na jednom konceptu. To je bilo vrlo teko. Zbog toga su joga
sutre od Patanjalija izuzetne, jedinstvene. Takva knjiga se nikada nije dogodila ranije i ne
postoji mogunost ponovo da se dogodi, jer sve to moe biti napisano o jogi napisano je; on
nita nije izostavio. Niko ne moe dodati nita tome. Nikada u budunosti nee postojati
mogunost stvaranja drugog dela kao to su Patanjalijeve Joga sutre. On je kompletno
zavrio posao, a on je to mogao da uradi tako kompletno jer nije bio jednostran. Da je bio
jednostran, to ne bi mogao da uradi tako celovito.
Buda je delimian, Mahavira je nepotpun, Muhamed je jednostran, Isus je nepotpun -
oni imaju odreenu stazu. Njihova nepotpunost moe biti zbog vas - zbog dubokog
razumevanja za vas, dubokog saoseanja za vas. Oni insistiraju na odreenoj stazi; stalno su
insistirali itavog njihovog ivota. Oni su govorili: "Sve drugo je pogreno; ovo je ispravna
staza" samo da bi stvorili veru u vama. Vi ste tako bezverni, tako ste ispunjeni sumnjom, da
ako oni kau da ova staza predvodi, a druge staze takoe vode, vi neete slediti ni jednu. Zato
su insistirali da jednino njihova staza vodi do cilja.
To nije tano. To je pomono sredstvo za vas - jer ako oseate neku nesigurnost u
njima, ako oni kau: "Ovo vodi do cilja, i ono takoe vodi; ovo je istina, i ono je takoe
istina", vi ete postati nesigurni. Vi ste ve nesigurni, potreban vam je neko ko je apsolutno
pouzdan. Samo da bi izgledali pouzdani vama, oni su nainili sebe jednostranim.
Inae ako ste jednostrani, ne moete obuhvatiti itavu osnovu. Patanjali nije
jednostran. On je manje zainteresovan za vas, vie se brine o projektovanju dobre staze. On
18
nee koristiti neistinu; on nee koristiti pomona sredstva, on se nee nagaati s vama.
Nijedan naunik ne prihvata kompromis.
Buda je bio sposoban za kompromis; on ima saoseanje. On vas ne tretira nauno.
Vrlo duboko ljudsko oseanje ima prema vama; moe ak i lagati da bi vam pomogao. Ako vi
ne moete razumeti istinu, on ini nagodbu s vama. Patanjali nee imati kompromis s vama.
Ma kakva da je istina, on e govoriti o injenici. Nee se spustiti nijedan korak da udovolji
vama; on je apsolutno beskompromisan. Nauka mora biti takva. Nauka ne moe praviti
kompromise; inae ona bi postala samo religija.
On nije ni ateista ni teista. On nije ni hinduista, niti musliman, ni hrianin niti ain, a
takoe ni budista. On je apsolutno nauni istraiva koji samo otkriva kakav sve to jeste -
otkriva bez ikakvog izmiljanja mitova. On nee koristiti nijednu alegoriju. Isus je stalno
govorio u priama jer vi ste deca i moete razumeti samo prie. On je govorio u alegorijama.
Buda koristi tako mnogo pria samo da bi vam pomogao da ostvarite letimian uvid.
itao sam o hasidu, jevrejskom uitelju, Bal emu. On je bio rabin u malom selu, a
kad god bi tamo bila neka nevolja, neka bolest, neka nesrea u selu, on bi krenuo u umu.
Otiao bi do odreenog mesta, ispod odreenog drveta, tamo bi obavio neki ritual i onda bi se
molio Bogu. I uvek bi se deavalo da je nesrea naputala selo, bolesti bi iezavale iz sela,
nevolje bi prestajale.
Onda je Bal em umro. Postavljen je njegov naslednik Problem je nastupio ponovo.
Selo je bilo u nevolji. Nastupila je neka nevolja, i seljani su zatraili od naslednika, novog
rabina, da ode u umu i da se moli Bogu. Novi rabin je bio jako uznemiren jer nije znao
mesto, tano odreeno drvo. Bio je neiskusan, ali je ipak otiao - pod neko drvo. Zapalio je
vatru, izveo je ritual, molio se i rekao Bogu: "Vidi, ja ne znam tano mesto na koje je moj
uitelj imao obiaj da dolazi, ali ti zna. Ti si svemoan, sveprisutan, dakle ti zna - stoga
nema potrebe za tano odreenim mestom. Moje selo je u nevolji, prema tome sluaj i uini
neto." Nesrea je prola!
Onda kada je ovaj rabin umro i doao njegov naslednik, opet je nastupio problem. Selo
je bilo u izvesnoj krizi, i seljani su doli. Rabin je bio uznemiren; zaboravio je ak i molitvu.
Tako je otiao u umu, odabrao izvesno mesto. Nije znao ni da zapali ritualnu vatru, ali
nekako je uspeo da zapali vatru i rekao je Bogu: "Sluaj, ja ne znam kako da zapalim ritualnu
vatru, ja ne znam tano mesto, i zaboravio sam molitvu, ali ti si sveznajui, tako da zna ve,
nema potrebe. Zato uini ta treba." Vratio se natrag i selo je prebrodilo krizu.
Onda je on takoe umro, a njegov naslednik Njegovo selo je opet bilo u nevolji,
tako su doli kod njega. Sedeo je u fotelji. Rekao je Bogu: "Ja ne elim da idem nikuda. uj,
ti si svuda. Ja ne znam molitvu, ne znam nikakav ritual. Ali to nije vano; moje znanje nije
glavna stvar. Ti zna sve. Kakva je korist moliti se, kakva je korist vriti ritual, i kakva korist
od posebnog svetog mesta? Ja znam samo priu o mojim prethodnicima. Ispriau ti priu, da
se to dogodilo u Bal emovo vreme, onda u vreme njegovog naslednika, onda njegovog
naslednika; to je pria. Sada uini ta treba, i to je dovoljno." I nevolja je iezla - zato to je
Bog mnogo voleo prie.
Ljudi vole njihove prie i boiji ljudi takoe, kroz prie moete imati odreena
delimina sagledavanja. Meutim, Patanjali nee koristiti nijednu alegoriju. Rekao sam vam
da je on kao Ajntajn plus Buda - vrlo retka kombinacija. On je imao unutranje svedoenje
Bude i mehanizam uma jednog Ajntajna.
On nije ni jedno ni drugo. Teizam je pria; ateizam je antipria. Prie su samo mitovi,
od ljudi stvorene parabole. Nekima se jedna dopada, a nekima druga. Patanjali nije
zainteresovan za prie, nije zainteresovan za mitove. On je zainteresovan za golu istinu. On je
nee ak ni zaodenuti, nee je ak ni doterati, nee je ukraavati. To nije njegov nain.
Zapamtite ovo.
Kretaemo se po vrlo suvoj zemlji, zemlji nalik pustinji. Ali pustinja ima svoju
vlastitu lepotu. Ona nema drvee, ona nema reke, ali ima svo svoje prostranstvo. Nijedna
uma se ne moe uporediti s njom. ume imaju svoje sopstvene lepote, brda svoje vlastite
19
lepote, reke svoje vlastite divote. Pustinja ima svoju sopstvenu neizmernu beskrajnost.
Kretaemo se kroz pustu zemlju. Hrabrost je nuna. Nee vam dati nijedno drvo da se
odmorite ispod njega, nee vam dati nijednu priu - samo gole injenice. Nee koristiti ak
nijednu suvinu re. Otuda je re sutre. Sutre oznaavaju osnovni minimum, aforizme u
kratkim izrekama. Sutra nije ak ni potpuna reenica. Ona je samo sutina - kao kada aljete
telegram, kreete suvine rei. Onda to postaje sutra jer samo deset ili devet rei mogu biti
stavljene u poruci. Ako biste pisali pismo, ispunili biste deset stranica, a ak ni u deset
stranica poruka nee biti potpuna. Ali u telegramu, u deset rei, ne samo da je kompletna, ona
je vie nego potpuna. Ona pogaa srce; sama sr je u njoj.
To su telegrami - Patanjalijeve sutre. On je tvrdica; nije koristio nijednu suvinu re.
Prema tome kako on moe priati prie? Ne moe, i ne oekujte to. Stoga ne pitajte da li je on
teista ili ateista; to su sve prie.
Filozofi su stvorili mnogo pria, i to je igra. Ako elite igru ateizma, budite ateista.
Ako elite igru teizma, budite teista. Ali to su igre, nisu realnost. Realnost je neto drugo.
Realnost se bavi s vama, ne s onim u ta verujete. Realnost ste vi, ne ono ta verujete.
Realnost je iza uma, ne u sadrajima uma, jer teizam je sadraj uma, ateizam je sadraj uma -
neto u umu. Hinduizam je sadraj uma, i hrianstvo je sadraj uma.
Patanjali je zainteresovan za ono to je izvan, ne za sadraj. On kae: "Odbaci ceo
ovaj um. ta god da sadri, to je beskorisno." Vi moda nosite divne filozofije, Patanjali je
rekao: "Odbacite ih, sve je besmislica." To je teko. Ako neko kae: "Vaa Biblija je triarija,
vaa Gita je besmislica, vai spisi su bezvredni, budalatina, odbacite ih", vi ete biti okirani.
Ali to je ono to e se dogoditi. Patanjali vam nee uiniti nikakav ustupak. On je
beskompromisan. A to je lepota, i to je njegova jedinstvenost.
Tree pitanje:
Vi ste govorili o znaaju uenitva na stazi joge, ali kako jedan ateista moe biti
uenik?
Ni teista ni ateista ne mogu biti uenici. Oni su ve zauzeli gledite, oni su ve
odluili, stoga gde je svrha da budu uenici? Ako ve znate, kako moete biti uenik?
Uenitvo znai spoznaju da ja ne znam. Ateisti, teisti - ne, oni ne mogu biti uenici.
Ako verujete u neto, vi ete propustiti lepotu uenitva. Ako neto ve znate, to
saznanje e vam dati ego. Ono vas nee uiniti poniznim. Zbog toga panditi i uenjaci
proputaju. Ponekad grenici dostiu uenitvo, ali naunici nikada. Oni znaju previe; oni su
tako pametni. Njihova darovitost je njihova bolest; ona postaje samoubistvo. Oni nee sluati
jer nee biti spremni da ue.
Uenitvo jednostavno oznaava jedno stanovite prema uenju - iz trena u tren
ostajati svestan da ne znam. Ovo saznanje da ne znam, ova svesnost Ja sam neznalica,
daje vam otvorenost; onda niste zatvoreni. Onog momenta kada kaete: "znam", vi ste
zatvoreni u krugu; vrata vie nisu otvorena.
Ako ste ve dostigli, zakljuili, ne moete biti uenik. ovek mora da bude u
prijemljivom raspoloenju. ovek mora neprekidno da bude svestan da stvarnost je nepoznata
i ma ta da znam to je beznaajno. ta vi znate? Vi ste moda skupili mnogo informacija, ali
to nije spoznaja. Moda ste pokupili mnogo praine kroz univerzitete; to nije spoznaja. Moda
znate o Budi, moda znate o Isusu, ali to nije spoznaja. Dok ne postanete Buda, nema
spoznaje. Dok niste Isus, nema spoznaje.
Spoznaja dolazi kroz bie, ne kroz pamenje. Moete imati uvebano pamenje;
pamenje je samo mehanizam. Ono vam nee dati bogatije postojanje. Moe vam dati strane
snove, ali vam ne moe dati bogatije postojanje. Ostaete isto pokriveni s mnogo praine.
Znanje, a naroito ego koji dolazi kroz znanje - oseanje ja znam zatvara vas. Jo ne moete
biti uenik. A ako ne moete biti uenik, ne moete ui u disciplinu joge. Stoga doite do
vrata joge neupueni, svesni da ne znate. A ja u vam rei: To je jedino znanje koje e vam
pomoi, znanje da ne znate.
Ovo vas ini poniznim i skromnim. Suptilna poniznost e vam doi. Uskoro e ego
20
splasnuti. Znajui da ne znate, kako moete biti egoistini? Znanje je najsuptilnija hrana za
ego: vi oseate da ste neto. Vi znate; vi postajete neko.
Ba pre dva dana, inicirao sam devojku sa Zapada u sannyas
9
i dao sam joj ime Joga
sambodhi i pitao sam je: "Da li e ti biti lako da ga izgovara? Ona je rekla: "Da. Lii na
englesku re 'somebody'
10
." Meutim, sambodhi je sasvim suprotno. Kada postanete niko,
onda se sambodhi deava. Sambodhi znai prosvetljenje. Ako ste vi neko, sambodhi se nikada
nee dogoditi. Ta "nekost"
11
je prepreka.
Kada oseate da ste niko, kada oseate da ste nita, iznenada ste pristupani mnogim
misterijama da vam se dogode. Vaa vrata su otvorena. Sunce moe da se uzdigne; sunevi
zraci mogu da prodru u vas. Vaa turobnost, vaa tama e ieznuti. Ali vi ste zatvoreni.
Sunce moda kuca na vrata, ali niko ne otvara; ni prozor ak nije otvoren.
Ateisti ili teisti, hindusi ili muslimani, hriani ili budisti, oni ne mogu stupiti na stazu
joge. Oni veruju. Oni su ve dosegli bez pruanja ruke ma gde. Oni su zakljuili bez ikakve
realizacije. Oni imaju rei u umovima - koncepte, teorije, spise. A to je vee breme, oni su
vie mrtvi.
etvrto pitanje:
Vi ste rekli da joga ne trai nikakvu veru. Ali ako je ueniku potrebna vera,
predanost i poverenje u uitelja kao osnovni uslov, onda kako je prva tvrdnja opravdana?
Ne. Nikada nisam rekao da joga ne trai veru. Ja sam rekao da joga ne trai neko
uverenje. Vera je potpuno razliita, poverenje je potpuno razliito. Uverenje je intelektualna
stvar, ali vera je vrlo duboko poverenje. Ona nije intelektualna. Vi volite uitelja, onda imate
poverenje i postoji vera. Meutim, ova vera nije nikakav koncept, ona je u samoj osobi. A to
nije uslov; to nije zahtevano - zapamtite ovu razliku. Ne trai se da vi morate verovati u
uitelja; to nije preduslov. Sve to je reeno je ovo: ako se to dogodi izmeu vas i uitelja,
onda e biti mogu satsang. To je samo situacija, a ne uslov. Nita se ne zahteva.
Samo ljubav... Ako se ljubav dogodi onda brak moe uslediti, ali vi ne moete uiniti
ljubav uslovom, da prvo morate voleti a onda e brak uslediti. Inae onda ete pitati: "Kako
ovek moe voleti?" Ako se to dogodi, dogodi se; ako se to ne dogaa, ne dogaa se. Vi ne
moete uiniti nita. Stoga ne moete prisiliti poverenje.
U davnim vremenima tragaoci bi lutali svuda po svetu. Lutali bi od jednog uitelja do
drugog, samo oekujui pojavu da se dogodi. Vi to ne moete prisiliti. Moete promeniti
mnogo uitelja, upravo u potrazi ne bi li negde neto kljocnulo. Onda se stvar dogodi; to nije
okolnost. Vi ne moete otii kod uitelja i pokuati da mu verujete. Kako moete pokuati da
verujete? Sam pokuaj, sam napor, pokazuje da ne verujete. Kako moete pokuati da volite
nekoga? Moete li? Ako pokuate, cela stvar e postati lana. To se smo dogaa.
Inae dok se to ne dogodi, satsang nee biti mogu. Tada vam uitelj ne moe dati
svoju milost. Nee on odvratiti sebe od davanja; vi niste dostupni. On ne moe uiniti nita.
Vi niste otvoreni.
Sunce moda eka ispred prozora, ali ako je on zatvoren, ta sunce moe uiniti? Zraci
e se reflektovati natrag. Oni e doi, kucati na vrata i vratiti se natrag. Zapamtite, to nije
uslov da vi otvorite vrata da bi sunce izalo na horizontu; to nije uslov! Sunce moda nee biti
tu, moda je no. Samo otvaranjem vrata vi ne moete stvoriti sunce. Vae otvaranje vrata je
samo vae bivanje dostupnim. Ako je sunce tu, ono moe ui.
Tako e se tragaoci kretati, morae da se kreu od jednog uitelja do drugog. Jedina
stvar koju treba zapamtiti je da oni moraju biti otvoreni i da ne treba da sude. Ako doete
blizu uitelja, i ne oseate nikakav rad unutar njega, kretanje - ali ne sudite. Jer vae
prosuivanje e biti pogreno. Vi nikada niste bili u kontaktu. Dok ne volite, vi ne znate,
9
Sannyas je red monaha, svetenika koji su posveeni duhovnoj praksi, mogu da budu beskunici ili da ive u
nekom aramu. Nose crvene ogrtae. Njihova osnovna praksa je meditacija. Osho je osnovao novu meunarodnu
zajednicu sanjasina (Neo-Sannyas Commune International), po ugledu na staru ali ne i po ugledu na tradiciju ija
uslovljavanja i ogranienja Osho na sve naine nadilazi.
10
Neko, vana linost, vana osoba.
11
Eng.: Somebodiness.
21
stoga ne sudite. Jednostavno kaite: "Ovaj uitelj nije za mene; ja nisam za ovog uitelja.
Stvar se nije dogodila." Jednostavno idite dalje.
Ako zaponete da sudite, onda zatvarate sebe za druge uitelje takoe. Moda ete
morati da proete kroz mnoge, mnoge situacije, ali zapamtite ovo: ne sudite. Kad god oseate
da je neto pogreno sa uiteljem, idite dalje. To znai da ne moete imati poverenje. Neto je
krenulo pogreno, ne moete verovati. Ali ne kaite da je uitelj pogrean; ne znate.
Jednostavno se maknite; to je dovoljno. Traite negde drugde.
Ako ponete da prosuujete, osuujete, zakljuujete, onda ete biti zatvoreni. A one
oi koje sude nikada nee moi da veruju. Jednom kada postanete rtva suenja nikada neete
biti sposobni da verujete jer ete nai neto to e vam pomoi da ne verujete, to e vam
pomoi da se zatvorite.
Dakle, nemojte verovati, nemojte suditi, kreite se. Jednog dana, ako nastavite da se
kreete, stvar e se sigurno dogoditi; jednog dana, negde, u nekom momentu, jer ima
trenutaka - ne moete uiniti nita s njima kada ste osetljivi, i kada uitelj tee. Vi ste
osetljivi, vi ga susreete. U odreenim takama vremena i prostora, susret se dogaa. Onda
satsang postaje mogu.
Satsang znai intimna blizina sa uiteljem, sa ovekom koji je spoznao. Jer onda on
moe da tee. On ve tee. Sufi kau da je to dovoljno. Samo da se bude u intimnoj blizini
uitelja, to je dovoljno, samo da se sedi pokraj njega, samo da se hoda uz njega, samo da se
sedi u blizini njegove sobe, samo da se bdi u noi sedei iza njegovog zida, samo ga se stalno
seati, to je dovoljno.
Ali to trai godine, godine ekanja. A on nee postupati s vama dobro, zapamtite, on
e vam stvarati svaku vrstu prepreka. Dae vam mnogo prilika da sudite. irie glasine o sebi
tako da moete pomisliti da je on pogrean ovek, da biste pobegli. Pomoi e vam na svaki
nain da pobegnete. Dok ne proete sve prepone... A one su nune, jer jeftino poverenje je
neupotrebljivo. Pravo poverenje, zrelo poverenje, koje se ekalo dugo, postalo je jaka stena...
Samo onda se moe prodreti u najdublje slojeve.
Patanjali ne kae da morate da imate uverenja. Uverenje je intelektualno. Vi verujete
u hinduizam, to nije vae poverenje. Vi ste samo sluajno u hinduistikoj porodici, i tako ste
sluali; od samog detinjstva ste bili proeti. Na vas su ostavile utisak teorije, koncepti,
filozofije, sistemi. Oni su postali deo vae krvi. Oni su samo zapali u vau svest; vi verujete u
njih. Ali to verovanje nije od koristi jer vas nije preobrazilo. To je mrtva stvar, pozajmljena.
Poverenje nikada nije mrtva stvar. Vi ne moete pozajmiti poverenje od vae porodice.
To je lina pojava. Moraete da doete do njega. Hinduizam je tradicionalan, islam je
tradicionalan.
Prva grupa oko Muhameda - bili su pravi muslimani - jer je to bilo poverenje u njega;
oni su doli lino do uitelja. Oni su iveli sa uiteljem u intimnoj blizini; imali su satsang.
Oni su verovali u Muhameda, a Muhamed nije bio ovek kome se lako moglo verovati.
Teko. Da ste vi bili kod Muhameda, vi biste pobegli - on je imao devet ena. Nemogue je
verovati takvom oveku. Drao je ma u svojoj ruci, a na mau je pisalo: "Mir"; re "Islam"
znai mir. Kako moete verovati takvom oveku?
Moete poverovati Mahaviru kada kae: "Nenasilje"; on je nenasilan. Oigledno
moete verovati Mahaviru. Kako moete verovati Muhamedu s maem? A on kae: "Ljubav
je poruka i mir je moto." Ne moete verovati. Ovaj ovek stvara ograde.
On je bio sufi; on je bio uitelj. On je kreirao svakojake tekoe. Dakle, ako va um
jo funkcionie, jo sumnjate, jo ste skeptini, pobei ete. Inae ako ostanete, ekate, ako
imate strpljenje - a beskonano strpljenje e biti potrebno - jednog dana ete upoznati
Muhameda, vi ete postati musliman. Samo znajui njega, vi ete postati musliman.
Prva grupa njegovih uenika je bila sasvim razliita stvar. Prva grupa Budinih uenika
je bila sasvim razliita stvar. Sada su budisti mrtvi. Muslimani su mrtvi. Oni su samo po
tradiciji muslimani.
Istina ne moe biti prenesena kao imovina. Vai roditelji vam ne mogu dati istinu. Oni
vam mogu dati imovinu jer imovina pripada svetu. Istina ne pripada svetu; oni vam je ne
mogu dati, oni je ne mogu imati u riznici. Ne mogu je imati u banci tako da vam se ona ne
22
moe preneti. Vi ete morati da je traite sami. Moraete da patite, da postanete uenik i
moraete da proete kroz strogu disciplinu. To e biti lini dogaaj. Istina je uvek lina. Ona
se deava osobi. Poverenje je razliito od verovanja. Vera vam je data od drugih, a poverenje
vi stiete sami.
Patanjali ne zahteva nikakvu veru, ali bez poverenja nita ne moe da se uini, bez
poverenja nita nije mogue. Ali vi to ne moete prisiliti - zapamtite. Vi ne moete prisiliti
svoje poverenje; to nije u vaim rukama da ga prisilite. Ako prisiljavate, ono e biti lano. A
nepoverenje je bolje od lanog poverenja, jer troite sebe. Bolje je preseliti se negde drugde
gde realno moe da se dogodi.
Nemojte suditi, nastavite da se kreete. Jednog dana, negde, va uitelj vas oekuje. A
uitelj vam se ne moe pokazati: "Idite tamo i taj e biti va uitelj". Moraete da traite,
moraete da patite, jer kroz patnju i traganje ete moi da ga vidite. Vae oi e postati vedre;
suze e ieznuti. Vae oi e postati bistre i vi ete spoznati da taj jeste va uitelj.
Pria se da je jedan od sufija, po imenu Junaid, doao kod starog fakira i zapitao ga:
"uo sam da vi znate. Pokaite mi put." Starac mu je rekao: "Ti si uo da ja znam. Ti ne zna.
Pogledaj u mene i oseti." ovek je rekao: "Ne mogu osetiti nita. Samo uradite jednu stvar:
pokaite mi put gde mogu nai svog uitelja." Tada je stari ovek rekao: "Prvo idi u Meku.
Naini hodoae i trai takvog i takvog oveka. On e sedeti ispod drveta. Njegove oi e
biti takve da e bacati svetlost, a ti e oseati odreen miris slian mousu oko njega. Idi i
trai."
I Junaid je putovao i putovao dvadeset godina. Gde god je uo za uitelja, on bi otiao.
Ali niti je bilo drveta, niti mirisa, mousa, niti onih oiju koje je opisao starac. Takva linost
nije postojala. A on je imao gotovu formulu, tako da je odmah sudio: "Ovo nije moj uitelj" i
kretao bi dalje. Posle dvadeset godina doao je do drveta. Uitelj je bio tamo. Mous je lebdeo
u vazduhu, ba kao izmaglica okolo oveka. Oi su bile vatrene, zraile su crvenim svetlom.
Pao je pred nogama tog oveka i rekao: "Uitelju, traio sam vas dvadeset godina."
Uitelj je rekao: "Ja takoe ekam tebe dvadeset godina. Pogledaj ponovo." On je
pogledao. To je bio isti ovek koji mu je pre dvadeset godina pokazao put da nae uitelja.
Junaid je zapoeo da plae: "ta, vi se alite sa mnom? Dvadeset godina sam potroio. Zato
mi niste rekli da ste moj uitelj?"
Starac je rekao: "To ti ne bi pomoglo; to nije bilo od velike koristi - jer dok ti nisi
imao oi da vidi... Ovih dvadeset godina su ti pomogle da me vidi; ja sam isti ovek.
Meutim pre dvadeset godina si mi rekao: "Ja ne oseam nita." Ja sam isti, ali ti si sada
postao sposoban da osea. Ti si se promenio. Ovih dvadeset godina su te dobro izglancale.
Sva praina je otpala; tvoj um je ist. Ovaj miris mousa je i u to vreme takoe bio prisutan,
ali ti nisi bio sposoban da ga omirie. Tvoj nos je bio zatvoren; tvoje oi nisu funkcionisale;
tvoje srce nije stvarno kucalo. Tako, kontakt nije bio mogu."
Vi ne znate nikoga koji bi rekao kada e se poverenje dogoditi. Ja ne kaem veruj
uitelju, jednostavno kaem nai osobu gde se poverenje stvara - ta osoba je va uitelj. Vi
nita ne moete uiniti oko toga. Moraete da lutate. Stvar e se sigurno dogoditi, ali traganje
je nuno jer vas ono priprema. Ne vodi vas traganje do uitelja, traganje vas priprema da ga
moete videti. On moe biti sve vreme pokraj vas.
Peto pitanje:
Prole noi ste govorili o satsangu i vanosti uenikove blizine guruu, da li to
podrazumeva fiziku blizinu? Da li je uenik koji ivi na velikoj fizikoj udaljenosti od gurua
na gubitku?
Da i ne. Da, fizika blizina je nuna u poetku jer takvi kakvi jeste ne moete
razumeti nita odmah. Moete razumeti telo; moete razumeti jezik fizikog. Vi postojite u
fizikom, tako da fizika blizina jeste nuna - u poetku.
A ja kaem 'ne' takoe jer kako rastete, kako poinjete da uite drugaiji jezik koji je
nefiziki, onda fizika blizina nije nuna. Onda moete ii svuda. Onda prostor ne ini
nikakvu razliku. Vi ostajete u kontaktu. Ne samo prostor, nego i vreme takoe ne ini nikakvu
23
razliku. Uitelj moe biti mrtav, vi ostajete u kontaktu. On je moda odbacio fiziko telo, vi
ostajete u kontaktu. Ako se poverenje dogodi, onda se oboje, i vreme i prostor transcendiraju.
Poverenje je udo. Vi moete biti u blizini Muhameda, Isusa ili Bude ba sada ako
postoji poverenje. Ali, to je teko! To je teko jer vi ne znate kako. Vi ne moete verovati
ivoj osobi, kako moete verovati mrtvoj. Ako se dogodi poverenje, onda ste upravo sada
blizu Bude. A za osobe koje imaju veru, Buda je iv. Nijedan uitelj nikada ne umire za
onoga ko moe verovati. On nastavlja da pomae, on je uvek tu. Ali za vas, ak i da je Buda
tu fiziki, da stoji iza vas ili ispred vas, da upravo sedi pored vas, vi neete biti bliski s njim.
Moe postojati irok prostor izmeu vas. Ljubav, vera, oni unitavaju prostor, vreme, oboje.
U poetku, poto ne moete razumeti nijedan drugi jezik, moete razumeti samo jezik
fizikog, fizika blizina je nuna - ali samo u poetku. Doi e trenutak kada e vas sam
uitelj poslati daleko. On e vas prisiliti da se udaljite jer je to takoe potrebno - moete
poeti da se lepite uz fiziki jezik.
Gurijev je gotovo uvek, celog svog ivota, slao svoje uenike daleko. On je stvarao
tako jadnu situaciju za njih, da su oni morali da odlaze. Nije bilo mogue iveti s njim. Posle
odreene take, on bi im pomogao da odu daleko. Zaista ih je prisiljavao da odu daleko, jer ne
treba da postanete previe zavisni od fizikog. Drugi, vii jezik, mora da se razvije. Morate
zapoeti da oseate bliskost s njim gde god da ste, jer telo mora biti transcendirano. Ne samo
vae, uiteljevo telo takoe mora biti transcendirano.
Ali u poetku je to velika pomo. Kada je seme zasaeno, kada je pruilo koren, onda
ste dovoljno jaki. Onda moete otii daleko, i tada moete da osetite. Ako odete daleko
kontakt se nee izgubiti - onda kontakt nije od velike vanosti. Poverenje e rasti, to dalje
odete. Poverenje e rasti vie, jer kad god ste na zemlji vi ete konstantno oseati uiteljevo
prisustvo. Poverenje e rasti. Sada e vam on pomagati kroz skrivene ruke, nevidljive ruke.
On e delovati na vas kroz vae snove, i vi ete konstantno oseati da vas on sledi kao senka.
Ali to je vrlo razvijen jezik. Nemojte ga probati od samog poetka jer onda moete biti
obmanuti. Stoga u rei, kreite se korak po korak. Kad god se poverenje dogodi, onda
zatvorite svoje oi i sledite naslepo. Zaista, onog trenutka kada se poverenje dogodi morate
zatvoriti svoje oi. Onda, kakva je korist od miljenja, prosuivanja? Poverenje se dogodilo i
verovanje nee sada sluati nita.
Onda sledite i ostanite blizu dok vas sam uitelj ne poalje daleko. A kada vas poalje
daleko onda se ne vezujte. Onda sledite. Sledite njegove instrukcije i otidite daleko, jer on zna
bolje, i ta je korisno, on zna.
Ponekad, ba pored uitelja, moe vam postati teko da rastete - kao to ispod velikog
drveta nova mladica ima potekoe da izraste. Ispod velikog drveta, novo drvo e postati
obogaljeno. ak i drvee se brine da baci svoje seme daleko tako da moe proklijati. Drvee
koristi mnoge trikove da poalje seme daleko; inae ono bi umrlo, ako padne ba ispod
velikog drveta. Tamo je previe senke. Sunce nikako tamo ne dopire, malo sunevih zraka
tamo dosee.
Dakle, uitelj zna bolje. Ako on osea da vi treba da odete daleko, onda se ne opirite.
Onda jednostavno sledite i otidite daleko. Ovo odlaenje daleko e biti dolaenje blie njemu.
Ako moete slediti, ako moete tiho slediti bez ikakvog otpora, ovo odlaenje daleko e biti
dolaenje blizu. Vi ete postii novu bliskost.
esto pitanje:
Kada traite od nas da razumemo neto jasno, kome se vi obraate da razume? Um
treba da se obustavi. Zbog toga nije od koristi uiniti da um razume sve. Ko onda treba da
razume?
Da, um treba da prestane, ali on nije jo prestao. Na umu treba da se radi; jedno
razumevanje treba da se stvori u umu. Kroz ovo razumevanje ovaj um e umreti. To
razumevanje je ba slino otrovu. Vi uzmete otrov i otrov vas ubije. Tako i um razume, ali
samo razumevanje je otrov za um. Zbog toga se um opire tako mnogo. On stalno pokuava da
ne razume. On stvara sumnju, bori se na svaki nain, titi sebe jer razumevanje je otrov za um.
24
On je eliksir za vas, ali za um je otrov.
Dakle, kada kaem razumite jasno, mislim na va um, ne na vas, jer vama ne treba
nikakvo razumevanje. Vi ve razumete. Vi ste sama mudrost - pranya.
Vama nije potrebna nikakva pomo od mene ili od nekoga drugog. Va um treba da
bude promenjen. A ako se razumevanje dogodi umu, um e umreti, a sa umom razumevanje
e ieznuti. Onda ete biti u vaoj iskonskoj istoti. Onda e vae bie reflektovati istotu
slino ogledalu - nema sadraja, besadrajno. Inae to unutranje bie ne treba razumevanje.
Ono je ve sama sr razumevanja. Njemu ne treba razumevanje - samo oblaci uma zahtevaju
uveravanja.
Dakle, ta je razumevanje zaista? Samo nagovaranje uma da ode. Zapamtite, ja ne
kaem borba, ja kaem nagovaranje. Ako se borite, um nikada nee otii, jer kroz borbu vi
pokazujete svoj strah. Ako se borite, vi pokazujete da je um neto od ega se bojite. Samo
uveravajte. Sva ova uenja, sve meditacije su duboko uveravanje uma da doe do take gde
e poiniti samoubistvo, gde on jednostavno otpada, gde um sam po sebi postaje takva
apsurdnost da ga ne moete vie nositi - vi ga jednostavno ispustite. Bolje je rei, um otpada
sam od sebe.
Dakle, kada ja neto objanjavam radi jasnog razumevanja, ja se obraam vaem umu.
Ne postoji drugi nain. Samo vaem umu se moe pristupiti jer ste vi nedostupni. Vi ste tako
skriveni duboko unutra, a samo um je na vratima. Um treba ubediti da napusti vrata i da
ostavi vrata otvorena. Onda ete vi postati dostupni.
Ja se obraam umu - vaem umu, ne vama. Ako se um odbaci, nije potrebno obraati
se - mogu sedeti u tiini i vi ete razumeti; nije potrebno obraati se. Umu su potrebne rei;
umu trebaju misli; umu je potrebno neto mentalno to ga moe nagovoriti. Buda, Patanjali
ili Krina govorei vama, obraaju se vaem umu.
Doe momenat kada um jednostavno postane svestan cele apsurdnosti. To je ba kao
ovo: ako vas vidim da vuete vae pertle za cipele, i pokuavate da povuete sebe navie
pomou njih, i ako vam kaem: "Kakvu besmislicu inite; to je nemogue." Pomou vaih
pertli za cipele, ne moete podii sebe navie. To je jednostavno nemogue; to se ne moe
dogoditi. Tako vas ja nagovaram da mislite vie o celoj stvari: "To je apsurd. ta to radite?" A
onda se oseate jadno jer to se ne dogaa, tako ja nastavljam da vam govorim, insistirajui,
udarajui ekiem. Jednog dana moete postati svesni: "Da, ovo je apsurd. ta to radim?"
Isto kao podizanje sebe uz pomo pertli za cipele, jeste sav va napor uma. Sve to
radite je apsurd. Ne moe vas odvesti nigde do u pakao, u nevolju. To vas je uvek vodilo u
bedu, ali vi jo niste toga bili svesni. Sva ova komunikacija od mene je samo da uini va um
svesnim da je sav njegov napor apsurdan. Jednom kada doete do oseanja da je itav napor
apsurd, napor iezava. Ne samo da ete morati da ostavite svoje pertle za cipele, ve i da ete
morati da inite ikakav napor, i to e biti apsurdno, vi ete jednostavno uvideti injenicu,
ostaviete i smejaete se. Postali ste prosvetljeni ako ostavite svoje pertle za cipele,
jednostavno ustanete i smejete se. To e se tako dogoditi.
Kroz razumevanje um otpada. Iznenada vi postajete svesni da niko nije bio odgovoran
za vau nevolju, vi ste je stvarali neprekidno; iz trenutka u trenutak vi ste bili tvorac. Vi ste
stvarali bedu, a onda ste traili kako da odete izvan nje, kako da ne budete jadni, kako da
postignete blaenstvo, kako da dostignete samadhi. I dok ste o tome pitali vi ste je stvarali.
ak i ovo pitanje. "Kako dostii samadhi?" je stvaranje patnje jer onda vi kaete: "Ja sam
uinio tako mnogo napora, a samadhi jo nije postignut. Uradio sam sve to je trebalo uraditi,
a samadhi jo nije postignut. Kada u postati prosvetljen?"
Sada vi stvarate novu nevolju kada ste nainili prosvetljenje takoe predmetom elje,
to je apsurdno. Nijedna elja nee doi do ispunjenja. Kada shvatite ovo, elje otpadaju - vi
ste prosvetljeni. Bez elja, vi ste prosvetljeni. Sa eljama vi se kreete u krugu patnje.
Poslednje, sedmo pitanje:
Rekli ste da je joga nauka, metodologija za unutarnje buenje. Ali napor da se bude
blie ne-umu, sadri motivaciju i nadu. ak i podvrgavanje procesu unutranje
transformacije sadri motivaciju. Kako onda ovek moe da se kree na stazi joge sa nadom i
25
motivacijom? Zar i samo ekanje ne sadri motivaciju?
Da, ne moete da se kreete na stazi joge s motivacijom, sa eljom, sa nadom. Zaista,
tako nema kretanja na stazi joge. Kada doete do shvatanja da su sve elje apsurdne, da su sve
elje patnja, nema ta da se ini, jer svako injenje e biti nova elja. Nema ta da se ini!
Jednostavno ne moete initi nita jer ta god vi inili vodie vas u novu patnju. Onda ne
inite. elje su naputene, um je prestao, i to je joga; uli ste u jogu. To nije kretanje, to je
smirenost. Zbog jezika se javlja problem. Ja sam rekao da ste uli, pa izgleda kao da ste se
kretali. Kada elje prestanu, svo kretanje prestaje. Vi ste u jogi: "a sada disciplina joge".
Sa motivacijom, u ime joge, stvoriete opet druge nevolje. Ja viam svakog dana
takve ljude. Oni dolaze i govore: "Ja sam praktikovao jogu trideset godina, nita se nije
dogodilo." Ali ko vam je rekao da e se neto dogoditi? On mora da je oekivao neto da se
dogodi; zbog toga se nita nije dogodilo. Joga kae da ne ekamo na budunost. Vi
meditirate, ali meditirate s motivom da ete kroz meditaciju doi negde do nekog cilja. Vi
proputate svrhu. Meditirajte i uivajte u tome. Ne postoji cilj. Ne postoji budunost, nema
dalje; ne postoji nita ispred. Meditirajte, uivajte u tome - bez ikakve motivacije.
I iznenada, cilj je tu. Iznenada oblaci iezavaju jer su oni stvoreni od vaih elja.
Vaa motivacija je dim koji stvara oblake; oni su iezli. Dakle, igrajte se meditacijom;
uivajte u tome. Ne inite je sredstvom za neto. Ona je kraj svega. Ovo je sva sutina koju
treba razumeti.
Ne stvarajte nove elje. Shvatite pravu prirodu elje, da je patnja. Samo pokuajte da
razumete prirodu elje, i doi ete do saznanja da je ona patnja. ta onda treba uraditi? Nita
ne treba raditi! Postajui svesni da je elja patnja, elja iezava. A sada, disciplina joge. Uli
ste na stazu.
A to zavisi od vae snage. Ako je vaa spoznaja da je elja patnja tako duboka da je
totalna, ne samo da ete ui u jogu, vi ete postati siddha. Vi ste postigli cilj.
To e zavisiti od vae snage. Ako je snaga totalna, onda ste postigli cilj. Ako vaa
snaga nije totalna, vi ste samo uli na stazu.
26
Poglavlje 3
PET MODIFIKACIJA UMA
27. decembar 1973.
I, 5: vrttayah pancatayyah klitaklitah.
Obrta ima pet vrsta. [Neki od njih] su ometajui (klita) [po proces
samoprepoznavanja subjekta] neki to nisu (aklita).
I, 6: pramanaviparyayavikalpanidrasmrtayah.
Istinosna spoznaja, zabluda, afektivno uivljavanje u imaginativnom
(vikalpa), spavanje i seanje [ine tih pet obrta].
Um moe biti ili izvor ropstva ili izvor slobode. Um postaje kapija za ovaj svet, ulaz;
on takoe moe postati i izlaz. Um vas vodi do pakla; um moe da vas odvede i do raja. Dakle
to zavisi od toga kako se um koristi. Ispravna upotreba uma postaje meditacija, neispravna
upotreba uma postaje ludilo.
Um je prisutan kod svakog. Mogunosti tame i svetla prisutne su u njemu. Sam um
nije ni neprijatelj ni prijatelj. Vi ga moete uiniti prijateljem, a moete ga uiniti i
neprijateljem. To zavisi od vas - od vas koji ste skriveni iza uma. Ako moete uiniti um
svojim instrumentom, svojim robom, um postaje prolaz kroz koji moete dostii krajnje,
maksimum. Ako postanete rob i umu dozvolite da bude gospodar, onda e vas ovaj um koji je
postao gospodar voditi do krajnjeg bola i tame.
Sve tehnike, sve metode, svi delovi joge, bave se zaista duboko samo s jednim
problemom: kako koristiti um. Ispravno korien um dolazi do take gde on postaje ne-um
(gde nema uma). Pogreno korien, um dolazi do take gde je on samo haos, mnogi glasovi
suprotstavljeni jedni drugima - kontradiktorni, zbunjujui, umobolni.
Ludak u ludnici i Buda ispod bodhi drveta - obojica su koristili um; obojica su
prolazili kroz um. Buda je doao do take gde je um iezao. Pravilno korien on nastavlja
da iezava; i doe momenat kada on vie nije. Ludak je takoe koristio um. Pogreno
korien, um postaje podeljen; nepravilno i krivo korien um postaje mnotvo. I, konano,
ludi um je tu, vi ste sasvim odsutni.
Budin um je iezao, a Buda je prisutan u svojoj celosti. Ludakov um je postao
celovit, a on sam je iezao sasvim. Ovo su dva pola. Vi i va um, ako postojite zajedno, onda
ete biti u patnji. Ili ete vi morati da nestanete, ili e um morati da nestane. Ako um nestane,
onda vi postiete istinu; ako vi nestanete, postiete ludilo. A to je borba: ko e nestati? Vi ete
nestati ili um? To je protivrenost, koren svake borbe.
12
Ove Patanjalijeve sutre e vas voditi korak po korak prema ovom razumevanju uma -
ta je on, koje sve oblike on uzima, koje vrste modifikacija dolaze iz njega, kako ga moete
koristiti i dopreti izvan njega. I zapamtite, vi nemate nita drugo upravo sada - samo um.
Morate ga koristiti.
12
U knjizi Newton Michael: "Putovanje dua" detaljno je opisano stanje due izmeu ivota i kako se due
raaju u novom telu. Do tih informacija autor je doao zahvaljujui hipnotikoj regresiji svojih pacijenata. Tu se
svedoi da dua ulazi u telo pri poroaju ili malo pre toga, ali ne boravi stalno u telu do starosti deteta do 6 ili 7
godina. Dotle esto izlazi dok spava ili na javi. Tek od toga doba dua stalno boravi u telu. Takoe je dokazano
da telo moe da deluje vrlo sloeno i bez uma, kao u somnabulnom stanju (mesearenju) ili u hipnozi. Tako se i
ovde moe razumeti da je duevni bolesnik onaj ovek, ili tanije, ono telo koje je dua napustila iz nekog
razloga, a telo je ostalo energizovano i delatno u izvesnoj meri. Prisustvo due daje svest i razumevanje. Bez nje
se ovek ponaa nerazumno i mehaniki, animalno, bez ikakve savesti. Takoe postoje "organski portali",
ljudska tela koja nemaju ljudsku duu ve su nastanjena drugim svesnim entitetima. O knjizi Putovanje dua
videti na http://www.ivantic.net/ostale_knjiige.htm
27
Ako ga pogreno koristite vi ete nastaviti da padate u sve veu i veu patnju. Vi jeste
u patnji. To je zato to ste tokom mnogo ivota koristili svoj um pogreno. I um je postao
gospodar; vi ste samo rob, senka koja sledi um. Ne moete rei umu: "Stani", ne moete
narediti svom vlastitom umu; va um stalno nareuje vama i vi ga morate slediti. Vae bie je
postalo senka i rob, jedno orue.
Um nije nita drugo ve orue, upravo kao to su vae ruke ili vae noge. Vi naredite
svojim stopalima - svojim nogama, one se kreu. Kada kaete: "Stanite", one se zaustavljaju.
Vi ste gospodar. Ako elim da pokrenem svoju ruku, ja je pokreem. Ako ne elim da je
pomerim, ja je ne pomeram. Ruka ne moe da mi kae: "Sada elim da budem pomerena."
Ruka ne moe rei meni: "Sada u se ja pomeriti ta god ti da ini. Ja te neu sluati." A ako
moja ruka zapone da se kree u inat meni, onda e nastupiti haos u mom telu. To se dogodilo
sa umom.
Vi ne elite misliti, a um nastavlja da misli. Vi elite da spavate. Leite na svom
krevetu, okreui se as na jednu as na drugu stranu elite da se uspavate, a um nastavlja, um
govori: "Ne, ja u razmiljati o neemu." Vi stalno govorite "Stani" a on vas nikada ne slua. I
ne moete uiniti nita. Um je takoe jedno orue, ali ste mu dali previe moi. On je postao
diktator, i borie se jako ako pokuate da ga postavite na njegovo pravo mesto.
Buda je takoe koristio um, ali je njegov um samo kao vae noge. Ljudi i dalje dolaze
kod mene i pitaju me: "ta se deava s umom prosvetljenog oveka? Da li on jednostavno
iezava? On ne moe da ga koristi?"
On iezava kao gospodar, a ostaje kao rob. On ostaje kao pasivno orue. Kada Buda
eli da ga koristi, on moe da ga koristi. Kada Buda govori vama on e morati da ga koristi,
jer ne postoji mogunost govora bez uma. Um treba da se koristi. Ako odete kod Bude i on
vas prepozna, da ste bili takoe ranije, on mora da koristi um. Bez uma ne moe biti
prepoznavanja; bez uma ne moe biti pamenja. Meutim zapamtite da on koristi um - a vi ste
korieni od uma, u tome je razlika. Kad god eli da ga koristi, on ga koristi. Kad god ne eli
da ga koristi, on ga ne koristi. On je pasivno orue; on se ne hvata za njega.
Dakle, Buda ostaje kao ogledalo. Ako doete ispred ogledala, ogledalo vas reflektuje.
Kada se uklonite, odraavanje nestaje; ogledalo je prazno. Vi niste kao ogledalo. Vidite
nekoga, on ode, ali miljenje se nastavlja, refleksija se nastavlja. Vi nastavljate da mislite o
njemu. ak i ako biste eleli da prestanete, um ne bi posluao.
Gospodarenje nad umom je joga. A kada Patanjali kae "obustavljanje uma", ovim se
misli na prestajanje u svojstvu gospodara. Um prestaje da biva gospodar. Onda on nije
aktivan. Onda je on pasivno orue. Vi naredite, on radi; vi ne naredite, on ostaje smiren. On
samo eka. On ne moe da se dokazuje i gura napred sam od sebe. Njegovo nametljivo
dokazivanje se gubi; nasilje se gubi. On nee pokuavati da vas kontrolie.
Sada je upravo obrnut sluaj. Kako da se postane gospodar? Kako da se stavi um na
njegovo mesto, gde moete da ga koristite; gde, ako ne elite da ga koristite, moete ga
ostaviti po strani i ostati smireni. Mora se razumeti ceo mehanizam uma. Sada bi trebalo ui u
sutru.
Prvo:
Modifikacija uma ima pet. One mogu biti ili izvor bola ili nepostojanja bola.
Prva stvar koju treba razumeti je da um nije neto razliito od tela, zapamtite. Um je
deo tela. On je telo, ali jako suptilno stanje tela, vrlo delikatno, vrlo profinjeno. Ne moete ga
uhvatiti, ali kroz telo moete uticati na njega. Ako uzmete drogu, ako uzmete LSD, marihuanu
ili neto drugo, ili alkohol, odjednom je um obuzet njihovim uticajem. Alkohol ulazi u telo, ne
u um, ali je um pod uticajem. Um je najsuptilniji deo tela.
Obrnuto je takoe istina. Dejstvom uma i telo biva pod njegovim uticajem. To se
deava u hipnozi. Osoba koja ne moe hodati, koja kae da ima paralizu, moe hodati pod
hipnozom. Vi nemate paralizu, ali ako vam se pod hipnozom kae: "Sada je vae telo
paralisano; vi ne moete hodati", neete moi da hodate. Paralizovan ovek moe hodati pod
hipnozom. ta se dogaa? Hipnoza dopire u um, sugestija odlazi u um. Onda telo to sledi.
Prva stvar koju treba razumeti: um i telo nisu dvoje. Ovo je jedno od najdubljih
Patanjalijevih otkria. Moderna nauka je to tek nedavno priznala na Zapadu. Sada oni kau:
28
telo-um, potpuno su srodni, podela nije ispravna. Dakle, oni kau to je psihosoma: to je um-
telo. Ova dva izraza su samo dve funkcije jednog fenomena. Jedan pol je um, a drugi pol je
telo, stoga se to naziva psihosomatskom pojavom.
Telo ima pet organa aktivnosti - pet indriyani, pet orua aktivnosti. Um ima pet
modifikacija, pet naina delovanja. Um i telo su jedno. Telo je podeljeno u pet funkcija; um je
takoe podeljen u pet funkcija. Detaljno emo ui u svaku funkciju.
Drugi deo ove sutre je:
One mogu biti ili izvor bola ili nepostojanja bola.
Ovih pet modifikacija uma, ova celovitost uma, moe vas voditi u duboki bol, u
dukkhu, ili patnju. Ili ako ispravno koristite um, njegovo delovanje, moe vas odvesti do
nepostojanja bola ili patnje. Moe vas odvesti u potpuno osloboenje od patnje.
Re "nemanje patnje" je vrlo znaajna. Patanjali ne kae da e vas to voditi u
anandu, u blaenstvo, ne. Um moe da vas vodi u patnju ako ga nepravilno koristite, ako
postanete njegov rob. Ako postanete gospodar, um vas moe voditi do nemanja patnje - ne u
blaenstvo, jer blaenstvo je vaa priroda; um vas ne moe voditi do nje. Ali ako ste u
"nemanju patnje", unutranje blaenstvo zapoinje da tee.
Blaenstvo uvek postoji unutra, u vaoj sutinskoj unutranjoj prirodi. To nije neto
to treba da se ostvari ili zaradi; to nije neto to treba da se negde postigne. Vi ste roeni s
tim; ve to imate; to je ve sluaj. Zbog toga Patanjali ne kae da vas um moe voditi u
patnju, a moe vas voditi i u blaenstvo - ne! On je vrlo nauan, vrlo precizan. On nee
koristiti ak nijednu re koja moe dati vama bilo koju neistinitu informaciju. On jednostavno
kae, ili patnja ili nepostojanje patnje.
Buda takoe kae mnogo puta, kad god tragaoci dou kod njega, a tragaju za
blaenstvom, tako da e pitati Budu: "Kako moemo dostii blaenstvo, krajnje blaenstvo?"
On e rei: "Ne znam. Mogu vam pokazati put koji vodi do nemanja patnje, samo odsustvo
patnje. Ja ne kaem nita o pozitivnom blaenstvu, samo negativnom. Mogu vam pokazati
kako da se kreete u svetu nemanja patnje."
To je sve to metode mogu uiniti. Jednom kada ste u stanju nemanja bede, unutranje
blaenstvo poinje da tee. Ali to ne dolazi iz uma, to dolazi iz vaeg unutranjeg bivstva,
Sopstva. Dakle um nema nita da ini s tim; um ne moe stvoriti to. Ako je um u patnji, onda
um postaje prepreka. Ako je um u nemanju patnje, onda um postaje jedan otvoren prolaz. Ali
on nije kreativan; on ne ini nita.
Vi otvorite prozore i sunevi zraci ulaze. Otvaranjem prozora vi ne stvarate sunce.
Sunce je ve bilo tu. Da ono nije bilo tu, onda samo otvaranjem prozora, zraci ne bi uli. Va
prozor moe biti prepreka - sunevi zraci mogu biti spolja a prozor je zatvoren. Prozor ih
moe spreiti ili im otvoriti put. On moe da postane prolaz, ali on ne moe biti kreativan. On
ne moe kreirati zrake; zraci su tu.
Va um, ako je u nevolji, postaje zatvoren. Zapatite, jedna od karakteristika patnje je
zatvorenost. Kad god ste u patnji, vi postajete zatvoreni. Obratite panju - kad god oseate
neku muku, vi ste zatvoreni za svet. ak i za vaeg najdraeg prijatelja vi ste zatvoreni. ak i
za svoju enu, vau decu, vaeg voljenog, vi ste zatvoreni kada ste u patnji, jer patnja vam
daje povlaenje unutra. Vi se povlaite. Sa svih strana vi ste zatvorili vrata.
Zbog toga u patnji ljudi zapoinju da misle na samoubistvo. Samoubistvo znai
totalno zatvaranje - nema mogunosti ni za kakvu komunikaciju, nema mogunosti ikakvih
vrata. ak i zatvorena vrata su opasna. Neko moe da ih otvori, tako da srui vrata, uniti sve
mogunosti. Samoubistvo znai: "Sada u unititi sve mogunosti nekog otvaranja. Tako u
biti zatvoren u sebe potpuno."
Kad god ste u nevolji vi zapoinjete da mislite o samoubistvu. Kad god ste sreni ne
moete misliti o samoubistvu; to ne moete zamisliti. Ne moete ak ni zamisliti: "Zato ljudi
izvravaju samoubistvo? ivot je takva radost, ivot je tako snana muzika, zato ljudi
unitavaju ivot." To izgleda nemogue.
Zato, kada ste sreni, to izgleda nemogue? Jer ste otvoreni; ivot tee u vama. Kada
ste sreni vi imate veu duu, proirenu. Kada ste nesreni vi imate manju duu, stegnutu.
Kada je neko nesrean, dodirnite ga, uzmite njegovu ruku u svoju ruku. Osetiete da je
29
njegova ruka mrtva. Nita ne tee kroz nju - nema ljubavi, nema topline. Ona je ba hladna,
kao da pripada leu. Kada je neko srean, dodirni njegovu ruku, postoji komunikacija,
energija tee. Njegova ruka nije samo mrtva ruka, njegova ruka je postala most. Kroz njegovu
ruku neto dolazi do vas, prenosi se, dovodi u vezu. Toplota klizi. On dosee do vas. On ini
svaki napor da se izlije u vas i dozvoljava vama takoe da se izlijete u njega.
Kada su dve osobe srene, one postaju jedno. Zbog toga u ljubavi jedinstvo se dogaa
i ljubavnici zapoinju da oseaju da oni nisu dvoje. Oni su dvoje, a poinju oseati da nisu
dvoje jer su u ljubavi tako sreni da se deava stapanje.
Oni se stapaju jedno u drugo; oni se ulivaju jedno u drugo. Granice se rastvaraju,
odrednice su nejasne, i oni ne znaju ko je ko. U tom momentu oni postaju jedno.
Kada ste sreni, vi se moete izliti u druge i moete dopustiti drugima da se izliju u
vas; to je ono to slavljenje znai. Kada dozvoljavate svakome da tee u vama, a vi se izlivate
u svakoga, vi slavite ivot. Slavljenje je najvea molitva, najvii vrhunac meditacije.
U patnji vi poinjete misliti da izvrite samoubistvo; u nevolji, poinjete da mislite o
destrukciji. U patnji, vi ste samo na suprotnom polu slavljenja. Vi osuujete. Ne moete
slaviti. Vi ste kivni na svakoga. Sve je pogreno i vi ste negativni, i ne moete se izliti, vi se
ne moete dovesti u vezu, i ne moete dozvoliti nikome da se izlije u vas. Vi ste postali ostrvo
- potpuno zatvoreni. Ovo je iva smrt. ivot je samo kada ste otvoreni i teete, onda ste
neuplaeni, neustraivi, otvoreni, osetljivi, slavite.
Patanjali kae da um moe initi dve stvari. On moe stvoriti patnju. Moete ga
koristiti na takav nain da moete postati jadni, i koristili ste ga. Nije potrebno mnogo
govoriti o tome; vi to ve znate. Vi znate umetnost kako da stvorite patnju, nevolju. Moda
niste svesni, ali to je ono ta vi inite, neprekidno. ta god da dodirnete postaje izvor patnje.
Kaem: bilo ta!
Vidim siromane ljude. Oni su u patnji, oevidno. Oni su siromani; osnovne potrebe
ivota nisu im ispunjene. A onda vidim bogate ljude, oni su takoe u patnji. A oni misle, ovi
bogati ljudi, da bogatstvo ne vodi nikuda. To nije ispravno. Bogatstvo moe voditi do slavlja,
ali vi nemate um da slavite. Tako ako ste siromani vi ste u patnji; ako postanete bogati vi ste
vie u patnji. Onog momenta kada dodirnete bogatstvo, vi ste ga unitili.
Jeste li uli grku priu o kralju Midasu? Sve to bi dodirnuo pretvorilo bi se u zlato.
Vi dotaknete zlato, odmah ono postane blato. Ono se pretvori u prainu, a onda vi mislite da
ne postoji nita u svetu, ak i bogatstvo je beskorisno. Ono nije beskorisno. Ali va um ne
moe slaviti, va um ne moe uestvovati ni u jednom nemanju patnje. Ako ste pozvani u raj,
tamo neete nai raj, stvoriete pakao. Gde god bili, ta god inili vi ete nositi svoj pakao sa
sobom.
Postoji arapska poslovica, da pakao i raj nisu geografska mesta, ona su gledita,
stanovita. Niko ne ulazi u pakao ili raj, svako ulazi sa rajem ili paklom. Gde god idete vi
imate svoju projekciju pakla ili projekciju, predstavu raja sa vama. Vi imate unutra projektor.
Odmah projektujete.
Meutim, Patanjali je paljiv. On kae: "Patnja ili nemanje patnje" - pozitivna patnja
ili negativna patnja - ali ne blaenstvo. Um vam ne moe dati blaenstvo; niko vam ga ne
moe dati. Ono je skriveno u vama, i kada je um u stanju nemanja patnje to blaenstvo
zapoinje da tee. Ono ne dolazi od uma, ono dolazi iza uma. Zbog toga on kae da stanja
uma mogu biti bilo izvor jada ili nemanja jada. Modifikacija uma ima pet.
Druga sutra:
One su ispravno znanje, pogreno znanje, imaginacija (mata), spavanje i pamenje.
(I, 6)
Prvo je pramana, ispravno znanje. Sanskritska re pramana je vrlo duboka i zaista ne
moe biti prevedena. Ispravno znanje je upravo senka, nije tano znaenje, jer ne postoji re
kojom moe da se prevede pramana. Pramana dolazi od korena prama. Mnoge stvari treba
shvatiti u vezi toga.
Patanjali kae da um ima sposobnost. Ako je ta sposobnost usmerena pravilno, onda
sve to se zna jeste istinito; to je samo-oevidno istinito. Mi nismo svesni o tome jer nikada to
nismo koristili. Ta sposobnost je ostala neiskoriena. To je kao Soba je mrana, vi uete
30
unutra, imate baklju, ali je ne koristite - tako da soba ostaje mrana. Stalno se spotiete na
stvarima, na stolu, na stolici, a imate baklju, ali baklja mora da se upali. Kada jednom upalite
baklju, odmah tama iezava. I gde god je baklja okrenuta vi znate. Barem to mesto postaje
oigledno i jasno.
Um ima sposobnost za pramanu, za ispravno znanje, za mudrost. Jednom kada znate
kako da ga upalite, onda gde god da usmerite to svetlo, samo pravo znanje se otkriva. Bez
takvog znanja, ta god da znate bie pogreno.
Um ima sposobnost za pogreno znanje, takoe. To pogreno znanje se naziva na
sanskritu viparyaya - lano, mithya. I vi imate tu sposobnost takoe. Uzmete alkohol. ta se
deava? Ceo svet postaje viparyaya; ceo svet postaje laan. Poinjete da vidite stvari koje ne
postoje.
ta se dogodilo? Alkohol ne moe stvoriti stvari. Alkohol ini neto unutar vaeg tela i
mozga. Alkohol zapoinje da deluje na centar koji Patanjali zove viparyaya. Um ima centar
koji moe izokrenuti sve. Jednom kada taj centar zapone da funkcionie, sve je izokrenuto.
Podsetio sam se na Jednom se dogodilo da su Mula Nasrudin i njegov prijatelj pili u
krmi. Izali su sasvim pijani, a Nasrudin je bio stari, iskusni pijanac. Drugi je bio nov, tako
da je bio vie obuzet pijanstvom. Pitao je: "Sada ne mogu videti, ne mogu uti, ne mogu ak
ni hodati valjano. Kako u stii do kue? Kai mi Nasrudine, molim te pokai mi put. Kako
mogu stii do moje kue?"
Nasrudin je rekao: "Prvo kreni. Posle mnogo koraka doi e do mesta gde postoje dva
puta: jedan ide desno, drugi ide levo. Ti idi na levo jer onaj koji vodi na desno ne postoji. Ja
sam bio mnogo puta na tom desnom takoe, ali sam sada iskusan ovek. Videe dve staze.
Odaberi levu, nemoj izabrati desnu stazu. Ta desna ne postoji. Mnogo puta sam iao njom, a
onda nikada da stigne, nikada ne stigne svojoj kui."
Jednom je Nasrudin uio svog sina prvoj lekciji iz pijanstva. Rekao mu je Sin je
pitao, on je bio radoznao. Pitao je: "Kada ovek treba da prestane?" Nasrudin je odgovorio:
"Pogledaj na onaj sto. etiri osobe sede tamo. Kada pone da vidi osam, prestani!" Mladi
je rekao: "Ali oe, tamo samo dve osobe sede!"
Um ima dar. Taj dar funkcionie kada ste pod bilo kojim uticajem droge, bilo kakvog
opojnog sredstva. Tu sposobnost Patanjali zove viparyaya, pogreno znanje, centar
izopaavanja.
Tano nasuprot njemu postoji centar koji ne znate. Tano naspram njega postoji
centar. Ako meditirate duboko, smireno, drugi centar e poeti da funkcionie. Taj centar se
naziva pramana, ispravno znanje. Kroz funkcionisanje tog centra, sve to znate jeste ispravno.
Nije pitanje ta znate, nego je pitanje odakle znate.
Zbog toga su sve religije bile protiv alkohola. To nije na nekoj moralnoj osnovi, ne!
To je zato to alkohol utie na centar izopaavanja. A svaka religija je za meditaciju, jer
meditacija znai stvaranje sve vie i vie smirenosti, vie i vie postajete tihi.
Alkohol uvek ini sasvim suprotno, ini vas sve vie i vie potresenim, uzbuenim,
smetenim. Drhtanje ulazi u vas. Pijanica ne moe ak ni hodati kako valja. Njegova ravnotea
je izgubljena. Ne samo u telu, ve je i u umu.
Meditacija znai sticanje unutarnje ravnotee. Kada steknete unutarnju ravnoteu i
nema drhtanja, celo telo i um postaju smireni, onda centar ispravnog znanja poinje da
funkcionie. Kroz taj centar sve to se saznaje jeste istinito.
Gde ste vi? Vi niste alkoholiari, niste meditanti, morate biti negde izmeu njih. Vi
niste ni u jednom centru. Vi ste izmeu ova dva centra, pogrenog znanja i ispravnog znanja.
Zbog toga ste zbunjeni.
Ponekad imate letimino sagledavanje. Naginjete malo prema centru ispravnog znanja,
onda odreena letimina sagledavanja vam dolaze. Naginjete se prema centru koji je
izopaavanje, onda izopaenost ulazi u vas. I sve je pomeano, vi ste u haosu. Zbog toga, ili
ete morati da postanete meditanti ili ete morati da postanete alkoholiari, jer pometnje je
previe. I to su ta dva puta.
Ako izgubite sebe u opijenosti, onda ste u spokojstvu. Barem ste zadobili centar -
moda onaj sa pogrenim znanjem, ali ste usrediteni. itav svet moe rei da niste u pravu.
31
Vi ne mislite tako, vi mislite da itav svet nije u pravu. Barem u tim momentima nesvesnosti
vi ste usrediteni, usrediteni u pogrenom centru. Ali vi ste sreni, jer ak i pogreno
usreditenje vam daje odreenu sreu. Vi uivate u tome, otuda tako velika privlanost
alkohola.
Vlade su se borile vekovima. Zakon je donesen, zabrana i sve, ali nita ne pomae.
Dok oveanstvo ne postane meditativno, nita ne moe pomoi. Ljudi e nastaviti, oni e
nai nove naine i nova sredstva da postanu opijeni. Ne mogu se spreiti, a to vie
pokuavate da ih spreite, s vie zakona zabrane, vie ih to privlai.
Amerika je uradila to i morala je da se povue. Pokuali najbolje to su mogli, ali kada
je alkohol bio zabranjen vie se koristio. Oni su pokuali; nisu uspeli. Indija je pokuavala
nakon sticanja nezavisnosti. Nije uspela, i mnoge drave su to pokrenule ponovo. To se ini
beskorisno.
Dok se ovek ne promeni u sebi, ne moete ga prisiliti ni na kakvu zabranu.
Nemogue je, jer e onda ovek poludeti. To je njegov nain da ostane normalan. Za nekoliko
sati on postane drogiran, "okamenjen", onda je u redu. Onda nema patnje; onda nema jada.
Patnja e doi, jad e doi, ali je to barem odloeno. Sutra ujutru patnja e biti tu, jad e biti tu
- on e morati da se suoi s tim. Meutim, do veeri se moe opet nadati - uzee pie i bie
spokojan.
Postoje dve alternative. Ako niste meditativni, pre ili kasnije moraete nai neku
drogu. Postoje suptilne droge. Alkohol nije suptilan, on je vrlo grub. Postoje suptilne droge.
Seks moe postati za vas droga. Kroz seks moete upravo gubiti svoju svesnost. Sve moete
koristiti kao drogu. Samo meditacija moe pomoi. Zato? Meditacija vam daje usreditenost
na centar koji Patanjali zove praman.
Zato svaka religija toliko istie meditaciju? Meditacija mora da ini neko unutranje
udo. Ovo je to udo: meditacija vam pomae da osvetlite ispravno znanje. Onda gde god se
kreete, na ta god da se usmerite, ta god da spoznate - jeste istinito.
Budi su postavljali hiljade i hiljade pitanja. Neko ga je pitao jednom kada su doli k
njemu s novim pitanjima: "Nismo ak ni postavili pitanje, a vi ste poeli da odgovarate.
Nikada ne razmiljate o tome. Kako se to deava?"
Na to je Buda odgovorio: "To nije pitanje razmiljanja. Vi postavite pitanje i
jednostavno, ja posmatram to. I ta god je istina to se otkriva. To nije pitanje zamiljanja i
razmiljanja oko njega. Odgovor ne dolazi kao logini zakljuak. To je samo usredsreivanje
na pravi centar."
Buda je kao baklja. Gde god se baklja pokrene, ona otkriva. Kakvo god da je pitanje,
to nije poenta. Buda ima svetlost, kad god ta svetlost padne na neko pitanje, odgovor e biti
otkriven. Odgovor e doi iz te svetlosti. To je jednostavan fenomen, otkrovenje.
Kada vas neko pita, treba da razmislite o tome. Ali kako moete razmiljati ako ne
znate? Ako znate, nije potrebno razmiljati. Ako ne znate, ta ete uraditi? Traiete u
pamenju, nai ete mnogo reenja. Samo ete nainiti krpe. Vi zapravo ne znate; inae
odgovor bi doao odmah.
Sluao sam o uiteljici, uiteljici iz osnovne kole. Pitala je decu: "Imate li neka
pitanja?" Jedan mali deak je ustao i rekao: "Ja imam jedno pitanje i ekao sam da li ete
pitati da postavimo pitanja. Koliko je teka cela zemlja?"
Bila je zateena i uznemirena, jer nikada nije mislila o tome, nikada nije itala o tome.
Koja je teina cele zemlje? Stoga je izvela trik koji uitelji znaju. Oni su morali da izvode
trikove. Rekla je: "Da, pitanje je znaajno. Dakle sutra, svako treba da nae odgovor."
Trebalo joj vreme. "Dakle, sutra u vam postaviti to pitanje. Ko god da pravilan odgovor
dobie poklon."
Sva deca su istraivala i istraivala, ali nisu mogla da nau odgovor. Uiteljica je
odjurila u biblioteku. Cele noi je istraivala, i upravo pred jutro nala je teinu zemlje. Bila je
vrlo srena. vratila se natrag u kolu, a deca su bila tu. Ona su bila iscrpljena. Rekli su da nisu
mogli otkriti. "Pitali smo majku i oca, svakoga smo pitali. Niko ne zna. Ovo pitanje izgleda
tako teko."
Uiteljica se smejala i rekla: "To nije teko. Ja znam odgovor, ali sam pokuala da
32
saznam da li vi to moete otkriti ili ne. Ovo je teina zemlje" Onaj mali deak koji je
postavio pitanje, ustao je i rekao: "Sa ljudima ili bez ljudi?" Dakle ista situacija.
Vi ne moete staviti Budu u takvu situaciju. Nije u pitanju nalaenje odgovora negde;
nije zaista pitanje da odgovorite. Vae pitanje je upravo jedno opravdanje. Kada postavite
pitanje, on jednostavno pokree svoju svetlost prema pitanju i ta god je otkriveno jeste
otkriveno. On vam daje odgovor; to je duboki odgovor njegovog istinskog centra - praman.
Patanjali kae da postoje pet modifikacija uma. Ispravno znanje. Ako centar
ispravnog znanja zapone da funkcionie u vama, vi ete postati mudrac, svetac. Postaete
religiozni. Pre toga ne moete postati religiozni.
Zbog toga su Isus ili Muhamed izgledali ludi - jer oni se nisu raspravljali niti
dokazivali; nisu postavljali svoj sluaj logiki, oni su jednostavno tvrdili. Ako biste pitali
Isusa: "Jesi li ti zaista sin Boiji?" On e rei: "Da." A ako traite od njega, "Dokai to," on e
se smejati. On e rei: "Nema potrebe dokazivati. Ja znam. Takav je sluaj; to je samo
oevidno." Za nas to izgleda nelogino. Taj ovek izgleda da je neurotian, tvrdi neto bez
ikakvog dokaza.
Ako ovaj praman, ovaj centar prame, ovaj centar ispravnog znanja pone da
funkcionie, vi ete biti isti: tvrdiete, ali neete moi da dokaete. Kako moete dokazati?
Ako ste u ljubavi, kako moete dokazati da ste u ljubavi? Ne moete jednostavno dokazati.
Imate bol u svojoj nozi; kako moete dokazati da imate bol? Vi jednostavno tvrdite to: "Ja
imam bol." Vi znate negde unutra. To saznanje je dovoljno.
Ramakrinu su pitali: "Ima li Boga?" On je rekao: "Da." Pitali su ga: "Onda dokai
to." On je odgovorio: "Nije potrebno. Ja znam. Za mene, nije potrebno. Za tebe postoji
potreba, stoga ti trai dokaz. Niko ne moe to dokazati meni, a ja ne mogu to dokazati tebi. Ja
sam morao da traim; morao sam da naem. I ja sam naao. Boga ima!"
Tako funkcionie ispravni centar. Zato Ramakrina ili Isus izgledaju apsurdno. Oni
tvrde odreene stvari bez davanja ikakvih dokaza. Oni ne prigovaraju, ne polau pravo ni na
ta. Odreene stvari su im otkrivene jer imaju delovanje novog centra koji vi nemate. Zato to
ga nemate vi morate imati dokaz.
Zapamtite, dokazivanje dokazuje da vi nemate unutranje oseanje niega - sve mora
da bude dokazano, ak i ljubav mora biti dokazana. A ljudi to stalno rade. Ja znam mnogo
parova. Mu stalno dokazuje da voli, a nije ubedio enu u to; i ena stalno dokazuje da ga ona
voli, a da nije ubedila supruga. Oni ostaju neubeeni a to ostaje kao konflikt. Stalno oseaju
da drugi nije dokazao.
Ljubavnici stalno tragaju. Oni kreiraju situacije u kojima morate dokazati da volite. I
postepeno oboje ponu da se dosauju od ovog besplodnog napora da dokau, a nita se ne
moe dokazati. Kako moete dokazati ljubav? Moete dati poklone, ali nita se time ne
dokazuje. Moete ljubiti, grliti i pevati, moete plesati, ali nita se ne dokazuje. Moda se
samo pretvarate.
Prva modifikacija uma je ispravno znanje. Meditacija vodi do ove modifikacije. A
kada moete ispravno znati i ne postoji potreba za dokazom, tada sam um moe biti obaen,
ne pre toga. Kada nije potrebno dokazivati, um nije potreban, jer um je orue logike.
Potreban vam je svakog momenta. Treba vam da razmislite, otkrijte ta je pogreno a
ta je ispravno. Svakog trenutka postoji izbor i alternativa. Vi imate izbor. Samo kada praman
deluje, kada ispravno znanje deluje, moete odbaciti um, jer sada biranje nema znaaj. Vi se
kreete bez izbora. Sve to je ispravno otkriva vam se.
Definicija mudraca je onaj koji nikada ne bira. On nikada ne bira dobro protiv loeg.
On se jednostavno kree u pravcu onoga to je dobro. On je kao suncokret. Kada je sunce na
istoku, cvet se okree prema istoku. Nikada ne bira. Kada se sunce kree prema zapadu, cvet
se okree na zapad. On se jednostavno kree sa suncem. On ne bira kretanje, on ne odluuje.
Ne donosi odluku: "Sada u se kretati jer se sunce kree prema zapadu."
Mudrac je ba kao suncokret. Gde god je dobro, on se kree jednostavno. Dakle, ta
god da on uini jeste dobro. Upaniade kau: "Ne sudi o mudracu. Vaa obina merila nee
delovati." Vi morate da inite dobro protiv zla, on nema nita da bira. On se jednostavno
33
kree, gde god je dobro. Vi ga ne moete promeniti jer to nije pitanje izbora. Ako kaete: "To
je zlo", on e rei: "U redu, to je moda loe, ali tako se ja kreem, na taj nain se moje bie
kree."
Oni koji znaju - a ljudi u danima Upaniada su znali - oni su odluili tako: "Mi
neemo suditi o mudracima." Jednom kada je osoba postala usreditena u sebi, kada je osoba
postigla meditaciju, jednom kada je osoba postala smirena i um je odbaen, ona je izvan nae
moralnosti, izvan tradicije. Ona je izvan naih ogranienja. Ako moemo slediti, moemo
slediti njega, a ako ne moemo slediti, mi smo bespomoni. Inae nita se ne moe uiniti, i
ne treba da sudimo.
Ako ispravno znanje funkcionie, ako je va um preuzeo modifikaciju ispravnog
znanja, vi ete postati religiozni. Pogledajte, to je potpuno razliito. Patanjali ne kae ako
idete u damiju, u gurudvar, u hram, izvodite neke rituale, molite se Ne, to nije religija.
Morate uiniti da proradi va centar ispravnog znanja. Tada bilo da idete u hram ili ne, to je
beznaajno; to nije vano. Ako va centar ispravnog znanja deluje, ta god da inite je
molitva, i gde god idete - jeste hram.
Kabir je rekao: "Gde god krenem ja nalazim tebe, Boe moj. Gde god se kreem ja se
kreem u tebi, naiem na tebe. ta god da inim, samo hodajui, jedui, to je molitva." Kabir
kae: "Spontanost je moj samadhi. Samo da budem spontan moja je meditacija."
Druga modifikacija uma je pogreno znanje. Ako deluje va centar pogrenog znanja,
onda sve to inite bie pogreno, i ta god odaberete bie pogreno odabrano. ta god
odluite bie pogreno jer vi ne odluujete, to pogrean centar deluje.
Postoje ljudi koji se oseaju vrlo nesreni, jer sve to ine ispadne pogreno. Oni
pokuavaju da opet ne ine pogreno, ali to ne pomae jer centar mora da bude promenjen.
Njihovi umovi funkcioniu na pogrean nain. Oni moda misle da ine dobro, ali uinie zlo.
Sve njihove dobre elje ne mogu pomoi; oni su bespomoni.
Mula Nasrudin je obino poseivao jednog sveca. Poseivao ga je za mnogo, mnogo
dana. Svetac je bio utljiv, nije govorio nita. Onda je Mula Nasrudin morao da kae:
"Dolazio sam mnogo puta, oekujui da ete neto rei, a vi niste rekli nita. Dok ne kaete, ja
ne mogu razumeti, stoga dajte mi poruku za moj ivot, pravac tako da se mogu kretati u tom
smeru."
Na to je taj sufi mudrac rekao: "Neki kar kuyen may dal; ini dobro i baci to u bunar."
To je jedna od najstarijih sufi izreka; "ini dobro i baci to u bunar." To znai ini dobro i
odmah to zaboravi; ne nosi to kao "Ja sam uinio dobro."
Onda je sledeeg dana Mula Nasrudin pomogao jednoj staroj eni da pree ulicu, a
onda je gurnuo u bunar.
"Neki kar kuyen may dal; ini dobro i baci to u bunar."
Ako funkcionie va pogrean centar, sve to uinite Moete itati Kuran, moete
itati Gitu, i nai ete znaenja - Krina e biti okiran, Muhamed e biti okiran da vidi da
moete nai takva znaenja.
Mahatma Gandi je napisao autobiografiju s namerom da ona pomogne ljudima. Onda
je primio mnoga pisma jer je opisao svoj seksualni ivot. Bio je iskren, jedan od najiskrenijih
ljudi, stoga je napisao sve - sve to se dogodilo u njegovoj prolosti - kako se previe
preputao onog dana kada mu je otac umirao; nije mogao da sedi pokraj njega. ak i tog dana
je otiao sa svojom enom u krevet.
Doktor je rekao: "Ovo je zadnja no. Va otac ne moe preiveti jutro. Umree do
jutra." Ba oko dvanaest, jedan, te noi, poeo je da osea elju, seksualnu elju. Otac je
spavao, pa je on otiao kod svoje ene, prepustio se seksu. A ena je bila trudna. U devetom
mesecu. Otac je umirao, a dete je takoe umrlo onog momenta kada se rodilo. Otac je umro te
noi, tako da se celog ivota Gandi duboko kajao to nije mogao biti sa svojim umiruim
ocem. Seks je bio opsesivan.
Dakle, on je napisao sve, bio je iskren i poten da bi pomogao drugima. Ali mnoga
34
pisma su poela da mu dolaze, i bila su takva da su ga okirala. Mnogi ljudi su mu pisali:
"Vaa autobiografija je takva da smo postali seksualniji nego to smo bili pre. Samo itajui
vau autobiografiju mi smo postali seksualniji i podatni. Ona je erotska."
Ako pogrean centar funkcionie, onda nita ne moe da se uradi. ta god da inite,
itate, kako god da se ponaate, bie pogreno. Kretaete se prema pogrenom. Imate centar
koji vas prisiljava da se kreete prema pogrenom. Moete otii kod Bude, ali neto pogreno
ete videti u njemu. Odmah! Vi se ne moete sastati s Budom, neto pogreno ete videti
odmah. Imate usredsreenost na pogreno, imate dubok podsticaj da naete svuda pogreno,
svuda.
Ovu modifikaciju Patanjali zove viparyaya. Viparyaya znai izopaenost. Izokreete
sve. Interpretirate sve na takav nain da to postane izopaenost.
Omar Khayam pie: "uo sam da je Bog milostiv." To je lepo. Muslimani stalno
ponavljaju, "Bog je rehman, samislost; rahim, saoseanje." Oni to stalno ponavljaju,
neprekidno. Stoga Omar Khayam kae: "Ako je on zaista milostiv, ako je zaista saoseajan,
onda nije nuno da se bude uplaen. Ja mogu nastaviti da inim greh. Ako je on milostiv,
onda emu strah? Mogu uiniti sve to elim i on je milostiv - dakle, kad god stanem ispred
njega, rei u, rahim, rehman; Bog je milostiv, greio sam, ali ti si milostiv. Ako si ti zaista
milostiv, onda imaj saoseanja za mene." Tako je on nastavio da pije, nastavio je da ini sve
to je mislio da je greh. On je interpretirao to na vrlo izopaen nain.
Svuda u svetu su ljudi to inili. U Indiji mi kaemo: "Ako ode Ganeu, ako se kupa
u Gangu, tvoji gresi se rastvaraju." To je sam po sebi lep koncept. To pokazuje mnoge stvari.
To pokazuje da greh nije neto mnogo duboko, on je samo kao praina na vama. Stoga ne
budite previe opsednuti s njim; ne oseajte se krivim, on je samo kao praina, a vi ostajete
unutra isti. ak i kupanje u Gangu moe pomoi.
Ovako se kae samo zato da ne postanete mnogo opsednuti sa grehom, kao to su
hriani postali. Krivica je postala samo toliko tegobna, da e ak i kupanje u Gangu pomoi.
Nemojte se toliko bojati. Ali sada smo mi interpretirali to. Mi kaemo: "Onda je u redu
nastaviti da ini greh." Uskoro kada osetite kako ste ih poinili dovoljno, dajete priliku
Gangu da vas proisti; onda se vratite natrag i inite ih opet. Ovo je centar izopaenosti.
Tree je imaginacija. Um ima sposobnost da mata. To je dobro, to je lepo. Sve to je
lepo dolo je kroz matu. Slike, umetnost, ples, muzika, sve to je lepo dolo je kroz
imaginaciju. Ali, i sve to je runo takoe je dolo kroz matu. Hitler, Mao, Musolini, svi su
oni doli kroz matu.
Hitler je matao o svetu natoveka. Verovao je u Fridriha Niea koji je rekao: "Uniti
sve one koji su slabi. Uniti sve one koji nisu super. Ostavi samo natoveka na zemlji."
13
Tako da ih je on unitio. Upravo mata, ba utopijska mata - da unitavanjem slabih,
unitavanjem runih, samo unitavanjem fiziki obogaljenih imaete lep svet. Ali samo
unitavanje je najrunija mogua stvar u svetu - pravo unitenje.
Inae on je delovao kroz matu. On je imao matu, utopijsku imaginaciju - bio je
najmatovitiji ovek! Hitler je jedan od najmatovitijih. Njegova mata je postala tako
fantastina i tako luda, da je za njegov zamiljeni svet pokuao potpuno da uniti ovaj svet.
Njegova mata je poludela.
Imaginacija vam moe dati poeziju, slikanje i umetnost, ali imaginacija vam takoe
moe dati ludilo. Zavisi kako je koristite. Sva velika nauna otkria dola su kroz imaginaciju
ljudi koji su mogli matati, koji su mogli zamisliti nemogue, kako moemo leteti u vazduhu,
kako moemo otii na Mesec.
Ovo su nedokuiva matanja. ovek je matao vekovima, milenijumima, kako da leti,
kako da ode na Mesec. Svako dete je roeno s eljom da ode na Mesec, da dohvati Mesec. Ali
mi smo dosegli. Kroz imaginaciju kreativnost dolazi, ali kroz imaginaciju i unitenje dolazi.
Patanjali kae da je mata trei oblik uma. Moete ga koristiti na pogrean nain, i
onda e vas on unititi. Moete ga koristiti na ispravan nain, i onda su to imaginativne
13
Ovo Nie nije rekao niti je Hitler sledio Niea. Mala Osho-va zabluda.
35
meditacije. One zapoinju sa matom, ali ubrzo imaginacija postaje suptilnija i suptilnija.
Onda se imaginacija na kraju odbacuje, i vi ste licem u lice sa istinom.
Sve hrianske i muslimanske meditacije su zasnovane na imaginaciji. Prvo morate
zamiljati neto. I kada stalno neto zamiljate, onda kroz imaginaciju stvarate atmosferu oko
sebe. Probajte to, ta je sve mogue kroz imaginaciju. Mogue je ak i nemogue.
Ako mislite da ste lepi, ako zamiljate da ste lepi, odreena lepota e poeti da se
deava u vaem telu. Stoga kad god ovek kae eni "Ti si lepa", ena se odmah promeni.
Ona moda nije bila lepa. Upravo pre tog trenutka ona moda nije bila lepa - samo domaica,
jednostavna. Ali ovaj ovek joj je dao matu.
Zato svaka ena koja je voljena postaje lepa, svaki ovek koji je voljen postaje lepi.
Osoba koja nije voljena - moe biti lepa - postaje runa jer ona ne moe zamiljati, ne moe
matati. Ako imaginacija nije prisutna, vi se steete.
Emil Kue, jedan od psihologa sa Zapada, pomogao je milionima ljudi da samo kroz
matu budu izleeni od mnogih, mnogih bolesti. Njegova formula je bila vrlo jednostavna. On
bi rekao: "Samo zaponite da oseate da ste u redu. Upravo nastavite da ponavljate unutar
uma, meni postaje bolje i bolje. Svakog dana sam bolje." Nou dok spavate nastavite da
mislite da ste zdravi, postajete zdraviji svakog momenta, i do jutra ete biti najzdravija osoba
u svetu. Nastavite da zamiljate."
On je pomogao milionima ljudi. ak i neizleive bolesti su bile izleene. To je
izgledalo kao udo; a to nije nita. To je samo osnovni zakon: va um sledi imaginaciju. Sada
psiholozi kau da ako kaete deci "Vi ste glupi, glupaci" ona postaju glupa. Vi ih prisiljavate
da budu glupi. Vi im dajete imaginaciju, sugestiju da oni jesu glupi.
Sprovedeni su mnogi eksperimenti. Kaite detetu: "Ti si glup. Ne moe uraditi nita;
ne moe reiti ovaj matematiki problem." Zadajte mu problem i kaite mu: "Sada probaj",
ono nee moi da ga rei. Vi ste zatvorili vrata. Kaite detetu: "Ti si inteligentan, nisam video
nijednog inteligentnog deaka kao to si ti; za tvoj uzrast, za tvoje godine ti si natproseno
inteligentan. Pokazuje mnogo potencijala; moe reiti svaki problem; sada pokuaj ovo", i
on e biti sposoban da rei to. Vi ste mu dali imaginaciju.
Sada ima naunih dokaza, novih naunih otkria, da ta god imaginacija uhvati, to
postaje seme. Cela generacija se menja, itavo doba, cele zemlje su se menjale, upravo kroz
imaginaciju.
Idite u Pendab. Jednom sam putovao iz Delhija u Manali. Moj voza je bio sikh,
sardar. Put je bio opasan, a kola su bila vrlo velika. Voza se mnogo puta preplaio. Mnogo
puta bi rekao: "Sada ne mogu ii dalje. Moraemo se vratiti natrag." Pokuali smo na svaki
nain da ga nagovorimo. Na jednom mestu se toliko uplaio da je zaustavio kola, izaao iz
kola i rekao: "Ne, odavde se ne mogu pomeriti. Opasno je "To moda nije opasno za vas; vi
ste moda spremni da umrete. Ali ja nisam i elim da se vratim natrag."
Sluajno jedan od mojih prijatelja koji je takoe bio sardar i veliki policijski
slubenik, takoe je putovao, sledei mene, da poseti kamp u Manaliu. Prispela su njegova
kola, pa sam mu rekao: "Uini neto! ovek je izaao iz kola." Taj policijski zvaninik je
doao i rekao: "Ti kao sardar, i sikh - kako moe biti kukavica? Ulazi u kola." ovek je
odmah uao u kola i krenuo. Pitao sam ga: "U emu je stvar?" Rekao je: "Sada je on dotakao
moj ego. Rekao je, ti si sardar?" Sardar znai voa ljudi. "Jedan sikh? A kukavica? On je
dodirnuo moju imaginaciju. Dirnuo je u moj ponos. Sada moemo krenuti. Mrtvi ili ivi, ali
emo stii u Manali."
A ovo se nije desilo jednom oveku. Ako odete u Pendab, videete da se to dogaa
milionima. Pogledajte hinduse iz Pendaba i sikhe iz Pendaba. Njihova krv je ista; oni
pripadaju istoj rasi. Pre pet stotina godina svi su bili hindusi. A onda je nastao razliit tip rase,
vojnika rasa je bila roena. Samo putanjem brade, promenom vaeg lica, vi ne moete
postati hrabri. Ali moete! Imaginacijom.
Guru Nanak je dao tu imaginaciju: "Vi ste drugaiji tip rase. Vi ste nepobedivi."
Jednom kada su poverovali, jednom kada je ta zamisao poela da deluje, u Pendabu, tokom
pet stotina godina, nova rasa, potpuno razliita od Pendabskih hindusa je nastala. Nita nije
drugaije. Ali u Indiji, niko nije hrabriji od njih. Ova dva svetska rata su dokazala da se na
36
celoj zemlji niko ne moe uporediti sa sikhima. Oni se mogu boriti neustraivo.
ta se dogodilo? Sama njihova mata je stvorila atmosferu oko njih. Oni oseaju da
time to su sikhi su razliiti. Mata radi. Moe od vas da naini hrabrog oveka, moe da
naini i kukavicu.
uo sam da je Mula Nasrudin sedeo u krmi pijui. On nije bio hrabar ovek, jedan je
od najveih kukavica. Ali alkohol mu je dao hrabrost. A onda je ovek, div od oveka, uao u
krmu, izgledao je divlje, opasno, kao ubica. U svako drugo vreme, po svojoj prirodi, Mula
Nasrudin bi se uplaio. Ali sada je bio pijan, tako da ga nije uopte nije bilo strah.
Taj ovek divljeg izgleda je priao Muli, i videvi da se on uopte ne plai, nagazio je
njegova stopala. Mula se naljutio, pobesneo, i rekao: "ta to radite? inite li ovo sa nekom
namerom ili je samo neka vrsta ale?" Ali tada, ustavii, Mula se povratio od alkohola.
Otreznio se, vratio se svojoj pameti. Ali ve je rekao: "ta to radite? inite li ovo sa nekom
namerom ili je samo neka vrsta ale?"
Ludi ovek je rekao: "Sa namerom." Mula Nasrudin je rekao: "Onda hvala vam, to je
u redu, jer ja ne volim ovakvu vrstu ala."
Patanjali kae: imaginacija je trea sposobnost. Vi stalno zamiljate. Ako pogreno
zamiljate, moete kreirati obmanu oko sebe, iluzije, snove - moete biti izgubljeni u njma.
LSD i druge droge pomau rad na ovom centru. Dakle, koju god unutra mogunost imate, va
LSD trip e vam pomoi da razvijete to. Dakle, nita nije sigurno. Ako imate srene
imaginacije, trip sa drogom e biti sreno poigravanje, uzvieno. Ako imate jadne
imaginacije, none more, trip e biti lo.
Zbog toga mnogi ljudi izvetavaju kontradiktorno. Haksli kae da to moe postati
klju za vrata raja, a Rajner kae da je to najvei pakao. To zavisi od vas; LSD ne moe
uraditi nita. On jednostavno skoi na va centar imaginacije i tamo poinje da deluje
hemijski. Ako imate imaginaciju tipa komara, onda ete razviti to i proi ete kroz pakao. A
ako ste skloni lepim snovima, moete dostii raj.
Mata moe da funkcionie bilo kao pakao ili kao raj. Vi moete koristiti to da
potpuno poludite. ta se dogodilo ludacima u ludnicama? Oni su koristili svoju matu, a
koristili su je na takav nain da su obuzeti njome. Ludak moe da sedi sam i da govori
nekome na glas. Ne samo da govori, on odgovara takoe. On pita, on odgovara, on govori i za
drugog koji je odsutan. Moete misliti da je on lud, ali on govori stvarnoj osobi. U njegovoj
mati osoba je stvarna, a on ne moe prosuditi ta je mata a ta je istinito.
Deca to ne mogu prosuditi. Toliko puta deca mogu izgubiti svoju igraku u snu, a
onda e ujutru plakati, "Gde je moja igraka?" Ona ne mogu suditi da san je san, a realnost je
realnost. Da nisu izgubila nita, samo su sanjala. Granice su zamagljene. Ona ne znaju gde se
san zavrava, a gde realnost poinje.
Lud ovek je takoe smuen. On ne zna ta je realno, ta je nerealno. Ako se mata
koristi ispravno, onda ete znati da je to mata i ostaete svesni da je to mata. Moete uivati
u tome, ali to nije realno.
Dakle, kada ljudi meditiraju mnogo stvari se deava kroz njihovu imaginaciju.
Zapoinju da vide svetla, boje, vizije, razgovaraju sa samim Bogom, ili se sreu sa Isusom, ili
pleu sa Krinom. Ovo su matovite stvari, a meditant treba da zapamti da su to funkcije
mate. Moete uivati u tome; nita nije pogreno u njima - one su zabava. Nemojte misliti da
su one stvarne.
Zapamtite, samo je svedoea svest stvarna; nita drugo nije stvarno. ta god da se
dogodi moe biti lepo, vredno uivanja - uivajte u tome. Lepo je plesati sa Krinom, nita
nije pogreno u tome. Plei! Ali neprekidno se seajte da je to mata, divan san. Ne budite
izgubljeni u tome. Ako ste izgubljeni, onda je mata postala opasna. Mnogi religiozni ljudi su
to samo u mati. Oni se kreu u mati i troe svoje ivote.
etvrto je spavanje u dubokom snu. Spavanje znai nesvesnost u odnosu na spoljanje
kretanje svesti. Ona je otila duboko u sebe. Aktivnost se zaustavila; svesna aktivnost se
37
zaustavila. Um ne funkcionie. Dubok san bez snova je nefunkcionisanje uma. Ako sanjate,
onda to nije dubok san. Dok sanjate vi ste upravo u sredini, izmeu budnosti na javi i
dubokog sna bez snova. Ostavili ste budnost, a jo niste uli u dubok san. Vi ste upravo u
sredini.
Dubok san oznaava potpuno besadrajno stanje, nema aktivnosti, nema kretanja u
umu. Um je potpuno apsorbovan, oputen. Dubok san je lep; on daje ivot. Moete ga
koristiti. I ako znate da ga koristite, moe postati samadhi. Jer samadhi i dubok san nisu
mnogo razliiti. Samo jedna razlika postoji, a to je da ete u samadhiju biti budni. Sve drugo
e biti isto.
U dubokom snu sve je isto, samo onda vi niste budni. Vi ste u istom blaenstvu u koje
je Buda uao, u kome je Ramakrina iveo, u kome je Isus nainio svoj dom. U dubokom snu
vi ste u istom blaenom stanju, ali niste budni. Ujutru ete oseati da je no bila dobra, ujutru
ete se oseati osveeni, vitalni, podmlaeni, ujutru ete oseati da je no bila lepa - ali to je
samo jedan odsjaj. Vi ne znate ta se dogodilo, ta se stvarno dogodilo. Niste bili budni.
Dubok san moe biti korien na dva naina. Samo kao prirodan odmor - vi ste ak i
to izgubili. Ljudi stvarno ne odlaze na spavanje. Oni neprekidno nastavljaju da sanjaju.
Ponekad, za nekoliko sekundi, oni dodirnu dubok san, i opet ponu da sanjaju. Tiina
dubokog sna, blaena muzika spavanja, postala je nepoznata. Vi ste je unitili. ak i prirodno
spavanje je uniteno. Vi ste tako uznemireni i uzbueni da um ne moe pasti potpuno u
zaborav.
Inae Patanjali kae da je prirodno spavanje dobro za telesno zdravlje, a ako moete
postati budni u dubokom snu to moe postati samadhi, to moe postati duhovna pojava. Stoga
postoje tehnike - docnije emo raspravljati o njima - kako spavanje moe postati budno. Gita
kae da jogin ne spava ak ni u dubokom snu. On ostaje budan. Neto unutra nastavlja da biva
svesno. Celo telo je zaspalo, um zapada u spavanje, ali svedoenje ostaje. Neko posmatra -
uvar na kuli ostaje. Onda spavanje postaje samadhi. To postaje krajnja ekstaza.
I poslednje je pamenje. Pamenje je peta modifikacija uma. To takoe moe biti
korieno i zloupotrebljeno. Ako je pamenje zloupotrebljeno, ono kreira zabunu. Zaista,
moete se seati neega, ali ne moete biti sigurni da li se to dogodilo na taj nain ili nije.
Vae pamenje nije pouzdano. Moete dodati mnoge stvari u njega; mata moe ui u njega.
Moete izbrisati mnoge stvari iz njega, moete uraditi mnoge stvari za njega. A kada kaete:
"Ovo je moje pamenje", to je vrlo profinjena i izmenjena stvar. To nije realno.
Svako kae: "Moje detinjstvo je bilo kao u raju", a pogledajte decu. Ova deca e
takoe rei kasnije da je njihovo detinjstvo bilo raj, a ona pate. I svako dete arko eli da
poraste uskoro, da postane odraslo. Svako dete misli da odrasli uivaju, sve to je vredno
uivanja oni uivaju. Oni su snani; oni mogu initi sve, a ono je bespomono. Deca misle da
pate, ali ona e odrasti kao to ste vi porasli, a onda e docnije rei da je detinjstvo bilo
najlepe, kao raj.
Vae pamenje nije pouzdano. Vi zamiljate, upravo kreirate svoju prolost. I niste
istiniti prema njoj. Odbacujete mnoge stvari iz nje - sve to je runo, sve to je tuno, sve to
je bilo bolno vi odbacujete; sve to je bilo lepo vi zadravate. Sve to je bilo podrka vaem
egu vi pamtite, a sve to nije bilo podrka vi odbacujete, zaboravljate to.
Tako svako ima veliko skladite odbaenih seanja. I ta god da kaete o njima nije
istina, vi se ne moete istinski seati. Svi vai centri su pobrkani, oni ulaze jedan u drugi i
ometaju se meusobno.
Ispravno pamenje. Buda je koristio rei ispravno pamenje za meditaciju. Patanjali
kae da ako je pamenje ispravno, to znai da je ovek totalno iskren prema sebi. Onda, samo
onda, moe pamenje biti ispravno. ta god da se dogodilo, loe ili dobro, ne menjajte to.
Znajte to kakvo jeste. To je vrlo teko! To je naporno! Vi birate i menjate. Znanje svoje
prolosti kakva jeste promenie ceo va ivot. Ako ispravno znate svoju prolost kakva jeste,
neete eleti da je ponavljate u budunosti. Upravo sada svako razmilja kako da ponovi to u
modifikovanom obliku, ali ako znate svoju prolost tano kakva jeste bila, neete eleti da je
ponovite.
38
Ispravno pamenje e vam dati podsticaj kako da budete slobodni od svih ivota. Ako
je pamenje ispravno, onda moete ii ak i u prole ivote. Ako ste iskreni, onda moete ii u
prole ivote. Onda imate samo jednu elju: kako da transcendirate sve te besmislice. Inae vi
mislite da je prolost lepa, i mislite da e budunost biti lepa, samo ova sadanjost je
pogrena. Ali ta prolost je bila prisutna pre nekoliko dana, a budunost e postati prisutna
nekoliko dana posle. I u svako vreme svaka sadanjost je pogrena, a sva prolost je lepa i sva
budunost je lepa. Ovo je pogreno pamenje. Gledajte direktno. Ne menjate. Gledajte u
prolost kakva je bila. Ali mi smo nepoteni.
Svaki ovek mrzi svog oca, ali ako nekoga pitate rei e: "Ja volim mog oca. Potujem
svog oca." Svaka ena mrzi svoju majku, ali pitajte i svaka ena e rei: "Moja majka, ona je
boanstvena." Ovo je pogreno pamenje.
Gibran ima priu. On kae, jedne noi jedna majka i erka su bile probuene usled
strane buke. Obe su bile meseari, a u vreme kada se dogodila iznenadna buka u susedstvu
one su obe hodale u bati, u snu. Bile su meseari.
Mora da je to bio ok, jer u snu je stara dama, majka, rekla erki: "Zbog tebe, kurvo,
zbog tebe, moja mladost je izgubljena. Ti si me unitila. I svako ko doe u kuu gleda tebe.
Niko ne gleda u mene." Velika je ljubomora koja dolazi svakoj majci kada erka postane
mlada i lepa. To se dogaa svakoj majci, ali to je unutra.
A erka je rekla: "Ti matora gaduro Zbog tebe ne mogu da uivam u ivotu. Ti si
prepreka. Svuda si ti prepreka, smetnja. Ne mogu da volim; ne mogu da uivam."
Iznenada usled buke, obe su se probudile. I stara ena je rekla: "Dete moje, ta radi
ovde? Moe da nazebe. Doi unutra." A erka je rekla: "A ta ti radi ovde? Nisi se oseala
dobro, a no je hladna. Doi, majko. Doi u krevet."
Prva stvar koja se dogodila dolazila je od nesvesnog. Sada se obe pretvaraju; probudile
su se. Nesvesno je otilo natrag, svesno je nastupilo. Sada su one licemeri. Vaa svesnost je
licemerna.
Da bi bio istinski iskren sa svojim vlastitim pamenjima ovek e morati zaista da
proe kroz veliki napor. A vi morate biti istiniti, o svemu. Morate biti ogoljeno istiniti, morate
znati ta zaista mislite o svom ocu, o svojoj majci, o svom bratu, o svojoj sestri - zaista. A ono
to imate u prolosti, ne meajte, ne menjajte, ne ulepavajte; pustite to da bude kakvo jeste.
Ako se to dogodi, onda, Patanjali kae, to e biti sloboda. Vi ete odbaciti to. Cela stvar je
besmislena, i vi neete eleti da projektujete to opet u budunosti.
14
Onda neete biti licemer. Biete realni, istiniti, iskreni - postaete autentini. A kada
postanete autentini, vi ete postati kao stena. Nita ne moe da vas promeni; nita ne moe
da vam stvori zabunu.
Postaete kao ma. Uvek ete sei sve to je pogreno; moete odeliti sve to je
ispravno od pogrenog. Onda se postie jasnoa uma. Ta jasnoa moe vas voditi prema
meditaciji; ta jasnoa moe da postane osnovni temelj za rast - za rast s one strane.
14
Sav teret prolosti i sva oekivanja u budunosti mi nosimo samo u iskrivljenom obliku. Sama prolost kakva
jeste nikada se ne bi lepila za nas i optereivala nas. Mi je sami drimo i to uvek u iskrivljenom obliku.
39
Poglavlje 4
S ONE STRANE UMA, PREMA SVESTI
28. decembar 1873.
Prvo pitanje:
Vi ste rekli da za ljude postoje samo dve alternative, ili ludilo ili meditacija, meutim
milioni ljudi na zemlji nisu dostigli ni jedno od ta dva. Da li mislite da hoe?
Oni su dostigli! Nisu dosegli do meditacije, ali su stigli do ludosti! Razlika izmeu
ludaka koji su u ludnici i ludaka koji su izvan je samo u stepenima. Nema kvalitativne razlike,
razlika je samo u kvantitetu. Vi moete biti manje ludi, oni mogu biti vie ludi, ali ovek
kakav jeste, je lud.
Zato ja nazivam oveka, kakav jeste, ludim? Ludost znai mnogo stvari. Jedna, vi
niste usrediteni. Ako niste usrediteni vi ste umobolni. Neusrediteni, mnogi su glasovi u
vama - vi ste mnogi, vi ste mnotvo. Niko nije gospodar u kui, a svaki sluga iz kue tvrdi da
je gospodar. Postoji konfuzija, konflikt, i neprekidna borba. Vi ste u neprekidnom
graanskom ratu. Ako se graanski rat ne odvija, onda ete biti u meditaciji. To se nastavlja
danju i nou, dvadeset etiri sata. Zabeleite sve to prolazi u vaem umu za nekoliko minuta,
i budite iskreni. Zapiite tano sve to se odvija, i sami ete osetiti da je to ludilo.
Ja imam posebnu tehniku koju koristim s mnogo osoba. Traim od njih da sede u
zatvorenoj sobi i da zaponu govoriti glasno, sve to im doe u um. Izgovarajte glasno svoje
misli tako da ih moete uti. Samo petnaest minuta govora, i vi ete osetiti da sluate ludog
oveka. Apsurdni, bezvezni, nepovezani fragmenti plove u umu. I to je va um! Dakle, vi
moete biti devedeset devet posto ludi, a neko je preao granicu, on je otiao izvan sto posto.
One koji su otili izvan sto posto mi stavljamo u ludnicu. Ne moemo staviti sve vas u ludnicu
jer nema tako mnogo ludnica. I ne moe ih biti - onda bi cela zemlja postala ludnica.
Halil Dubran je napisao malu anegdotu. On kae da je jedan od njegovih prijatelja
postao lud, pa je stavljen u ludnicu. Onda je samo iz ljubavi, saoseanja, on otiao da ga vidi,
da ga poseti. Sedeo je ispod drveta u bati ludnice, okruene velikim zidom. Halil Dubran je
otiao tamo, seo pored prijatelja na klupi i pitao ga: "Da li ikada razmilja zato si ovde?"
Ludi ovek se nasmejao i rekao: "Ja sam ovde jer sam eleo da napustim onu veliku ludnicu
spolja. Ovde sam miran. U ovoj ludnici - koju ti naziva ludnicom - niko nije lud."
Ludi ljudi ne mogu misliti da su oni ludi; to je jedna od osnovnih karakteristika
ludosti. Ako ste ludi, vi ne moete misliti da ste ludi. Ako moete misliti da ste ludi, postoji
mogunost. Ako moete misliti i shvatiti da ste ludi, vi ste jo uvek malo razboriti. Ludost se
nije pojavila u svojoj totalnosti. Dakle, ovo je paradoks: oni koji su stvarno normalni, oni
znaju da su ludi, a oni koji su potpuno ludi, oni ne mogu misliti da su ludi.
Vi nikada ne mislite da ste ludi. To je deo ludosti. Niste usrediteni, ne moete biti
razboriti. Vaa razboritost je samo povrna, prilagoena. Samo na povrini izgleda da ste
razboriti. Zbog toga, neprekidno, morate da obmanjujete svet oko sebe. Morate mnogo da
skrivate, morate da spreavate mnogo. Ne dozvoljavate sve da izae van. Vi potiskujete.
Moda mislite jedno, ali ete govoriti neto drugo. Vi se pretvarate, i zbog tog pretvaranja
moete imati minimum povrne razboritosti oko sebe; a unutra vi kljuate.
Ponekad se dogodi erupcija. U ljutnji vi eksplodirate i ludilo koje ste skrivali izlazi
napolje. Ono slomi sva vaa usaglaavanja. Tako psiholozi kau da je ljutnja privremena
ludost. Vi ete opet zadobiti ravnoteu; opet ete skrivati svoju realnost; opet ete doterivati
svoju povrinu; vi ete opet postati razboriti. I rei ete: "To je bilo pogreno. Uinio sam to u
ljutnji. Nikada to nisam mislio, zato oprostite mi." Ali ste mislili to! To je bilo najrealnije.
Pitanje za oprotaj je samo pretvaranje. Opet vi odravate svoju povrinu, svoju masku.
Razborit ovek nema masku. Njegovo lice je izvorno; ta god da on jeste, on jeste.
Ludak mora svesno da promeni svoje lice. Svakog momenta on mora da koristi razliitu
40
masku za razliitu situaciju, za razliite odnose. Samo posmatrajte sebe kako menjate svoja
lica. Kada doete kod svoje ene imate jedno lice; kada odete svojoj voljenoj, svojoj
ljubavnici, imate sasvim razliito lice.
Kada govorite svome slugi imate jednu masku, a kada govorite svom gazdi, sasvim
drugaije lice. Moe biti da va sluga stoji desno od vas, a ef levo, onda imate dva lica
istovremeno. Na levo imate jedno lice, na desno imate drugo lice, jer slugi ne moete pokazati
isto lice. Ne trebate. Vi ste ef tamo, tako da e ta strana lica biti ef. To lice ne moete
pokazati svom efu, jer ste tamo vi sluga; vaa druga strana e pokazati ponizno dranje.
Ovo se neprekidno odvija. Vi ne posmatrate, zbog toga niste svesni. Ako posmatrate
postaete svesni da ste ludi. Vi nemate nikakvo lice. Izvorno lice je izgubljeno. Meditacija
oznaava ponovno zadobijanje izvornog lica.
Zato zen majstor kae: "Idite i naite svoje izvorno lice - lice koje ste imali pre nego
to ste bili roeni, to lice ete imati kada budete umrli." Izmeu roenja i smrti vi imate lana
lica. Vi neprekidno nastavljate da obmanjujete - ne samo druge: kada stojite ispred ogledala vi
varate sebe. Nikada u ogledalu ne vidite svoje pravo lice. Nemate dovoljno hrabrosti da se
suoite sa sobom. To lice u ogledalu je takoe lano. Vi ga stvarate, uivate u njemu, ono je
naslikana maska.
Mi ne varamo samo druge; obmanjujemo sebe takoe. Zaista mi ne moemo obmanuti
druge, ako ve nismo obmanuli sebe. Tako moramo verovati u svoje vlastite lai, samo tada
moemo uiniti da drugi veruju. Ako ne verujete u svoje lai, niko drugi nee biti obmanut.
I ova munina koju nazivate svojim ivotom ne vodi nigde. To je luda spletka. Radite
previe. Preoptereujete se i trite. I celog ivota se borite, a ne stiete nigde. Ne znate odakle
dolazite, ne znate gde lutate, ne znate kuda idete. Ako sretnete oveka na putu i pitate ga:
"Odakle dolazite gospodine?" a on kae: "Ne znam", a vi ga pitate: "Kuda idete" a on kae:
"Ne znam", i jo kae: "Ne odvraajte me, u urbi sam", zaista ta ete misliti o njemu?
Misliete da je lud.
Ako ne znate odakle dolazite i kuda idete, onda emu urba? Ali to je situacija sa
svakim, svako je na putu. ivot je put, vi ste uvek u sredini. I vi ne znate odakle ste doli, ne
znate kuda idete. Nemate znanje o izvoru, nemate znanje o cilju, ali u velikoj ste urbi,
ulaete veliki napor da ne stignete nigde.
Kakva je ovo vrsta razumnosti? A iz itave ove borbe, ne dolaze vam ak ni bljeskovi
sree - ak ni nagovetaji. Vi se jednostavno nadate da jednog dana, sutra, prekosutra, ili posle
smrti, u nekom buduem ivotu - srea vas oekuje. Ovo je samo trik, samo odgaanje, samo
da se ne oseate previe jadno upravo sada.
Nemate nikakav bljesak blaenstva. Kakva je ovo vrsta razumnosti? Neprekidna
patnja - i, povrh toga, ta patnja nije stvorena ni od koga drugog. Vi stvarate svoju patnju. Koja
je ovo vrsta razumnosti? Vi stvarate svoju patnju neprekidno! Ja to zovem ludou.
Razumnost e biti ovo: postaete svesni da niste usrediteni. Dakle, prva stvar koju
treba uraditi je da se bude centriran, da doete do sredita, da imate sredite unutar sebe
odakle moete voditi svoj ivot, moete disciplinovati svoj ivot, da imate vlast unutar sebe
odakle moete usmeravati, moete se kretati. To je prva stvar koja treba da bude
iskristalisana, a onda druga stvar je da se ne stvara patnja za samog sebe. Odbacite sve to
stvara patnju - sve motive, elje, nade koje stvaraju patnju.
Ali vi niste svesni. Vi jednostavno nastavljate da je stvarate; ne vidite da to sebi
stvarate. ta god da radite, vi sejete neko seme. Onda plodovi e uslediti, a ta god da ste
posejali, vi ete ponjeti to. A kad god anjete neto, postoji patnja, ali nikada ne vidite da ste
vi posejali seme. Kad god vam se dogodi patnja, mislite da ona dolazi od neega drugog,
mislite da je to neki nesretan sluaj ili neke zle sile deluju protiv vas.
Tako ste izmislili avola. avo je samo rtveni jarac - vi ste avo. Vi stvarate svoju
patnju. Jer kad god patite, vi jednostavno bacate to na avola, avo je neto uradio. Onda ste
spokojni. Onda nikada ne postajete svesni svog vlastitog porenog naina ivota, glupog
naina ivota.
Ili vi to nazivate sudbinom, ili kaete: "Bog me iskuava." Ali nastavljate da
izbegavate osnovnu injenicu da ste vi iskljuivi uzrok svega ta god da vam se deava. I nita
41
nije sluajno. Sve ima uzronu vezu, a vi ste uzrok.
Na primer, vi se zaljubite. Ljubav vam da oseanje, oseanje da blaenstvo je negde u
blizini. Oseate po prvi put da ste nekome dobrodoli, barem vam jedna osoba eli
dobrodolicu. Vi zapoinjete da cvetate. Jedna osoba vam eli dobrodolicu, eka vas, voli
vas, brine za vas i vi zapoinjete da cvetate. Samo u poetku, a onda odmah va pogrean
obrazac uma poinje da deluje - vi odmah elite da posedujete to drago, voljeno bie. A
posedovanje ubija. Onog momenta kada posedujete ljubavnika, vi ste ga ubili. Zato i patite.
Onda plaete i zapomaete, a zatim mislite da ljubavnik je pogrean, da je sudbina loa,
"Sudbina mi nije naklonjena." Ali vi ne znate da ste otrovali ljubav kroz posedovanje, kroz
posesivnost.
Ali svaki ljubavnik ini to i svaki ljubavnik pati. Ljubav koja vam moe dati najdublje
blagoslove postaje najdublja patnja. Tako su stare kulture, naroito u Indiji u drevnim danima,
potpuno unitile pojavu ljubavi. Oni su ugovarali brakove za decu - nema mogunosti
zaljubljivanja, jer ljubav dovodi do patnje. Ovo je bio tako poznat fenomen - da ako dopustite
ljubav, onda ljubav vodi do patnje - tako je bolje nemati tu mogunost. Neka deca, mala deca,
budu venana. Pre nego to mogu da se zaljube, neka se venaju. Oni nikada nee znati ta je
ljubav, i tako nee biti u patnji.
Ali ljubav nikada ne stvara patnju. Vi je otrujete. Ljubav je uvek radost, ljubav je uvek
proslava. Ljubav je najdublja ekstaza koju vam priroda doputa. Ali vi je unitavate. Tako da
se ne bi palo u nevolju, u Indiji i drugim starim, drevnim zemljama, mogunost ljubavi je
potpuno zatvorena. Tako neete zapasti u patnju, ali onda ete takoe propustiti jedinu
ekstazu koju priroda dozvoljava. Tako ete imati osrednji ivot. Nema patnje, nema sree,
samo nekakvo guranje napred. Takav je brak bio u prolosti.
Sada Amerika pokuava, Zapad pokuava da oivi ljubav. Ali mnogo patnje dolazi
kroz to, i pre ili kasnije zapadne zemlje e se ponovo odluiti za deje brakove. Nekoliko
psihologa su ve predloili da deji brakovi treba da se vrate natrag jer ljubav stvara tako
mnogo bede. Ali ja opet kaem, ljubav nije uzrok tome. Ljubav ne moe da stvara patnju. To
ste vi, va obrazac ludila je ono to stvara patnju. Ne samo u ljubavi, svuda. Svuda ste
prisiljeni da u to unesete svoj um.
Mnogi ljudi dolaze kod mene. Na primer, oni zaponu da meditiraju. U poetku
postoje iznenadni bljeskovi, ali samo u poetku. Jednom kada su upoznali odreena iskustva,
kada su upoznali odreene bljeskove, sve staje. I oni dolaze plaui i jadikujui mi, pitajui:
"ta se dogodilo? Neto se deavalo, a sada je sve prestalo. Mi pokuavamo najbolje to
moemo, ali nita, nita iz toga ne dolazi."
Ja im odgovaram: "U poetku se to dogodilo jer to niste oekivali. Sada oekujete,
tako da se itava situacija promenila. Kada ste po prvi put imali to besteinsko oseanje
lakoe, oseanje da ste ispunjeni neim nepoznatim, oseanje da ste bili preneti iz svog
mrtvog ivota, oseanje ekstatinih trenutaka, vi to niste oekivali, nikada niste znali takve
trenutke. Po prvi put oni su pali na vas. Nesvesni ste bili, ne oekujui nita. Takva je bila
situacija.
Sada ste promenili situaciju. Sada svakog dana sedite da meditirate oekujui. Sada ste
lukavi, pametni, proraunati. Kada ste po prvi put imali kratak uvid, bili ste nevini, ba kao
dete. Vi ste se igrali s meditacijom, ali nije bilo oekivanja. Onda se to dogodilo. Dogodie se
to opet, ali onda ete morati opet da budete nevini.
Sada vam va um donosi nevolju, i ako nastavite da insistirate 'Moram imati iskustvo
ponovo i ponovo' izgubiete ga zauvek. Dok ga sasvim ne zaboravite, moe potrajati
godinama. Dok ne postanete potpuno ravnoduni da je takav dogaaj nekada u prolosti
postojao, onda e vam mogunost ponovo biti otvorena."
Ovo ja nazivam ludou. Vi unitavate sve. ta god doe u vae ruke, vi to odmah
unitavate. I zapamtite, ivot vam daje mnoge darove, netraene. Vi niste nikada zatraili od
ivota, a ivot vam je dao mnoge darove. Ali vi unitavate svaki dar, a svaki dar moe postati
vei i vei. To moe rasti jer ivot vam nikada ne daje nita mrtvo. Ako vam je ljubav data,
ona moe da raste. Ona moe da raste do nepoznatih dimenzija, ali na samom poetku vi je
unitavate.
42
Ako vam se meditacija dogodi, samo oseajte zahvalnost boanskom i zaboravite to.
Samo oseajte zahvalnost, i zapamtite dobro da vi nemate nikakvu sposobnost da je imate,
niste ni na koji nain autorizovani da je imate; ona je bila dar. Ona je bila jedno bujanje
boanskog. Zaboravite je. Ne oekujte je; ne zahtevajte je. Doi e sledeeg dana opet -
dublja, via, monija. Ona nastavlja da se iri, ali svakog dana ispustite je iz uma.
Nema kraja njenim mogunostima. Ona e postati beskonana; itav kosmos e postati
ekstatian za vas. Ali va um mora da bude isputen. Va um je ludost. Dakle, kada kaem da
postoje samo dve alternative, ludost i meditacija, ja mislim um i meditacija. Ako ostanete
ogranieni u umu, vi ete ostati ludi. Dok ne transcendirate um, ne moete transcendirati
ludost.
Najvie to moete biti je funkcionalni lan drutva, to je sve. I moete biti
funkcionalni lan drutva, jer celo drutvo je isto kao i vi. Svako je lud, tako da je ludost
pravilo.
Postanite svesni, i ne mislite da su drugi ludi. Oseajte duboko da ste vi ludi i neto
treba da se uradi. Odmah! To je hitno! Ne odlaite to jer e doi momenat kada neete moi
uiniti nita. Moete postati tako mnogo ludi da ne moete nita initi.
Upravo sada moete uiniti neto. Jo ste unutar granica. Neto moe da se uradi; neki
napor moe da se uini; obrazac moe da se promeni. Inae moe doi momenat kada ne
moete uiniti nita, kada postanete potpuno poremeeni i izgubite ak i svesnost.
Ako moete oseati da ste ludi, to je pravi znak koji daje nadu. To pokazuje da moete
biti svesni svoje vlastitoj realnosti. Vrata postoje; vi moete postati zaista normalni. Barem
toliko razboritosti postoji - da moete razumeti.
Drugo pitanje:
Kapacitet ispravnog znanja je jedna od pet sposobnosti uma, ali to nije stanje uma.
Kako je onda mogue da ta god ovek vidi kroz ovaj centar jeste istinito? Da li ovaj centar
ispravnog znanja deluje posle prosvetljenja, ili moe ak meditant, sadhaka biti u tom centru?
Da, sredite ispravnog znanja, praman, jo je unutar uma. Neznanje je od uma;
znanje je takoe od uma. Kada odete s one strane uma, nema ni jednog ni drugog; niti ima
neznanja, niti znanja. Znanje je takoe bolest. To je dobra bolest, zlatna bolest, ali je bolest!
Tako, zapravo, za Budu se ne moe rei da on zna, ne moe se rei ni da on ne zna. On je
otiao izvan. Nita se ne moe dokazati o tome, bilo da on zna ili da li je neznalica.
Kada nema uma, kako moete znati ili ne znati? Znanje je kroz um, neznanje je takoe
kroz um. Kroz um moete znati pogreno, kroz um moete znati ispravno. Kada nema uma,
znanje i neznanje oboje prestaju. Ovo e biti teko razumeti, ali je lako ako sledite: um zna,
stoga moe biti neznalica; kada nema uma, kako moete biti neznalica i kako moete biti
upueni da znate. Vi jeste, ali znanje i neznanje oboje su prestali.
Um ima dva centra; jedan, ispravnog znanja. Ako taj centar funkcionie on zapoinje
da deluje kroz usredsreenost, meditaciju, kontemplaciju, molitvu - onda bilo ta to znate
jeste istina. Postoji pogrean centar; on funkcionie ako ste pospani, ivite u stanju slinom
hipnozi, opijeni s neim, sa seksom, muzikom, drogama ili bilo ime.
Moete se odati looj navici s hranom; onda to postaje jedan opijat. Moete jesti
previe. Vi ste ludi, opsednuti hranom. Onda hrana postaje alkohol. Sve to zaposedne va
um, sve bez ega ne moete da ivite, to postaje opijanje. Dakle, ako ivite kroz opijate onda
va centar pogrenog znanja funkcionie, i ta god da znate jeste lano, neistinito. ivite u
svetu lai.
Ali oba ova centra pripadaju umu. Kada um otpadne i meditacija doe u svojoj
potpunosti Na sanskritu mi imamo dva izraza: jedan izraz je dhyana; dhyana znai
meditacija; drugi izraz je samadhi. Samadhi znai savrena meditacija gde ak i meditacija
postaje nepotrebna, gde ak i da se vri meditacija postaje besmisleno. Ne moete to da radite,
vi ste postali to - onda je to samadhi.
U ovom stanju samadhija ne postoji um. Nema ni znanja niti neznanja, postoji samo
43
isto postojanje.
15
Ovo isto bivanje je potpuno razliita dimenzija. To nije dimenzija
saznavanja, to je dimenzija bivanja.
ak i ako takav ovek, Buda ili Isus, eli da komunicira s vama, on e morati da
koristi um. Za komunkaciju e morati da koristi um. Ako vi postavite odreena pitanja, on e
morati da koristi svoj centar uma za ispravno znanje. Um je orue za komunikaciju, za
razmiljanje, za saznavanje.
Ali ako vi ne pitate nita, a Buda sedi ispod svog bo drveta, on nije ni neznalica ni
znalac. On je tu. Zaista, ne postoji razlika izmeu drveta i Bude. Ne postoji razlika. Postoji
razlika, ali na nain da nema odvajanja. On je postao kao drvo; on samo postoji. Nema
kretanja, ak ni znanja. Sunce e se podii, ali on nee znati da se sunce podiglo. Ne znai da
e on ostati neznalica - ne, jednostavno to nije sada njegovo kretanje. On je postao smiren,
tako tih, da se nita ne pokree. On je ba kao drvo. Drvo je potpuna neznalica. Ili moete rei
da je drvo samo ispod uma. Um jo nije poeo da funkcionie. Drvo e postati ovek u nekom
ivotu, drvo e postati ludo kao vi u nekom ivotu, i drvo e pokuati da meditira u nekom
ivotu, i drvo e jednog dana postati Buda. Drvo je ispod uma, a Buda sedei pod drvetom je
iznad uma. Oni su oboje bez uma. Jedan e tek postii um, a drugi je postigao i preao iznad
njega.
Dakle, kada se um transcendira, kada se postigne nemanje uma, vi ste isto bivanje,
sat-it-ananda. Nema dogaanja u vama. Niti delovanje postoji niti saznavanje postoji. Ali to
je teko za nas. Spisi stalno kazuju da je svaka dualnost transcendirana.
Znanje je takoe deo dualnosti neznanje - znanje. Ali takozvani mudraci nastavljaju da
govore da je Buda postao "znalac". Onda mi prianjamo uz dualnost. Zbog toga Buda nikada
ne odgovara. Mnogo puta, milionima puta pitali su ga: "ta se deava kada osoba postane
Buda?" On je ostao nem. Samo je rekao: "Postani i znaj." Nita se ne moe rei o tome ta se
deava, jer ta god moe biti reeno bie reeno vaim jezikom, a va jezik je u osnovi
dualistiki. Dakle ta god da se kae bie neistinito.
Ako se kae da on zna, to e biti neistinito, ako bi se reklo da je on postao besmrtan, to
e biti neistinito, ako bi se reklo da je on postigao blaenstvo, to bi bilo neistinito - jer sva
dualnost iezava. Patnja iezava, srea iezava. Neznanje iezava, znanje iezava. Tama
iezava, svetlost iezava. Smrt iezava, ivot iezava. Nita se ne moe rei. Ili, samo
ovoliko se moe rei - da ta god moete zamisliti nee biti to, bilo ta moete shvatiti nee
biti to. I jedini nain je da se postane to. Samo onda znate.
Tree pitanje:
Rekli ste da ako vidimo vizije Boga ili da pleemo sa Krinom, da zapamtimo da je to
samo mata. Meutim, druge veeri ste rekli da ako smo prijemivi moemo komunicirati sa
Hristom, Budom, ili Krinom odmah sada. Da li je ta komunikacija takoe imaginacija koja
se dogaa, ili postoje meditativna stanja u kojima su Hrist ili Buda zaista tu? Malo je teko
da se razume.
Prva stvar: od sto sluajeva, devedeset devet sluajeva e biti od mate. Vi zamiljate
- zbog toga se hrianinu Krina nikada ne pojavljuje u viziji, hindusu se Muhamed nikada ne
javlja u njegovim vizijama. Ostavite Muhameda i Isusa; oni su daleko. Inae ainu se nikada
Rama ne javlja u viziji, ne moe se pojaviti. Hindusima se Mahavira nikada ne pojavljuje.
Zato? Nemate nikakvu imaginaciju za Mahaviru.
Ako ste roeni kao hindu, vi ste hranjeni konceptom Rame i Krine. Ako ste roeni
kao hrianin vi ste hranjeni - va kompjuter, va um, je hranjen - s likom Isusa. Kad god
ponete da meditirate, pohranjena slika dolazi u um; bljesne u umu.
Isus se pojavljuje vama; Isus se nikada ne pojavljuje Jevrejima. A on je bio Jevrejin.
Roen je kao Jevrejin, umro je kao Jevrejin, ali on se nikada ne javlja Jevrejima, jer oni
nikada nisu verovali u njega. Oni su mislili da je on samo vagabund, raspeli su ga kao
kriminalca. Isus se nikada ne javlja Jevrejima, iako je pripadao Jevrejima - imao je jevrejske
15
Bivanje, Bitak, Jastvo, Sopstvo.
44
krvi i kosti.
uo sam priu da su u nacistikoj nemakoj vojnici iz Hitlerove vojske ubijali Jevreje
u gradu. Mnogi su ubijeni. Nekoliko Jevreja je pobeglo. Bilo je to nedeljno jutro. Pobegli su;
doli su do hrianske crkve jer su mislili da e to biti najbolje mesto da se sakriju. Crkva je
bila puna hriana, jer to bilo u nedelju ujutro. Tako se tamo sakrilo desetak Jevreja.
Meutim, vojnici su saznali da su neki Jevreji pobegli u crkvu i da se tamo kriju, pa su
otili u crkvu. Rekli su sveteniku: "Zastavi slubu!" Predvodnik vojnika je uao i rekao: "Ne
moete nas obmanuti. Ima nekoliko Jevreja koji se kriju ovde. Dakle, svako ko je Jevrejin
treba da izae i stane u red. Ako sledite nae naredbe moete spasiti sebe. Ako neko pokua
da obmane, odmah e biti ubijen."
Ubrzo su Jevreji izali iz crkve i stali u red. Onda je iznenada cela gomila postala
svesna da je Isus iezao, Isusova statua. On je takoe bio Jevrejin, tako da je stao napolju u
redu.
Isus se nikada nije javljao Jevrejima. On nije bio ni hrianin. On nikada nije pripadao
nijednoj hrianskoj crkvi, da se sada vrati ne bi ni prepoznao hriansku crkvu, on je iao u
sinagogu, odlazio bi u jevrejsko drutvo. Iao bi da vidi rabina, ne bi mogao otii da vidi
katolikog ili protestantskog svetenika. On ih ne zna. Ali se nikada ne pojavljuje Jevrejima
jer nikada nije bio posejan u njihovoj mati. Oni su ga odbacili, tako da seme nije tu.
Dakle, ta god da se dogodi, devedeset devet mogunosti ima da ste upravo nahranjeni
znanjem, konceptima, slikama. One bljesnu pred vaim umom, i kada ponete da meditirate vi
postajete osetljivi. Postajete senzitivni tako da moete postati rtva svoje vlastite mate. A
mata e izgledati tako realno da ne postoji nain da se prosudi da li je stvarna ili nestvarna.
Samo jedan procenat sluajeva nee biti izmiljen, ali kako da se zna? U tom jednom
procentu sluaja zaista nee biti nita izmiljeno. Neete oseati da Isus stoji pred vama
raspet, neete oseati da Krina stoji pred vama niti ete plesati s njim, vi ete samo oseati
prisustvo, ali tu nee biti lika, vizije, zapamtite to. Osetiete sputanje boanskog prisustva.
Biete ispunjeni s neim nepoznatim, ali bez ikakvog oblika. Nee biti plesa Krine i nee biti
raspetog Isusa i nee biti Bude koji sedi u sidhasani, ne! Jednostavno e biti samo prisustva,
ivog prisustva koje tee unutar vas, unutra i van. I vi ste preplavljeni, vi ste u okeanu tog
prisustva.
Isusa nee biti u vama, vi ete biti u Isusu. To e biti razlika. Krina nee biti u vaem
umu, kao slika, vi ete biti u Krini. Ali onda Krina e biti bezoblian. To e biti jedno
iskustvo, ali ne i jedna slika.
Onda zato ga nazivati Krinom? Nee biti forme. Zato to nazivati Isusom? Oni su
jednostavno simboli, jeziki simboli. Vi ste upoznati s reju "Isus", tako kada to prisustvo
ispuni vas i vi postanete deo toga, vibrirajui deo toga; kada postanete kap u tom okeanu,
kako to da izrazite? Vi znate da najlepa re za vas moe biti "Isus" ili najlepa re moe biti
"Buda" ili "Krina" - ovim reima je hranjen um, tako da vi birate te odreene rei da iskau
to prisustvo.
Ali to prisustvo nije jedna zamisao; to nije san, to uopte nije vizija. Vi moete
koristiti Isusa, moete koristiti Krinu, moete koristiti Hrista, bilo ta, bilo koje ime koje vam
se svia, koje ima ljubavnu privlanost za vas. To zavisi od vas. Ta re i to ime, i ta slika e
doi iz vaeg uma, ali smo iskustvo je nezamislivo. To nije samo jedna imaginacija.
Jedan katoliki svetenik je posetio zen majstora, Nan-ina. Nan-in nikada nije uo za
Isusa, pa je taj katoliki svetenik mislio: "To e biti dobro. Ja u proitati neke delove iz
Propovedi na gori, i videu kako Nan-in reaguje. A ljudi kau da je on prosvetljen."
Tako je katoliki svetenik otiao kod Nai-ina i rekao: "Uitelju, ja sam hrianin, ja
imam knjigu i volim je. eleo bih da vam proitam neto iz nje samo da vidim kako vi
reagujete." Onda je proitao nekoliko redova iz Propovedi na gori - iz Novog Zaveta. Preveo
je to na japanski, jer Nan-in je razumeo samo japanski.
Kada je poeo da prevodi, itavo lice Nan-ina se potpuno promenilo. Suze su poele
da teku iz njegovih oiju, rekao je: "To su rei Bude." Hrianski svetenik je rekao: "Ne, ne,
ovo su rei Isusove." Meutim Nam-in je rekao: "Dajte mu koje god hoete ime, ali ja oseam
ovo su rei Bude jer ja znam Budu, a ove rei mogu doi samo kroz Budu. Ako vi kaete da
45
su dole kroz Isusa, onda je Isus bio Buda; to ne ini nikakvu razliku. Onda u rei mojim
uenicima da je Isus bio budista."
Takvo e biti oseanje. Ako vi oseate prisustvo boanskog, onda su imena
beznaajna. Imena su obavezna da budu razliita za svakoga jer imena dolaze iz obrazovanja,
imena dolaze iz kulture, imena dolaze iz naroda kome pripadate. Meutim, ovakvo iskustvo
ne pripada nijednom drutvu, ovakvo iskustvo ne pripada nijednoj kulturi, ovakvo iskustvo ne
pripada vaem umu, kompjuteru - ono pripada vama.
Stoga zapamtite, ako vidite vizije, one su mata. Ako ponete da oseate prisustva -
bezoblina, egzistencijalna iskustva - obavijeni ste njima, stopljeni s njima, rastvoreni u
njima, onda ste stvarno u kontaktu.
Moete nazvati to prisustvo Isusom, moete zvati to prisustvo Budom, to zavisi od
vas, nema razlike. Isus je Buda, a Buda je Hristos. Oni koji su otili izvan uma, oni su takoe
otili izvan linosti. Oni su takoe otili van formi. Ako Isus i Buda stoje zajedno, tu e biti
dva tela, ali samo jedna dua. Bie dva tela, ali ne dva prisustva, jedno prisustvo.
To je isto kao kada stavite dve lampe u sobu. Lampe su dve, samo po svom obliku, ali
svetlo postaje jedno. Ne moete razgraniiti da ovo svetlo pripada ovoj lampi, a ono svetlo
pripada onoj lampi. Svetla su sjedinjena. Samo materijalni deo lampe je ostao odvojen,
meutim nematerijalni deo postaje jedan.
Ako Buda i Isus dou blizu, ako stanu zajedno, videete dve lampe, odvojene, ali
njihova svetla su se ve sjedinila. Oni su postali jedno. Svi oni koji su spoznali istinu, postali
su jedno. Njihova imena su razliita za njihove sledbenike; za njih, sada nema imena.
etvrto pitanje:
Molimo objasnite da li je svest takoe jedna od modifikacija uma.
Ne, svest nije deo uma. Ona tee kroz um, ali ona nije deo uma. To je ba kao ova
sijalica - elektricitet tee kroz nju, ali elektricitet nije deo sijalice. Ako razbijete sijalicu, vi
niste slomili elektricitet. Izraaj e biti spreen, ali potencijal ostaje skriven. Stavite drugu
sijalicu, i elektricitet poinje da tee.
Um je samo jedan instrument. Svest nije deo njega, ali svest tee kroz njega. Kada je
um transcendiran, svest ostaje u sebi. Zbog toga kaem da e ak i Buda morati da koristi um
ako vam govori, ako ima veze s vama, jer onda trebae mu tok kojim e tei njegov unutarnji
izvor. On e morati da koristi instrumente, medijume, i onda e um funkcionisati. Inae um je
samo vozilo.
Vi se kreete u vozilu, ali niste vozilo. Vi idete u kolima, ili letite u avionu, ali vi niste
ta vozila. Um je samo vozilo. I vi ne koristite um u njegovom totalnom kapacitetu. Ako
koristite um u njegovom potpunom kapacitetu, to e postati ispravno znanje.
Mi koristimo na um kao neko to koristi avion kao autobus. Moete isei krila avionu
i koristiti ga kao autobus na putu. To e delovati; on e raditi kao autobus. Ali vi ste budalasti.
Taj autobus moe leteti! Ne koristite ga u njegovom pravom kapacitetu!
Vi koristite svoj um za snove, matanja, ludosti. Vi ga niste iskoristili, isekli ste mu
krila. Ako ga koristite s krilima, to moe postati ispravno znanje; to moe postati mudrost. Ali
to je takoe deo uma; to je takoe vozilo. Korisnik ostaje u pozadini; korisnik ne moe biti
korien. Vi koristite to, vi ste svest. I svi napori meditacije jesu sredstvo za upoznavanje ove
svesti u njenoj istoti, bez ikakvog medijuma. Jednom kada znate nju bez ikakvog
instrumenta, vi je moete znati! A ovo se moe saznati samo kada je um prestao da
funkcionie. A kada um prestane da funkcionie - vi ete postati svesni da je ta svest tu, vi ste
ispunjeni s njom. Um je bio samo vozilo, prolaz. Sada, ako elite, moete koristiti um; ako ne
elite, ne treba da ga koristite.
Telo i um, oboje su vozila. Vi niste vozilo, vi ste gospodar skriven iza ovih vozila. Ali
ste zaboravljeni potpuno. I postali ste dvokolica; vi ste postali vozilo. To je ono to Gurijev
naziva identifikacijom. To je ono to su, u Indiji, jogini nazvali tadatyma, postajanje jedno sa
neim to vi niste.
46
Peto pitanje:
Molimo objasnite kako je mogue da samo pomou posmatranja, pomou svedoenja
zapisa u modanim elijama, izvori procesa miljenja mogu prestati da postoje.
Oni nikada ne prestaju da postoje, ali samim svedoenjem je identifikacija prekinuta.
Buda je iveo u svom telu etrdeset godina posle svog prosvetljenja; telo nije prestalo
postojati. Neprekidno etrdeset godina on je govorio, objanjavao, inio da ljudi razumeju ta
mu se dogodilo i kako isto moe da se dogodi njima. On je koristio um; um nije prestao. Kada
je doao posle dvanaest godina u svoj rodni grad, prepoznao je svog oca, prepoznao je svoju
enu, prepoznao je svog sina. Um je bio tu, pamenje je bilo tu; inae prepoznavanje nije
mogue.
Um zaista nije prestao da postoji. Kada mi kaemo um prestaje, mislimo vaa
identifikacija je prekinuta. Sada vi znate: ovo je um, a ovo je "Ja sam". Most je sruen. Sada
um nije gospodar. On je postao samo jedno orue; on je pao na svoje pravo mesto. Dakle kad
god vam je on potreban, moete ga koristiti. To je isto kao ventilator. Ako elite da ga
koristite, ukljuite ga, onda ventilator pone da funkcionie. Sada mi ne koristimo ventilator,
tako da je on neaktivan. Ali je on ovde, on nije prestao da postoji. Svakog momenta moete
da ga koristite. On nije iezao.
Samo pomou svedoenja, identifikacija iezava, ne um. Ako identifikacija iezne,
vi ste totalno novo bie. Po prvi put vi ste saznali svoju pravu pojavu, vau pravu realnost. Po
prvi put vi ste upoznali ko ste. Sada je um samo deo mehanizma oko vas.
To je isto kao da ste pilot i letite u avionu. Koristite mnogo instrumenata; vae oi
rade na mnogim instrumentima, neprekidno svesni ovoga i onoga. Ali vi niste ti instrumenti.
Ovaj um, ovo telo i mnoge psihofizike funkcije samo su oko vas, mehanizam. U
ovom mehanizmu vi moete postojati na dva naina. Jedan nain egzistencije je da zaboravite
sebe i oseate kao da ste mehanizam. To je ropstvo, to je patnja; to je svet, samsara.
Drugi nain funkcionisanja je ovaj: postajui svesni da ste odvojeni, vi ste razliiti.
Onda nastavljate da ga upotrebljavate, ali sada to stvara veliku razliku. Sada mehanizam niste
vi. Ako neto krene pogreno u mehanizmu, moete pokuati da to ispravite, vi neete biti
uznemireni. ak i ako itav mehanizam iezne, vi neete biti uznemireni.
Budino umiranje i vae umiranje su dve razliite pojave. Buda umirui zna da samo
mehanizam umire. On je bio korien, i sada nije potreban. Teret je uklonjen; on postaje
slobodan. On e se kretati sada bez oblika. Ali vae umiranje je neto sasvim razliito. Vi
patite, vi plaete, jer oseate da vi umirete, ne mehanizam. To je vaa smrt. Onda to postaje
jedna silna patnja.
Samo uz pomo svedoenja, um ne prestaje i modane elije nee prestati. Pre e
postati ivlji jer e biti manje konflikta, vie energije. Oni e postati sveiji. I moete ih
koristiti mnogo ispravnije, mnogo preciznije, neete biti optereeni njima i nee vas prisiliti
da inite neto. Nee vas gurati i vui ovde i onde. Vi ete biti gospodar.
Inae kako se to deava samo uz pomo svedoenja? Zato to se to tako dogodilo,
ropstvo se dogodilo uz pomo nesvedoenja. Ropstvo se dogodilo zato to niste bili svesni,
stoga ropstvo e ieznuti ako postanete svesni. Ropstvo je samo nesvesnost. Nita drugo nije
potrebno: postanite vie svesni, ta god da radite.
Vi sedite ovde i sluate me. Moete sluati sa svesnou, moete sluati bez svesnosti.
Bez svesnosti takoe e sluanje biti tu, ali e to biti razliita stvar, kvalitet e se razlikovati.
Onda vae ui sluaju, a va um deluje negde drugde.
Onda nekako, nekoliko rei e ui u vas. Ali one e biti pomeane i va um e ih
interpretirati na svoj vlastiti nain. On e staviti svoje vlastite ideje u njih. Sve e biti smutnja
i nered. Vi ste sluali, ali mnoge stvari e biti proputene, mnoge stvari se nee uti. Vi ete
birati. Onda e cela stvar biti izobliena.
Ako ste svesni, onog momenta kada postanete svesni, miljenje prestaje. Sa panjom
vi ne moete misliti. itava energija postaje svesna, nije vie preostalo energije da se preseli u
miljenje. Kada ste svesni makar za jedan trenutak, vi jednostavno sluate. Nema prepreke.
Vae rei nisu tu da bi mogle biti pomeane. Vama nije potrebno tumaenje. Uticaj je
47
direktan.
Ako sluate sa budnou, onda ono to ja kaem moe biti znaajno ili moe biti bez
znaenja, ali vae sluanje s budnou uvek e biti upueno u smisao. Sama budnost stvorie
vrhunac vae svesnosti. Prolost e se rastvoriti, budunost e nestati. Neete biti nigde
drugde, vi ete biti samo ovde i sada. A u tom momentu tiine kada miljenja nema, biete
duboko u kontaktu sa svojim vlastitim izvorom. A taj izvor je blaenstvo, taj izvor je
boanski. Dakle, jedina stvar koju treba uraditi je da se sve radi sa budnou.
Poslednje, esto pitanje:
Dok ste govorili o Lao Ce-u vi ste postali taoistiki mudrac, dok ste govorili o tantri
vi ste postali tantrista, dok ste govorili o bhakti vi ste postali prosvetljeni bhakta, a dok
govorite o jogi vi postajete savreni jogin. Molim vas hoete li nam objasniti kako je taj
fenomen postao mogu?
Kada vi niste, samo onda to moe biti mogue. Ako vi jeste, onda to ne moe postati
mogue. Ako vi niste, ako je domain potpuno iezao, onda gost postaje gazda. Dakle gost
moe biti Lao Ce, gost moe biti Patanjali. Gazda nije tu, tako da gost zauzima njegovo
mesto potpuno, on postaje domain. Ako vi niste onda moete postati Patanjali; ne postoji
tekoa. Moete postati Krina, moete postati Hrist. Ako ste vi tu, onda je to vrlo teko. Ako
ste vi tu, ta god da kaete bie pogreno.
Zbog toga kaem da ovo nisu komentari. Ja ne komentariem Patanjalija. Ja sam
jednostavno odsutan, doputajui to Patanjaliju. Stoga ovo nisu komentari. Komentarisati
znailo bi da je Patanjali neto odovojeno. I da sam ja odvojen i da ja komentariem
Patanjalija. To e sigurno biti izoblieno, jer kako mogu da komentariem Patanjalija? Ma
ta da kaem bie to moje rei, i ma ta da kaem bie to moje tumaenje. Ja ne mogu biti
sam Patanjali. I to sve nee biti dobro. Bie destruktivno. Stoga ja ne komentariem uopte.
Ja jednostavno doputam da se to izrazi kroz mene, a ovo doputanje je mogue samo ako ja
nisam tu.
Ako postanete svedok, ego iezava. A kada ego iezne, vi postajete vozilo, postajete
prolaz, postajete flauta. A flauta moe biti stavljena na Patanjalijeve usne, flauta moe biti
poloena na Krinine usne, i flauta moe biti stavljena na Budine usne - flauta ostaje ista. Ali
kada je na Budinim usnama, Buda tee.
Dakle, ovo nije komentar. Teko je ovo razumeti jer ne moete dopustiti. Vi ste toliko
mnogo unutar sebe da ne moete dozvoliti nikome. A oni nisu osobe. Patanjali nije osoba;
Patanjali je prisustvo. Ako ste vi odsutni, njegovo prisustvo moe da deluje.
Ako pitate Patanjalija, on e isto rei. Ako pitate Patanjalija, on nee rei da je ove
sutre stvorio on. On e rei: "One su vrlo drevne - sanatan." On e rei: "Milioni i milioni
mudraca su ih videli. Ja sam samo vozilo. Ja sam odsutan, a one govore." Ako pitate Krinu
on e rei: "Ja ne govorim. Ovo je najvea drevna poruka. To je uvek bilo tako. Ako pitate
Isusa, on e rei: "Ja nisam vie, ja nisam tu."
emu ovo insistiranje? Svako ko postane odsutan, ko postane bez ega, zapoinje da
funkcionie kao vozilo, kao prolaz - prolaz za sve to je istina, prolaz za sve to je skriveno u
egzistenciji, to moe da tee. Vi ete moi da razumete ta god da ja govorim samo kada
barem za trenutak budete odsutni.
Ako ste previe ovde, va ego je ovde, onda ma ta ja da kaem ne moe tei u vas. To
nije samo intelektualna komunikacija. To je neto dublje.
Ako ste makar za trenutak bez ega, osetiete prodor razumevanja. Tada e neto
nepoznato ui u vas, i u tim trenucima ete razumeti. I nema drugog naina da razumete.
48
Poglavlje 5
ISTINITO I NEISTINITO ZNANJE
29. decembar 1973.
I, 7: pratyakanumanagamah pramanani.
Neposredno zrenje (pratyaka), logino zakljuivanje (anumana) i predanje
zasnovano na proverenim tradicijama (agama) su [iskljuivi izvori] istinostnih
spoznavanja (pramana).
I, 8: viparyaya mithyajnanatadrupapratitham.
Zabluda (viparyaya) je [ona vrsta] pogrenog saznanja koje proizilazi iz formi
razliitih od ovih [napred navedenih].
I, 9: abdajnananupati vastuunyo vikalpah.
Afektivno uivljavanje u imaginativnom(vikalpa) je [onaj obrt] koji proizilazi
kao rezultat verbalnog saznanja (sabdajnana) a kojem nedostaje realna potpora.
I, 10: abhavapratyayalambana vrttirnidra.
Spavanje (nidra) je onaj obrt koji kao potporu poticaju energija (pratyaya)
ima odsutnost.
I, 11: anubhutaviayasampramoah smrtih.
Neisputanje (asampramoa) onog [jednom ve] iskuenog jeste seanje
(smrti).
Prva sutra:
Ispravno znanje ima tri izvora: direktno saznanje, zakljuivanje i rei probuenih
ljudi.
Pratyaka, direktno saznanje, je prvi izvor istinitog znanja. Direktno saznanje
oznaava susret licem-u-lice, bez ikakvog sredstva, bez ikakvog posrednika. Kada vi znate
neto direktno, saznavalac gleda u znano odmah. Nema nikoga da to povezuje, nema
premoavanja. Onda je to ispravno znanje. Ali onda se javljaju mnogi problemi.
Obino, pratyaka, direktno saznanje, je prevoeno, interpretirano, komentarisano, na
vrlo pogrean nain. Sama re pratyaka znai pred oima, neposredno zrenje. Ali same oi
su posredovanje, saznavalac je skriven u pozadini. Oi su sredstva. Vi sluate mene, ali to nije
direktno; to nije neposredno. Vi sluate mene kroz ula, kroz ui. Vidite mene kroz oi.
Vae oi mogu pogreno da vas izveste. Nikome ne treba verovati; nijednom
posredniku ne treba verovati, jer vi se ne moete osloniti na posrednika. Ako su vae oi
bolesne, one e izvestiti razliito; ako su vae oi drogirane, one e izvestiti razliito; ako su
vae oi ispunjene seanjem, one e izvestiti razliito.
Ako ste u ljubavi, onda vidite neto drugo. Ako niste u ljubavi onda to nikada ne
moete videti. Jedna obina ena moe postati najlepa osoba u svetu ako je gledate kroz
ljubav. Kada su vae oi ispunjene ljubavlju, onda one izvetavaju neto drugo. A ista osoba
moe izgledati najrunija ako su vae oi ispunjene s mrnjom. One nisu pouzdane.
Vi ujete kroz ui. Ui su instrumenti, one mogu da funkcioniu pogreno; one mogu
da uju neto to nije bilo reeno; one mogu propustiti neto to je reeno. ula ne mogu biti
pouzdana; ula su samo mehanika sredstva.
Onda ta je pratyaka? ta je direktno saznanje? Direktnog saznanja moe biti samo
kada ne postoji posrednik, ak ni ula. Patanjali kae da je onda to ispravno znanje. To je
49
prvi osnovni izvor istinskog znanja: kada znate neto a ne morate zavisiti ni od ega drugog.
Samo u dubokoj meditaciji vi transcendirate ula. Tada direktno saznanje postaje
mogue. Kada Buda saznaje svoje najunutarnije bie, to najskrivenije bie je pratyaka; to je
direktna spoznaja. Nikakva ula nisu ukljuena; niko nije izvestio to; ne postoji nita slino
posredniku. Saznavalac i saznavano su licem u lice. Ne postoji nita izmeu. To je
neposrednost, a neposrednost samo moe biti istinita.
Dakle, prvo istinito znanje moe samo biti ono od unutarnjeg Sopstva.
16
Moete znati
ceo svet, ali ako niste saznali najdublju sr svoga bia itavo vae znanje je apsurdno, to nije
pravo znanje, ono ne moe biti istinito, jer prvo, osnovno ispravno znanje se nije dogodilo
vama. Cela vaa graevina je lana. Moete znati mnoge stvari. Ako niste spoznali Sebe, sve
vae znanje je zasnovano na izvetajima, izvetajima datim od ula. Ali kako moete biti
sigurni da vas ula izvetavaju pravilno?
Nou vi sanjate. Dok sanjate poinjete verovati u san, da je on istinit. Vaa ula
izvetavaju o snu - vae ui ga uju, vae oi ga vide, moete da to dodirujete. Vaa ula vas
tako izvetavaju; zbog toga padate pod iluziju da je to realno. Vi ste ovde; to moe biti samo
san. Kako moete biti sigurni da vam govorim u realnosti? Da li je mogue da je ovo samo
san, da me sanjate. Svaki san je istinit dok sanjate.
uang Ce je jednom sanjao da je postao leptir. Ujutru je bio tuan. Uenici su ga
pitali: "Zato ste tako alosni?" uang Ce je rekao: "Ja sam u nevolji. U takvoj neprilici u
kakvoj nikada ranije nisam bio. Zagonetka mi izgleda nemogua; ne moe se reiti. Prole
noi videh u snu da sam postao leptir!"
Uenici su se nasmejali. Rekoe: "Kakva je to stvar? To nije zagonetka. San je samo
san." uang Ce je rekao: "Ali ujte, ja sam u nevolji. Ako uang Ce moe sanjati da je postao
leptir, leptir moda sada sanja da je postao uang Ce. Dakle, kako presuditi da li se ja sada
suoavam s realnou ili opet sanjam. Ako je uang Ce mogao postati leptir, zato leptir ne bi
mogao sanjati da je postao uang Ce?"
To nije nemogue, i obrnuto se moe dogoditi. Ne moete se osloniti na ula. U snu
vas ona obmanjuju. Ako uzmete drogu, LSD ili neto, vaa ula poinju da vas obmanjuju;
zapoinjete da vidite stvari koje nisu tu. Ona vas mogu zavesti do takvog stepena da moete
poeti da verujete u stvari tako potpuno, da moete biti u opasnosti.
Jedna devojka je skoila u Njujorku sa esnaestog sprata, jer je pod uticajem LSD
mislila da moe da leti. uang Ce nije pogreio: devojka je zaista izletela kroz prozor.
Naravno, umrla je. Ali ona za to nikada ne bi bila sposobna da nije bila zavedena svojim
ulima pod uticajem droge.
ak i bez droge mi imamo obmane. Prolazite kroz mranu ulicu, i iznenada se
prestravite - zmija je tu. Poinjete da trite, a docnije saznate da to nije bila zmija, tamo je
samo lealo ue. Ali kada ste osetili da je tamo bila zmija, bila je zmija. Oi su vas obavestile
da je tamo zmija i vi ste se ponaali saglasno tome - pobegli ste s tog mesta.
ulima se ne moe verovati. Onda ta je direktno saznanje? Direktno saznanje je neto
to se zna bez ula. Dakle, prvo istinito znanje moe biti samo od unutranjeg Sopstva, jer
samo tamo ula nee biti potrebna. Svuda drugde ula e biti potrebna. Ako elite da vidite
mene moraete da me vidite kroz oi, ali ako elite da vidite sebe, oi nisu potrebne. ak i
slep ovek moe videti sebe. Ako elite da vidite mene svetlo e biti potrebno, ali ako elite
da vidite sebe tama je u redu, svetlo nije potrebno.
ak i u najmranijoj peini vi moete znati sebe. Nikakav medijum - svetlost, oi, bilo
ta - nije potreban. Unutarnje iskustvo je neposredno, trenutno, a neposredno iskustvo je
osnova sveg istinitog znanja.
Jednom kada ste ukorenjeni u tom unutranjem iskustvu onda e mnoge stvari
zapoeti da vam se dogaaju. Nee biti mogue razumeti ih odmah. Ukorenjeni u svom
centru, u svom unutarnjem biu, vi oseate to kao direktno iskustvo, onda vas ula ne mogu
obmanuti. Vi ste probueni. Onda vas oi ne mogu zavesti, onda vas ui ne mogu obmanuti,
onda vas nita ne moe obmanuti. Prevara je izostala.
16
Od Jastva, Atmana, unutarnjeg bia, ili Bitka.
50
Moete biti zavedeni jer ivite u samoobmani, ali ne moete biti obmanuti jednom
kada postanete pravi znalac. Ne moete biti zavedeni! Onda sve ubrzo uzima oblik istinitog
znanja. Jednom kada znate sebe, ta god da znate postae automatski istinito jer ste vi sada
istiniti. Ovo je razlika koju treba zapamtiti: ako ste istiniti, onda sve postaje istinito; ako ste
neistiniti, onda sve postaje pogreno. Dakle nije pitanje injenja neega spolja, to je pitanje
injenja neega unutra.
Ne moete obmanuti Budu - to nije mogue. Kako moete varati Budu? On je
ukorenjen u sebi. Vi ste providni za njega; ne moete ga zavesti. Pre nego to znate, on zna
vas. ak i svetlucanje misli u vama on jasno vidi. On prodire u vas do samog vaeg bitka.
Vae prodiranje ide do istog stepena u druge, kao to ide u vas same. Ako moete
prodreti u sebe, do istog stepena moete prodreti u sve. to se dublje kreete unutra, dublje se
moete kretati spolja. A vi se niste pomerili unutra nijedan in, tako da ta god inite spolja je
samo kao san.
Patanjali kae da je prvi izvor ispravnog znanja neposredno, direktno saznanje
pratyaka. On se ne bavi arvakama, starim materijalistima, koji su govorili da pratyaka,
ono to je pred oima, jeste jedina istina.
Zbog ove rei pratyaka, direktno saznanje, mnogo nerazumevanja se dogodilo.
Indijska kola materijalista je arvaka. Izvor indijskog materijalizma je bio Brihaspati - vrlo
pronicljiv mislilac, samo mislilac; vrlo dubok filozof, samo filozof - ne ostvarena dua. On je
rekao da je samo pratyaka istina, a pod pratyakom on podrazumeva da sve to znate kroz
ula jeste istina. I on kae da ne postoji nain znanja iega bez ula, tako je samo ulno znanje
istinito za arvake.
Dakle, on porie da postoji bilo kakav Bog jer niko ga nikada nije video. A ono to se
moe videti jedino je realno; ono to se ne moe videti ne moe biti istinito. Boga nema jer ga
ne moete videti; due nema jer je ne moete videti. I on kae: "Ako postoji Bog, dovedi ga
ispred mene tako da ga mogu videti. Ako ga ja vidim onda on postoji, jer samo je vienje
istinito."
On je takoe koristio re pratyaka, ali njegovo znaenje je potpuno razliito. Kada
Patanjali koristi re pratyaka njegovo znaenje je na sasvim drugom nivou. On kae da
znanje koje nije izvedeno ni iz kakvog instrumenta, nije izvedeno ni iz kakvog posrednika,
neposredno, jeste istinito. A jednom kada se ovo znanje dogodi, vi ste postali istiniti. Tada
nita lano ne moe da se vam desi. Kada ste vi istiniti, autentino ukorenjeni u istini, onda
iluzije postaju nemogue.
Zbog toga je reeno da Bude nikada ne sanjaju, onaj ko je probuen nikada ne sanja.
Jer ak ni san njemu ne moe da se dogodi; on ne moe biti obmanut. On spava, ali ne kao vi.
On spava na potpuno razliit nain, kvalitet je razliit. Samo njegovo telo spava, relaksira se.
Njegovo bie ostaje budno.
A ta budnost ne doputa nikakav san da se dogodi. Moete sanjati samo kada se
budnost izgubi. Kada niste budni, kada ste duboko hipnotisani, onda poinjete da sanjate.
Sanjanje moe da se dogodi samo kada ste potpuno nesvesni. Vie nesvesnosti, vie snova e
biti prisutno. Vie svesnosti, manje snova. Potpuna svesnost, nema snova. ak i dubok san
bez snova postaje nemogu za onoga ko je ukorenjen u samome sebi, koji je neposredno
spoznao unutarnje bivstvo (Sopstvo).
Ovo je prvi izvor ispravog znanja. Drugi izvor je zakljuivanje. To je sekundarno, ali
to je takoe vredno razmatranja jer, takvi kakvi ste sada, vi ne znate da li postoji Sopstvo
unutra ili ne. Nemate direktno znanje svog unutarnjeg bitka. ta da se radi? Postoje dve
mogunosti. Jednostavno moete poricati da ne postoji unutarnja sr vaeg bia, da nema
due, kao to arvake ine, ili su na Zapadu inili, Epikur, Marks, Engels i drugi.
Meutim, Patanjali kae da ako vi znate, nije potrebno zakljuivanje, ali ako ne
znate, onda e biti korisno da se zakljuuje. Na primer, Dekart, jedan on najveih mislilaca
Zapada, zapoeo je svoje filozofsko traganje kroz sumnju. On je zauzeo gledite od samog
poetka da nee verovati ni u ta to nije neosporno i oevidno. U ono u ta se moe sumnjati,
on e sumnjati. I pokuae da otkrije taku s koje se ne moe sumnjati, i samo sa tog mesta e
stvoriti celu graevinu svog miljenja. Lep gest - iskren, teak za dostizanje, opasan.
51
Dakle, on je poricao Boga, jer moete sumnjati. Mnogi su sumnjali, a niko nije mogao
da odgovori na njihove sumnje. On je nastavio da osporava. Sve u ta se moglo sumnjati, to
je shvaeno kao nepouzdano, on je osporavao. Godinama je neprekidno bio u unutranjem
meteu. Onda je pao na taki koja je bila nosporna: nije mogao porei sebe; to je bilo
nemogue. Ne moete rei: "Ja nisam". Ako kaete to, samo vae izgovaranje dokazuje da vi
jeste. Stoga je to bio temelj, to "ne mogu porei sebe samoga; ne mogu rei da nisam. Ko e
rei to? ak i da bih sumnjao u sebe, ja sam neophodan da bih sumnjao".
Ovo je zakljuak. Ovo nije direktno saznanje. Ovo je kroz logiku i dokaz, ali to daje
senku, to daje letimino sagledavanje, to vam daje mogunost, jedno otvaranje. Onda je
Dekart imao stenu, a na ovoj steni veliki hram moe biti izgraen. Jedna neosporna injenica,
i vi moete stii do apsolutne istine. Ako zaponete sa sumnjivom stvari, nikada neete stii
nigde. U samoj osnovi, sumnja ostaje.
Patanjali kae da je zakljuivanje drugi izvor istinitog znanja. Ispravna logika,
ispravna sumnja, ispravan dokaz moe vam dati neto to moe pomoi na putu prema
pravom znanju. To on naziva zakljuivanjem, anumana. Direktno vi niste videli, ali sve
dokazuje to, to mora biti tako. Dokazi su tako postavljeni da to mora biti tako.
Na primer, vi gledate okolo iroki univerzum. Moda neete moi da shvatite da
postoji Bog, ali ne moete osporiti - jer ceo univerzum je ureen sistem, kohernetna celina,
osmiljena. To ne moete porei. Osmiljenost je tako oigledna da ak ni nauka to ne moe
porei. Naprotiv, nauka stalno nalazi sve vie i vie planova, vie i vie zakona.
Ako je svet samo jedna sluajnost, onda nauka nije mogua. Ali ne izgleda da je svet
jedna sluajnost, izgleda da je planiran, i pokree se prema odreenim zakonima, a ovi zakoni
se nikada ne naruavaju.
Patanjali e rei da plan univerzuma ne moe da se porekne, a ako jednom osetite da
postoji plan, planer je uao. Ali to je jedan zakljuak, vi ga niste spoznali direktno - ve samo
plan univerzuma, planiranje, zakone, red. A red je tako velianstven! On je tako detaljan, tako
sjajan, tako beskonaan! Red postoji; sve bruji u jednom poretku, muzika harmonija celog
univerzuma. Neko je izgleda skriven u pozadini, ali to je jedan zakljuak.
Patanjali kae da zakljuivanje takoe moe biti pomo prema ispravnom znanju, ali
to mora da bude ispravno zakljuivanje. Logika je opasna; ona je s dve otrice. Moete
koristiti logiku pogreno; onda ete takoe postii zakljuak.
Na primer, rekao sam vam da plan postoji, model postoji; svet ima izvestan red, lep
red, savren. Ispravan zakljuak e biti da izgleda da postoji neka ruka iza toga. Moda
neemo biti direktno svesni, moda neemo biti u direktnom dodiru s tom rukom, ali ruka
izgleda da je tu, skrivena. Ovo je ispravno zakljuivanje.
Ali iz iste premise vi moete zakljuiti i pogreno. Postojali su mislioci koji su rekli...
Didro je rekao: "Zbog reda ja ne mogu verovati da postoji Bog. Svetom izgleda vlada savren
poredak. Zbog tog reda, ne mogu da verujem da postoji Bog." Koja je njegova logika? On
kae, ako postoji neka osoba u pozadini, onda ne moe biti tako velikog reda. Ako je osoba u
pozadini toga, onda ona mora poiniti ponekad greke. Ponekad on mora biti kapriciozan,
pogubljen, ponekad se mora promeniti. Zakoni ne mogu biti tako savreni ako je neko u
pozadini. Zakon moe biti savren ako nema nikoga iza i oni su jednostavno mehaniki.
To takoe ima privlanost. Ako sve ide savreno, to izgleda mehaniki jer se o oveku
kae, greiti je ljudski. Ako je tu neka osoba, onda ona ponekad mora greiti - dosaivae se s
tako mnogo savrenstva. Ponekad ona mora eleti promenu.
Voda vri na sto stepeni. Ona je kljuala na sto stepeni milenijumima, uvek i svugde.
Bogu mora postati dosadno, ako je on u pozadini, Didro kae, dakle samo radi promene,
jednog dana e on rei: "Od sada na dalje voda e kljuati na devedeset stepeni." Ali se to
nikada nije dogodilo, prema tome izgleda da nema osobe.
Oba argumenta izgledaju savrena. Meutim Patanjali kae da je ispravno
zakljuivanje ono koje vam daje mogunosti za rast i napredak. Nije pitanje da li je logika
savrena ili ne. Pitanje je da va ishod treba da postane jedno otvaranje. Ako nema Boga, on
postaje zatvaranje. Onda ne moete da rastete. Ako zakljuite da postoji neka skrivena ruka,
svet postaje misterija. A onda vi niste ovde samo sluajno. Onda va ivot postaje znaajan.
52
Onda ste deo velike eme. Onda je neto mogue; moete uiniti neto, moete se uzdii u
svesti.
Ispravno zakljuivanje oznaava zakljuivanje koje vam moe dati rast; pogreno
zakljuivanje je ono koje, ma kako savreno da izgleda, zatvara va rast. Zakljuivanje moe
biti takoe izvor istinitog znanja. ak i logika se moe iskoristiti da bude izvor ispravnog
znanja, ali morate biti vrlo svesni ta radite. Ako ste samo logini, moete poiniti
samoubistvo kroz to. Logika moe da postane samoubistvo. To je postala za mnoge.
Ba pre nekoliko dana bio je ovde jedan tragalac iz Kalifornije. On je putovao dugo.
Doao je da se sretne sa mnom. A onda je rekao: "Pre nego to meditiram i pre nego to mi
kaete da meditiram, uo sam da ko god doe kod vas vi ga gurnete u meditaciju, tako da pre
nego to me gurnete, imam pitanja." Imao je listu barem od sto pitanja. Mislim da nije
ispustio nijedno koje je mogue - o Bogu, o dui, o istini, o nebu, paklu - lista je bila puna
pitanja. Rekao je: "Dok ne reite ova pitanja, ne idem da meditiram."
On je logian na nain to kae: "Dok se na moja pitanja ne odgovori, kako mogu
meditirati? Dok ne osetim pouzdano da ste vi ispravni, dok ne odgovorite na moje sumnje,
kako mogu poi u nekom pravcu koji vi izlaete i pokazujete? Vi ste moda neistiniti. Dakle,
moete dokazati vau ispravnost samo ako ieznu moje sumnje."
A njegove sumnje su takve da ne mogu nestati. Ovo je dilema: ako on meditira sumnje
e nestati, ali on kae da e meditirati samo kada ne bude bilo sumnji. ta da se radi? On
kae: "Prvo dokaite da ima Boga." Niko to nije dokazao, niti e ikada neko moi. To ne
znai da Bog ne postoji, nego da ne moe biti dokazan. On nije mala stvar koja se moe
dokazati ili pobiti. To je tako vitalna stvar, morate je iveti da biste je znali. Nikakav dokaz ne
moe da pomogne.
Ali on je logino u pravu. On kae: "Dok ne dokaete kako mogu zapoeti? Ako nema
due, ko e meditirati? Tako prvo dokaite da postoji Sopstvo, onda mogu meditirati."
Ovaj ovek izvrava samoubistvo. Niko nee nikada moi da mu odgovori. On je
stvorio sve prepreke, a kroz te barijere nee moi da raste. Ali on je logian. ta mogu da
uradim s takvom osobom? Ako ponem da odgovaram na njegova pitanja, osoba koja moe
stvoriti stotinu sumnji moe stvoriti milione, jer sumnjanje je nain postojanja uma. Moete
odgovoriti na jedno pitanje, kroz va odgovor on e stvoriti jo deset jer um ostaje isti.
On trai sumnje, ako odgovorim logino ja pomaem njegov logini um da bude
hranjen, da bude vie ojaan. Ja ga hranim. To nee pomoi. On treba da bude izbaen iz
svoje loginosti.
Tako sam mu ja rekao: "Jesi li ti ikada bio zaljubljen?" On je rekao: "Ali zato? Vi
menjate predmet razgovora." Ja sam mu rekao: "Vratiu se natrag na tvoja pitanja, ali mi je
iznenadno postalo vrlo znaajno da te pitam jesi li ikada voleo." On je rekao: "Da!" Lice mu
se promenilo. Pitao sam: "Pre nego to si se zaljubio, jesi li sumnjao u celu tu pojavu?"
Onda je bio uznemiren. Bilo mu je neugodno. Rekao je: "Ne, nikada nisam mislio o
tome. Jednostavno sam se zaljubio, a onda sam postao toga svestan." Onda sam ja rekao:
"Uini suprotno. Prvo misli o ljubavi, da li je ljubav mogua, da li ljubav postoji, da li ljubav
uopte moe postojati. Prvo neka bude dokazana, naini joj uslov da dok ne bude dokazana
nee voleti nikoga."
On je rekao: "ta govorite? Vi ete unititi moj ivot. Ako nainim taj uslov, onda ne
mogu voleti." A ja sam mu rekao: "To je isto to ti ini. Meditacija ja ista kao ljubav. Mora
prvo da je upozna. Bog je upravo kao ljubav. Zbog toga je Isus stalno govorio kako je Bog
ljubav. To je isto kao ljubav. Prvo ovek mora to da iskusi."
Logini um moe biti zatvoren, i to tako logino da nikada nee oseati da je zatvorio
svoja vrata za sve mogunosti rasta. Stoga ispravno zakljuivanje, anumana, znai
razmiljanje na koji nain se taj rast pomae. Onda ono moe postati izvor istinitog znanja.
A tree je najlepe. Nigde drugde to nije uinjeno izvorom ispravnog znanja - rei
probuenih osoba, agama. Vodila se velika polemika oko ovog treeg izvora. Patanjali kae
da moete znati direktno, onda je to u redu. Moete i zakljuiti ispravno, onda ste takoe na
pravoj stazi i dostii ete izvor.
Meutim, postoje neke stvari koje ne moete nikada zakljuiti, niti ih neposredno
53
spoznati. Inae vi niste prvi na ovoj zemlji, niste prvi tragalac. Milioni su traili tokom
miliona godina - i ne samo na ovoj planeti, ve na drugim planetama takoe. Traganje je
veno i mnogi su stigli. Oni su postigli cilj, oni su uli u hram. Njihove rei su takoe izvor
ispravnog znanja.
Agama oznaava rei onih koji su spoznali. Buda je rekao neto, ili je Isus rekao
neto... mi ne znamo ta su oni govorili. Mi nismo iskusili to, tako da nemamo nain da
sudimo o tome. Ne znamo ta i kako da zakljuujemo ispravno kroz njihove rei. A rei su
kontradiktorne, tako da moete zakljuiti sve to elite.
Ima ih nekoliko koji misle da je Isus bio psihotian. Zapadni psihijatri su pokuali da
dokau da je on psihotian, da je bio manijak. Oni tvrde: "Ja sam sin Boiji, jedini sin" - on je
bio lud, ego-manijak, psihotian. Moe se dokazati da je bio psihotian jer ima mnogo
psihotinih ljudi koji tvrde iste takve stvari. Moete to otkriti. U ludnicama ima mnogo takvih
ljudi.
To se jednom dogodilo u Bagdadu. Kalif Omar je bio kralj, a jedan ovek je
objavljivao na ulicama Bagdada: "Ja sam poslanik, ja sam prorok. Sada je Muhamed izbaen
jer sam ja ovde. Ja sam zadnja re, poslednja poruka od boanskog. I sada nema potrebe za
Muhamedom, njegovo vreme je prolo. On je bio izaslanik do sada, ali sada sam ja doao.
Moete zaboraviti Muhameda."
To nije bila hinduistika zemlja. Hindus moe da tolerie sve, niko nije tolerantan kao
hindus. Oni mogu tolerisati sve jer kau: "Dok mi ne znamo tano, ne moemo rei 'da', ne
moemo rei 'ne'. On moe biti izaslanik, ko zna?"
Ali muslimani su razliiti, vrlo dogmatini. Oni ne mogu tolerisati. Tako je Kalif
Omar, uhvativi novog proroka, bacio ga u tamnicu i rekao mu: "Data su ti dvadeset etiri
sata. Ponovo promisli. Ako kae da nisi prorok, Muhamed je prorok, onda e biti
osloboen. Ako vrsto ostaje u svojoj ludosti, onda u posle dvadeset etiri sata doi u
tamnicu i bie ubijen."
ovek se smejao. Rekao je: "Gledaj! Ovo je zapisano u spisima - proroci e uvek biti
tretirani ovako, kao to ti postupa sa mnom." On je bio logian. Sam Muhamed je bio tretiran
tako, tako da to nije nita novo. ovek je rekao Omaru: "Ovo nije nita novo. Ovako e se
stvari prirodno razvijati. A ja nisam u nekom poloaju da ponovo promiljam. Ja nisam vlast.
Ja sam samo poslanik. Samo Bog moe to da promeni. Za dvadeset etiri sata ti moe doi,
nai e da sam isti. Samo moe da promeni onaj ko me je postavio."
Dok se ovaj razgovor odvijao, drugi ludak, koji je bio vezan lancem za stub, poeo je
da se smeje. Omar ga je pitao: "Zato se ti smeje?" Odgovorio je: "Ovaj ovek apsolutno nije
u pravu. Ja ga nikada nisam postavio! Ne bih to dozvolio. Posle Muhameda nisam poslao
nijednog poslanika." U svakoj ludnici ovi ljudi su prisutni, i za Isusa moe se dokazati da je
slian sluaj.
I rei su tako kontradiktorne i nelogine. Svaka osoba koja zna je primorana da govori
kontradiktorno, paradoksalno, jer istina je takva da moe biti izraena samo kroz paradokse.
Njihove tvrdnje nisu jasne; one su misteriozne. I vi moete zakljuiti bilo ta iz njih na
osnovu svojih zakljuaka. Svojih zakljuaka. Va um je tu; zakljuak je postao va zakljuak.
Zato Patanjali kae, trei izvor. Vi ne znate. Ako znate direktno, onda nema pitanja,
onda nema potrebe ni za kakvim drugim izvorom. Ako imate direktno saznanje, onda nema
potrebe za zakljuivanjem ili za reima prosvetljenih ljudi, vi sami ste postali prosvetljeni.
Onda moete odbaciti druga dva izvora. Ali ako se to nije dogodilo, onda moe pomoi
zakljuivanje, ali zakljuivanje e biti vae. Ako ste ludi, onda e va zakljuak biti lud. Onda
je vredno pokuati s treim izvorom - s reima prosvetljenih.
Ne moete ih dokazati, ne moete ih ni opovrgnuti. Samo moete imati poverenje, a to
poverenje je hipotetino; ono je vrlo nauno. U nauci takoe ne moete napredovati bez
hipoteza. Ali hipoteze nisu verovanja. To je samo radna klasifikacija. Hipoteze su samo
usmerenje; moraete da eksperimentiete. Ako se eksperiment pokae ispravnim, onda
hipoteza postaje teorija. Ako eksperiment ispadne pogrean, onda se hipoteza odbacuje. Rei
prosvetljenih ljudi treba da se uzmu na poverenje, kao hipoteze. Onda ih primenite u svom
ivotu. Ako se pokau istinitim, onda su hipoteze postale verodostojne; ako se pokau
54
neistinitim, onda hipoteze treba da budu odbaene.
Odete kod Bude. On e rei: "ekaj! Budi strpljiv, meditiraj, i za dve godine nemoj
postaviti nikakvo pitanje." To morate preduzeti na poverenje; nema drugog puta.
Moete misliti: "Ovaj ovek me moda samo obmanjuje. Onda su dve godine mog
ivota izgubljene. Ako se posle dve godine pokae da je ovaj ovek bio samo hokus-pokus,
samo varalica, ili je u samoobmani - u iluziji da je postao prosvetljen - onda su moje dve
godine izgubljene." Ali ne postoji drugi put. Morate rizikovati. Ako bez poverenja u Budu
ostanete tu, ove dve godine e biti beskorisne - jer dok nemate poverenje ne moete raditi. A
rad je tako naporan da samo ako imate poverenje moete napredovati u njemu u celosti,
potpuno u njemu. Ako nemate poverenje, onda stalno odbijate neto. A to odbijanje nee vam
dopustiti da iskusite ono to Buda nagovetava.
Rizik postoji, ali sam ivot je rizik. Za vii ivot, vii e biti rizik. Vi se kreete
opasnom stazom. Ali zapamtite, postoji samo jedna greka u ivotu, a to je ne pokretati se
uopte, to je samo strah, sedeti, potpuno uplaeni da neto moe krenuti nepovoljno, tako da
je bolje ekati i sedeti. Ovo je jedina greka. Neete biti u opasnosti, ali rast nee biti mogu.
Patanjali kae da postoje stvari koje ne znate, ima stvari koje vaa logika ne moe
zakljuiti. Morate primiti na poverenje. Zbog ovog treeg izvora, guru, uitelj, postaje
neophodan, neko ko zna. Morate preuzeti ovaj rizik, i kaem da je to rizik jer ne postoji
garancija. Cela stvar moe da se pokae samo kao gubitak, ali bolje je prihvatiti rizik, jer ak i
da dokaete da bilo beskorisno, nauili ste mnogo. Sada nijedna druga osoba nee moi da vas
obmane tako lako. Barem ste toliko nauili.
Ako se kreete s poverenjem, ako se kreete sasvim sledei Budu kao senka, stvari
mogu zapoeti da se deavaju, jer su se one deavale ljudima; ovom Gautama Budi, Isusu,
Mahaviru. One su se dogaale i oni znaju stazu; oni su je proli. Ako raspravljate s njima,
biete gubitnik. Oni ne mogu biti gubitnici. Oni e vas jednostavno ostaviti po strani.
U ovom veku to se dogodilo sa Gurijevom. Tako mnogo ljudi bilo je privueno k
njemu, ali on je kreirao takvu situaciju za nove uenike da dok oni nisu verovali potpuno,
morali su da odustanu odmah - dok ne budu verovali ak i u besmislice. A te besmislice su
bile planirane. Gurijev bi stalno lagao. Ujutru bi rekao neto, poslepodne bi rekao neto
drugo. A vi niste stigli ni da pitate! On bi razbio va logiki um potpuno.
Ujutru bi on rekao: "Kopaj rupu. I to se mora. Do veeri ovo mora biti zavreno." I
celog dana biste to kopali. Vi ste se trudili, umorni ste, preznojiete se, niste uzimali hranu, a
predvee on bi doao i rekao: "Vrati ovu zemlju u rupu! To morate zavriti pre nego to odete
u krevet."
Dakle, ak i jedan obian um e rei: "Kako to mislite? Ceo dan sam izgubio. Mislio
sam da je ovo neto vrlo bitno, do uvee je trebalo da bude zavreno, a sada kaete: "Bacaj
zemlju natrag!" Ako biste pitali takvu stvar, Gurijev bi rekao: "Jednostavno odustanite! Idite
odmah! Ja nisam za vas; vi niste za mene."
Nije stvar u rupi ili kopanju. Ono to on isprobava je da li moete imati poverenje u
njega ak i kada je on apsurdan. A jednom kada zna da mu moete verovati, da se moete
kretati s njim gde god on vodi, samo tada e uslediti prave stvari. Onda je ispit zavren, vi ste
isprobani i utemeljeni istinski - kao pravi tragalac koji moe raditi i koji moe imati
poverenje. A onda prave stvari mogu da vam se dogode, nikada ranije.
Patanjali je uitelj, a ovaj trei izvor on zna vrlo dobro kroz svoje vlastito iskustvo sa
hiljadama i hiljadama uenika. Mora da je radio s mnogima, mnogim uenicima i tragaocima,
samo onda je mogue napisati takvu raspravu kao to su Joga Sutre. To nije od mislioca. To je
od onoga ko je eksperimentisao s mnogim tipovima umova i koji je pronikao u mnoge slojeve
umova, svakog tipa osobe sa kojim je radio. Ovo je on nainio treim izvorom: rei
probuenih ljudi.
Druga sutra:
Pogreno znanje je pogreno poimanje koje ne odgovara stvarima kakve jesu.
Jo neke definicije e pomoi razumevanju definicije viparyaye - neispravnog znanja.
Pogreno znanje je netano shvatanje neega to ne odgovara stvari kakva ona jeste. Svi mi
imamo veliko breme pogrenog znanja jer pre nego to se susretnemo s injenicom, mi ve
55
imamo predubeenja.
Ako ste hindus i neko vam je predstavljen, i reeno vam je da je on musliman, odmah
imate pogreno gledite da taj ovek mora biti nepodesan. Ako ste hrianin i neko vam je
predstavljen kao Jevrejin, neete pokuavati da zaista upoznate tog oveka; neete ulaziti u
tog odreenog oveka. Rekavi vam da je "Jevrejin", vaa predrasuda je ula unutra; ve znate
tog oveka. Sada nije potrebno upoznavati ga, znate koji je to tip oveka - Jevrejin.
Imate predubeenja, pristrasan um, a taj pristrasan um vam daje pogreno znanje.
Jevreji nisu loi. Niti su svi hriani dobri, niti su svi muslimani loi. Niti su svi hindusi dobri.
Zaista, dobrota i ravost ne pripadaju nijednoj rasi, to pripada osobama, individuama. Moe
biti loih muslimana, loih hindusa; dobrih muslimana, dobrih hindusa. Dobrota i ravost ne
pripadaju nijednoj naciji, nijednoj rasi, nijednoj kulturi, to pripada pojedincima, linostima.
Ali teko je suoiti se s osobom bez ikakve predrasude. A samo tada ete imati ispravan uvid.
Jednom se to meni dogodilo. Putovao sam. Uao sam u moj kupe. Mnogi ljudi su doli
da me isprate, pa je osoba koja se sedela u kupeu, drugi putnik, odmah dotakla moja stopala i
rekla: "Vi mora da ste veliki svetac. Toliko mnogo ljudi je dolo da vas isprati!"
Onda sam rekao tom oveku: "Ja sam musliman. Moda sam veliki svetac, ali sam
musliman." On je bio okiran! Dodirnuo je muslimanu stopala, a bio je Brahmin! Poeo je da
se znoji, bio je nervozan. Pogledao me je ponovo i rekao: "Ne, vi se alite." Samo da bi uteio
sebe rekao je: "Vi se alite." "Ne alim se. Zato bih se alio? Morali ste da se raspitate pre
nego to ste dotakli moja stopala!"
Onda smo bili zajedno u kupeu. esto me je posmatrao i uzdisao duboko. Razmiljao
je verovatno da ode i da se okupa. Ali nije se sukobljavao sa mnom. Ja sam tu, a on se bavio s
konceptom "muslimana", on je bio Brahmin, postao je neist dodirujui me.
Niko se ne sukobljava sa stvarima, osobama, kakve one jesu. Vi imate predrasude.
Ove predrasude stvaraju viparyayu; ove predrasude stvaraju pogreno znanje. ta god da
mislite, ako niste neposredno doli do injenica to e biti pogreno. Ne unosite svoju prolost,
ne unosite svoje predrasude. Odloite na stranu svoj um i suoite se s injenicom. Samo vidite
ma ta da gledate. Nemojte projektovati svoje zamisli.
Stalno projektujemo zamisli. Na um je potpuno ispunjen i fiksiran od samog
detinjstva. Sve nam je dato na gotovo, a kroz to unapred dato znanje itav na ivot postaje
jedna iluzija. Nikada ne susreete stvarnu osobu, nikada ne vidite pravi cvet. im ujete:
"Ovo je rua" vi mehaniki kaete: "Divno". Niste osetili lepotu; niste saznali lepotu; niste
dodirnuli cvet. Ali, "Rua je lepa" je samo u vaem umu; onog momenta kada ujete "rua",
um projektuje misao na nju i kae: "Lepa je!"
Moete verovati da ste stekli oseanje da je rua lepa, ali to nije tako. To je lano.
Samo pogledajte. Zbog toga deca dolaze do stvari mnogo dublje nego odrasli ljudi - jer ona ne
znaju imena. Ona jo nisu pristrasna. Ako je rua lepa, onda e samo ona biti lepa; sve rue
nisu lepe. Deca prilaze blie stvarima, njihove oi su iste i neiskusne. Ona vide stvari kakve
jesu jer ne znaju kako da projektuju misli.
Ali mi smo uvek u urbi da ih uinimo odraslim, da ih uinimo punoletnim. Punimo
njihov um sa znanjem, informacijama. Ovo je jedno od najveih nedavnih otkria psihologa,
da kada deca krenu u kolu ona su inteligentnija nego kada napuste univerzitet. Poslednja
otkria to dokazuju. U prvi razred, kada deca uu, ona su vie inteligentna. Imae manje i
manje inteligencije kako rastu u znanju.
Vremenom kada postanu diplomci, magistri i doktori, oni su dokrajeni. Kada se vrate
sa doktorskom diplomom, ostavili su svoju inteligenciju negde na univerzitetu. Oni su mrtvi,
ispunjeni znanjem, pretrpani znanjem, ali to znanje je lano - predubeenja o svemu. Sada ne
mogu oseati stvari direktno, ne mogu oseati ive osobe direktno, ne mogu iveti direktno,
sve je postalo verbalno, reito. To sada nije realno; to je postalo mentalno.
Pogreno znanje je lana koncepcija, koja ne odgovara stvarima kakve jesu.
Stavite na stranu svoje predrasude, znanje, koncepcije, preformulisane informacije, i
gledajte istim pogledom, nevino, postanite opet dete. A to treba da se radi svakog trenutka,
jer svakog trenutka vi ih sakupljate.
Jedan od najstarijih joga aforizama je: umiri svakog trenutka tako da moe biti roen
56
svakog trenutka. Umri svakog trena za prolost, odbaci svu prainu koju si sakupio, i
posmatraj iznova. Meutim, ovo treba da se ini neprekidno, jer sledeeg momenta praina se
ponovo nakupila.
Nan-in je bio u potrazi za Zen uiteljem kada je bio tragalac. iveo je sa svojim
uiteljem mnogo godina, a onda je uitelj rekao: "Sve je u redu. Skoro si postigao." Ali je
kazao: "skoro", pa je Nan-in pitao: "ta vam to znai?" uitelj je odgovorio: "Morau da te
poaljem na nekoliko dana kod drugog uitelja. To e ti dati poslednji zavrni in."
Nan-in je bio veoma uzbuen. Rekao je: "Poaljite me odmah!" Dato mu je pismo. A
on je bio tako uzbuen, mislio je da je poslat kod nekoga ko je vei uitelj nego to njegov
sopstveni. Ali kada je stigao do tog oveka, on nije bio niko, samo uvar jedne krme, vratar
jedne gostionice.
Oseao je veliko razoarenje pa je pomislio, "Ovo mora biti neka vrsta ale. Ovaj
ovek e biti moj poslednji uitelj? On e mi dati zavrni dodir?" Ali poto je ve doao,
pomislio je: "Bolje da ostanem ovde nekoliko dana, barem da se odmorim, onda u se vratiti
natrag. Ovo je bilo dugako putovanje." Tako je rekao uvaru: "Moj uitelj mi je dao ovo
pismo."
Onda je uvar krme rekao: "Ali ja ne mogu da itam, tako da moe zadrati tvoje
pismo, ono nije potrebno. A ti moe biti ovde." Nan-in je rekao: "Ali ja sam poslat da
nauim neto od tebe."
uvar krme je rekao: "Ja sam samo jedan uvar, nisam majstor, nisam uitelj. Moda
je dolo do nekog nesporazuma. Moda ste doli kod pogrene osobe. Ja sam uvar, ne mogu
poduavati, ne znam nita. Inae kad si ve doao, moe samo da me posmatra. To moe da
bude korisno. Odmaraj se i posmatraj."
Meutim nije bilo niega da se posmatra. Ujutru bi otvorio vrata krme. Gosti bi doli
a on bi istio njihove stvari - lonce, potreptine i sve - i sluio bi ih. Nou opet, kada bi svi
otili, a gosti otili da spavaju u svojim krevetima, on bi opet istio stvari, lonce, potreptine,
sve. I ujutru opet isto.
Ali treeg dana Nan-inu je bilo dosadno. Rekao je: "Nema ta da se posmatra. Stalno
isti potreptine, stalno obavlja uobiajene poslove, tako da moram otii." uvar se smejao,
ali nije rekao nita.
Nan-in se vratio natrag, mnogo je bio ljut na svog majstora pa je rekao: "Zato, zato
ste me poslali na tako daleko putovanje, bilo je muno, a taj ovek je samo uvar? Nije me
nauio niemu, jednostavno je rekao: 'Posmatraj', a nije imalo ta da se posmatra."
Tada je majstor rekao: "Ipak, bio si tamo tri-etiri dana. ak i ako nije imalo ta da se
posmatra, mora da si posmatrao. ta si radio?" On je odgovorio: "Posmatrao sam. Nou bi
istio upotrebljene lonce, stavljao je sve tamo, a ujutru je ponovo istio."
Majstor je rekao: "To je uenje! To je ono zbog ega si bio poslat! On je istio te lonce
nou, ali ujutru je opet istio te iste lonce. ta to znai? ak i tokom noi, kada se nita nije
dogaalo, oni su postali opet neisti, neto praine je opet palo. Dakle, moe biti ist, sada i
jesi. Moe biti bezazlen, ali svakog trenutka mora nastaviti ienje. Moe da ne radi
nita, a ipak postaje neist samo od prolaenja vremena. Iz trenutka u trenutak, samo
prolaenjem, ne radei nita, samo sedenjem ispod drveta, ti postaje neist. Ta neistoa nije
zato to si ti neto radio loe ili neto pogreno, to se deava samo prolaenjem vremena.
Praina se sakuplja. Stoga mora stalno da se isti, i to je taj poslednji dodir, jer oseam da si
postao ponosan to si ist, i sada se ne brine za konstantan napor ienja."
Iz trenutka u trenutak ovek mora da umire i da se ponovo raa. Samo onda ste
slobodni od pogrenog znanja.
Tree:
Lik, zazivan neprekidno reima bez ikakve sutine u njegovoj pozadini, je vikalpa -
imaginacija.
Imaginacija nastaje samo kroz rei, verbalne strukture. Vi kreirate stvar - ona nije tu,
ona nije realnost. Ali vi je kreirate kroz vae mentalne likove. I moete stvarati to do takvog
opsega da postanete obmanuti od nje i mislite da je realna. Ovo se dogaa u hipnozi.
57
Hipnotiete osobu i kaete ta god hoete; ona priziva taj lik, i on postane realan. Vi to moete
uraditi. To inite na mnogo naina.
Jedna od najuvenijih amerikih glumica, Greta Garbo, napisala je u svojim
memoarima. Bila je jedna obina devojka, ba jednostavna, obina devojka, vrlo siromana i
radila je u berbernici samo za nekoliko novia, stavljala je sapun na lice muterija. Radila je
to tri godine.
Jednog dana jedan ameriki filmski reiser bio je u toj berbernici, i ona je stavila
sapun na njegovo lice, i kao to to amerikanci ine - on moda nije ni mislio o tome -
jednostavno je pogledao u ogledalo, odraz devojke i rekao: "Kako je lepa!" Upravo tog
momenta Greta Garbo je roena!
Ona je pisala: iznenada je postala drugaija; nikada nije mislila o sebi da je lepa; nije
mogla to da pojmi. Nikada nije od nikoga ula da je lepa. Po prvi put ona je takoe pogledala
u ogledalo i lice joj bilo razliito - taj ovek ju je uinio lepom. I itav ivot se promenio.
Sledila je tog oveka i postala je jedna od najuvenijih filmskih glumica.
ta se dogodilo? Samo hipnoza, hipnoza kroz re "lepa" - delovala je. To deluje, to
postaje hemija. Svako veruje neto o sebi. To verovanje postaje stvarnost, jer verovanje
zapoinje delovati na vas.
Imaginacija je sila. Ali to je prizvana, zamiljena sila. Moete je koristiti i moete biti
iskorieni od nje. Ako moete da je koristite, ona e postati korisna, a ako ste korieni od
nje, ona je fatalna, ona je opasna. Mata moe da postane ludilo svakog momenta; imaginacija
moe biti korisna ako kroz nju stvarate situaciju za va unutranji rast i kristalizaciju.
Kroz rei se prizivaju stvari. Za ljudska bia rei, jezik, verbalne konstrukcije postale
su znaajne toliko da sada nita nije znaajnije. Ako iznenada neko kae: 'Vatra', re 'vatra'
odmah e vas promeniti. Moda nema vatre, ali vi ete prestati da me sluate. Nee biti
napora da se stane; iznenada ete prestati da me sluate, poeete da trite tamo-amo. Re
'vatra' obuzela je matu.
Na vas rei utiu na taj nain. Ljudi u poslovima oglaavanja znaju koje rei da koriste
da bi prizvali slike. Kroz ove rei mogu da vas dohvate, mogu zarobiti celo trite. Ima
mnogo takvih rei. Oni ih stalno menjaju sa modom.
Zadnjih nekoliko godina re "novo" je ovladala. Tako sve, ako pogledate oglase, jeste
"novo" - "novi" Lux sapun. "Lux sapun" nee delovati. "Novi" privlai odmah. Svako je za
novo; svako traga za novim, neim novim, jer svakome je dosadno sa starim. Tako sve novo
ima privlanost. To moda nee biti bolje od starog, moe biti gore, ali sama re "novo"
otvara vidike u umu.
Ove rei i njihov uticaj treba duboko razumeti. Jer osoba koja je u potrazi za istinom
mora biti svesna uticaja rei. Politiari, ljudi u oglaavanju, koriste rei i mogu kreirati kroz
rei takvu imaginaciju da moete dati svoj ivot - moete odbaciti svoj ivot samo za rei.
Koje su to rei "Nacija", "nacionalna zastava" - samo rei! "Hinduizam" - moete rei:
"hinduizam je u opasnosti" i iznenada mnogi ljudi su spremni da uine neto ili ak da umru.
Samo nekoliko rei. Naa nacija je uvreena. ta je "naa nacija"? Samo rei. Zastava nije
nita drugo do komad platna, ali cela nacija moe umreti za zastavu jer je neko uvredio
zastavu, ponizio je. Kakve besmislice se deavaju u svetu zbog rei! Rei su opasne. One
imaju duboke izvore uticaja unutar vas. One aktiviraju neto u vama, i moete biti zarobljeni.
Mata mora da se razume kae Patanjali, jer na putu meditacije rei e biti odbaene
tako da uticaj od drugih moe biti odbaen. Zapamtite, rei su nauene od drugih; vi niste
roeni s reima. Njima su vas nauili, a kroz rei i mnogim predrasudama. Kroz rei religija,
kroz rei mitova - sa svim tim ste napunjeni. Re je medijum, vozilo kulture, drutva,
informacija.
Ne moete pobuditi ivotinje da se bore za naciju. Ne moete zato to one ne znaju ta
je "nacija". Zbog toga nema ratova u ivotinjskom carstvu. Ne postoje ratovi, nema zastava,
nema hramova, nema damija. Ako bi ivotinje mogle pogledati u nas bile bi prinuene da
misle da ljudi imaju neku opsesiju s reima, jer ratovi nastaju oko njih, milioni bivaju ubijeni
samo zbog rei.
Neko je Jevrejin, "Ubij ga" - samo zbog rei 'Jevrejin'. Promeni etiketu, on postane
58
hrianin, onda ga ne treba ubiti. Ali on nije spreman da promeni etiketu. On e rei: "Neka
me i ubiju ali neu promeniti svoju etiketu. Ja sam Jevrejin." On je takoe vrst u svom
ubeenju, kao i drugi. Ali to su samo rei.
an Pol Sartr je napisao svoju autobiografiju i dao joj je naslov: "Rei". To je divno
jer to se tie uma itava biografija svakog uma sastoji se samo od rei i niega drugog.
Patanjali kae da ovek treba da bude svestan ovoga, jer na stazi meditacije, rei treba da
budu ostavljene u pozadini. Nacije, religije, spisi, jezici, moraju biti ostavljeni iza i ovek
mora da postane bezazlen, slobodan od rei. Kada ste slobodni od rei nee biti mate, a kada
nema imaginacije vi se moete suoiti sa istinom. Inae, nastaviete da je stvarate.
Ako doete da se sretnete s Bogom, morate ga sresti bez ikakvih rei. Ako imate neke
rei, on moda nee pristajati i odgovarati vaoj ideji. Jer ako hindus misli da on ima hiljadu
ruku, a Bog doe samo sa dve ruke, hindus e ga odbaciti: "Ti nisi uopte Bog. Samo s dve
ruke? Bog ima hiljadu ruku. Pokai mi svoje druge ruke. Samo onda ti mogu verovati."
To se dogodilo. Jedna od najlepih osoba iz prolog stolea bio je Sai Baba iz irdija.
On je imao prijatelje i sledbenike. Sai Baba je bio musliman. Niko nije znao da li je bio
musliman ili hindus, ali je iveo u damiji pa se zato verovalo da je musliman. Sledbenik
hindus je bilo tamo, voleo ga je i potovao, imao mnogo vere u Sai Babu. Svakog dana bi
dolazio za svoj daran, ne bi otiao dok ga ne vidi. Ponekad se dogaalo da bi ekao celog
dana, ali bez vienja on ne bi odlazio, a ne bi uzimao ni hranu dok ne bi video Sai Babu.
Jednom se dogodilo da je ceo dan proao, mnotvo se sakupilo i velika gomila - a on
nije mogao da ue. Kada su svi otili, uvee, on je dodirnuo njegova stopala.
Sai Baba mu je rekao: "Zato nepotrebno eka? Nije nuno da me vidi ovde, ja
mogu doi tamo. Prekini sa tim od sutra. Sada u ja delovati. Pre nego to uzme hranu
videe me svakog dana."
Uenik je bio vrlo srean. Tako da je sledeeg dana ekao i ekao, nita se nije
dogodilo. Mnoge stvari su se dogodile stvarno, ali nita se nije dogodilo prema njegovoj
koncepciji. Do veeri je postao vrlo srdit. Nije uzeo hranu, a Sai Baba se nije pojavio pa je
opet ekao. Rekao je: "Obeao si, a nisi ispunio obeanje?"
Sai Baba je rekao: "Ali ja sam se pojavio tri puta, ne samo jednom. Prvi put kada sam
doao, bi sam prosjak a ti si mi rekao: "Skloni se dalje! Ne dolazi ovamo!" Drugi put kada
sam doao bio sam starica, a ti nisi hteo da me pogleda, zatvorio si oi" - jer sledbenici imaju
naviku da ne gledaju ene; on je praktikovao ne gledanje ene, stoga je zatvorio oi. Sai Baba
je rekao: "Ja sam dolazio, ali ta si ti oekivao? Treba li da uem u tvoje oi, zatvorene oi?
Stajao sam tamo, ali ti si zatvorio oi. Onog momenta kada si me ugledao, zatvorio si oi.
Onda sam trei put doao kao pas, a ti mi nisi dozvolio da uem unutra. Sa tapom si stajao na
vratima."
Te tri stvari su se dogodile. I ove tri stvari se dogaaju celom oveanstvu. Boansko
dolazi u mnogim oblicima, ali vi imate predubeenja; imate unapred stvorene koncepcije; ne
moete videti. Bog mora da se pojavi saglasno s vaim oekivanjima, a on se ne pojavljuje
nikada u saglasnosti s vama. On se nikada nee pojaviti prema vaim oekivanjima. Vi ne
moete postavljati pravila za njega i ne moete postavljati nikakve uslove.
Kada sve zamisli otpadnu, samo tada se istina pojavljuje. Jer zamisli stalno stvaraju
uslove i istina kakva jeste ne moe se pojaviti. Samo u otvorenom umu, samo u golom,
praznom umu, istina se javlja, jer je tada vi ne moete izobliiti.
etvrta sutra:
Modifikacija uma koja je zasnovana na odsustvu ma kakvog sadraja u njemu, jeste
spavanje.
Ovo je definicija spavanja u dubokom snu, etvrte modifikacije uma, kada ne postoji
sadraj. Um je uvek sa sadrajem, izuzev dubokog sna bez snova. Neto je uvek tu. Neka
misao se kree, neka strast se kree, neka elja se kree, neko seanje, neka budua zamisao,
neka re, neto se kree. Neto se nastavlja neprekidno.
17
Samo kada vrsto zaspite, u
17
Svo to kretanje je od prakrti, prirode, to ona samu sebe osmiljava pod privlanim dejstvom Duha u nama. Sve
misli su od prakrti, nisu nae. Mi ih samo koristimo i identifikujemo se sa njima.
59
dubokom snu, sadraji prestaju. Um iezava, a vi ste u sebi bez ikakvog sadraja.
Ovo treba zapamtiti jer e takvo biti takoe stanje samadhija, samo s jednom
razlikom: vi ete biti svesni. U dubokom snu, vi ste nesvesni, um odlazi potpuno u
nepostojanje. Vi ste sami, ostali ste sami - nema misli, samo vae bie. Ali niste svesni. Um
nije tu da vam smeta, ali vi niste svesni, budni.
Inae spavanje moe biti prosvetljenje. Besadrajna svest je tu, ali svesnost nije
aktuelna, budna. Ona je skrivena - ba kao seme. U samadhiju seme je niklo, svest postaje
aktuelna, budna. A kada je svesnost aktuelna i budna a nema sadraja, to je cilj. Spavanje
sa sveu je cilj.
18
Ovo je etvrta modifikacija uma - dubok san. Ali taj cilj, spavanje sa svesnou, nije
modifikacija uma, to je izvan uma. Svest je iza uma. Ako moete spojiti spavanje bez snova i
svesnost zajedno, vi ste postali prosvetljeni. Meutim to je teko, jer i kada smo budni tokom
dana mi nismo svesni. ak i kada smo budni na javi, mi nismo budni. Re je netana. Kada
spavamo, kako moemo biti budni? Kada smo budni mi nismo probueni.
Stoga morate poeti na javi, kada ste budni po danu. Morate biti vie probueni, vie i
vie, jae probueni. Onda treba da pokuate sa snovima, dok sanjate morate biti budni. Samo
ako uspete sa budnim stanjem, na javi, zatim sa stanjem sanjanja, onda ete moi da uspete sa
treim stanjem dubokog sna bez snova.
Pokuajte prvo s budnou na ulici. Probajte da budete budni. Samo ne hodajte uvek
automatski, mehaniki. Budite paljivi, svesni svakog pokreta, svakog daha koji uzmete.
Izdahnite, udahnite - budite budni. Svakog pokreta oiju koji nainite, svake osobe u koju
pogledate, budite svesni. Sve to radite, budite budni i radite to sa svesnou.
A onda tokom noi, dok se uspavljujete, pokuajte da ostanete budni. Poslednja faza
dana e prolaziti, seanja e ploviti. Ostanite budni, i pokuajte da se uspavate sa budnou.
To e biti teko, ali ako pokuate, unutar nekoliko sedmica, imaete kratko iskustvo: vi ste
uspavani i budni. Makar za jedan trenutak, a to je tako lepo, tako ispunjeno blaenstvom, da
nikada neete opet biti isti.
A onda vie neete govoriti da je spavanje samo gubljenje vremena. To moe postati
najdragocenija sadhana, jer kada budno stanje odlazi i spavanje zapone, postoji promena,
promena brzine unutra. To je ba kao promena brzine u autu. Kada menjate brzinu od jedne
do druge, za jedan trenutak, izmeu te dve brzine, postoji neutralan hod, nema zupanika. Taj
trenutak neutralnosti je vrlo znaajan.
Isto se dogaa u umu. Kada se od budnog stanja kreete prema spavanju, postoji
trenutak kada ste niti budni niti uspavani. U tom trenutku ne rade zupanici, mehanizam ne
funkcionie. Vaa automatska linost je ponitena u tom trenutku. U tom trenutku vae stare
navike nee vas prisiljavati na odreene obrasce. U tom trenutku moete pobei i postati
budni.
Ovaj trenutak se u Indiji nazivao sandhya, trenutak izmeu. Postoje dve sandhye, dva
meu-momenta: jedan uvee kada idete od budnosti do spavanja, a drugi ujutru kada se opet
kreete od spavanja do budnosti. Ova dva trenutka hindusi su nazvali trenucima molitve,
sandhyaka - period izmeu jer onda vaa linost nije tu za jedan trenutak. U tom jednom
trenutku vi ste isti, bezazleni. Ako u tom trenutku moete postati svesni, ceo va ivot e se
promeniti. Postavili ste osnovu za preobraaj.
Zatim pokuajte da u stanju sanjanja budete budni. Postoje metode kako da budete
budni u stanju sanjanja. Uradite jednu stvar, ako elite da pokuate... Prvo pokuajte u
budnosti, onda ete moi da uspete u sanjanju. Jer sanjanje je dublje, vei napor e biti
potreban. I teko je takoe, jer ta da se radi u snu i kako to da se radi?
Za sanjanje Gurijev je razvio lepu metodu. To je jedna od tibetanskih metoda, a
18
Drugim reima: budnost za vreme sna koji sainjava ovaj svet. To je svrha inkarnacija dua. Izvan roenja u
telu, izmeu inkarnacija, due su u svom autentinom stanju (svarupa - vidi Joga sutre 1.3). Raaju se u ovaj
svet iluzije individualnosti i odvojenosti da bi se ovde probudile za ono to uvek jesu. Na taj nain Boansko,
ije su due samo emanacije, postaje aktuelno u svim planovima svoga postojanja. Zato je u naem ivotu pojava
lucidnih snova ili vantelesnih iskustava vrlo vana kao obuka na tom putu buenja. Zapravo iskustva buenja u
snu se sama prva pojavljuju kao posledica ispravne meditacije.
60
tibetanski tragaoci su vrlo duboko istraivali svet snova. Metoda je: za vreme padanja u san
pokuavate da zapamtite jednu stvar, bilo koju stvar, samo cvet rue. Samo vizualizujte ruin
cvet. Nastavite da razmiljate da ete videti to u snu. Vizualizujte to i nastavite da mislite o
tome u snu, ta god da sanjate, ruin cvet mora biti prisutan. Vizualizujte njene boje, njen
miris - sve. Oseajte je tako da postane iva u vama. I sa tom ruom, padnite u san, zaspite.
Za nekoliko dana uspeete da unesete cvet u svoj san. Ovo je veliki uspeh jer sada ste
stvorili barem deo sna. Sada ste majstor. Barem je doao jedan deo sna, cvet. Onog momenta
kada vidite cvet, vi ete se odmah setiti da je to san.
Nita drugo nije potrebno. Cvet i "ovo je san" postali su spojeni jer ste stvorili cvet u
snu. I mislili ste neprekidno da se taj cvet pojavi u snu, i cvet se pojavio. Odmah ete
prepoznati da je to san, i itav kvalitet sanjanja e se promeniti, sanjani cvet i sve oko
sanjanja. Postali ste budni.
Onda moete uivati u snu na nov nain, ba kao u filmu, ako elite da zaustavite
sanjanje jednostavno ga moete zaustaviti, odloiti. Ali za to e trebati vie vremena i vie
prakse. Onda moete kreirati svoje vlastite snove. Nije potrebno da budete rtva snova.
Moete stvoriti svoje vlastite snove; moete iveti svoje vlastite snove. Moete imati temu
upravo pre nego to se uspavate; moete reirati svoje snove kao filmski reiser. I moete
kreirati temu iz njih.
Tibetanci su koristili kreirane snove, jer kroz kreiranje sna moete potpuno promeniti
va um, njegovu strukturu. A kada uspete u snovima, onda moete uspeti u dubokom snu bez
snova. Ali za dubok san ne postoji tehnika, jer tamo nema sadraja. Tehnika moe delovati
samo sa sadrajem. Zato ako nema sadraja, nijedna tehnika ne moe pomoi. Ali kroz
sanjanje vi ete nauiti sa budete svesni, a ta svesnost se moe preneti u dubok san bez snova.
Poslednja sutra:
Pamenje je prizivanje prolih iskustava.
Ovo su definicije. On razjanjava stvari tako da ih kasnije ne pobrkate. ta je
pamenje? Prizivanje prolih iskustava. Pamenje se neprekidno deava. Kad god vidite
neto, odmah seanje ue unutra i izoblii to. Videli ste me ranije. Vidite me opet, odmah
seanje ue unutra. Ako ste me videli pre pet godina, onda slika od pre pet godina, prola
slika, dolazi u vae oi i ispunjava ih. I videete me kroz tu sliku.
Zbog toga ako odavno niste videli prijatelja, onog momenta kada ga vidite odmah
kaete: "Izgleda vrlo mrav" ili "Izgleda vrlo nezdravo," ili "Izgleda vrlo debelo." Odmah!
Zato? Jer uporeujete; seanje je ulo unutra. Sam ovek nije svestan da je sakupio salo, ili je
postao mrav, ali postaje svestan tako to odmah uporeuje. Prolost, prola slika ue unutra, i
odmah moete uporediti.
I ovo pamenje koje je neprekidno tu, biva projektovano na sve to vidite. Ova seanja
iz prolosti treba da budu odbaena. Ne treba da bude konstantnog meanja u vaem
saznavanju jer vam to ne dozvoljava da znate novo. Uvek znate novo u obrascu starog. To
vam ne dozvoljava da osetite novo, to ini sve starim i ukorenjenim. Zbog ovog seanja,
svakom je dosadno; celom oveanstvu je dosadno. Pogledajte lice bilo ije, njemu je
dosadno, smrtno dosadno. Nema niega novog, nema ekstaze.
Zato su deca tako ekstatina. I za tako male stvari vi ne moete zamisliti kako se ta
ekstaza deava. Samo zbog nekoliko obojenih kamenia na plai ona poinju da pleu. ta se
njima deava? Zato vi ne moete plesati? Jer vi znate da je to samo kamenje; vae seanje je
tu. Za tu decu nema seanja, ovo kamenje je nova pojava - kao da su stigli sa Meseca.
itao sam kada je prvi ovek doao na Mesec svuda u svetu je vladalo uzbuenje. Svi
su gledali TV, ali kada se sve zavrilo, za petnaest minuta svima je bilo dosadno. ta sad da se
radi? ovek hoda na mesecu. Posle samo petnaest minuta, a san da se stigne tamo trajao je
milionima godina... Niko sada nije zainteresovan ta se dogaa.
Sve postaje staro. im neto postane seanje, to postaje staro. Ako biste mogli da
odbacite svoje pamenje! Odbacivanje ne znai da prestajete da se seate, odbacivanje samo
znai prestanak ovog konstantnog meanja. Kada vam treba, moete seanje povui natrag u
sredite panje. Kada vam ne treba, samo ga pustite da bude tu, tiho, bez neprekidnog
61
nametanja.
Prolost, ako je stalno prisutna, nee dozvoliti sadanjosti da postoji. A ako propustite
sadanjost, vi proputate sve.
Poglavlje 6
ISTOTA JOGE
30. decembar 1973.
Pitanje prvo:
Rekli ste da je Patanjalijeva nauka egzaktna nauka, apsolutno logina, u kojoj je
rezultat izvestan kao to dva plus dva ine etiri. Ako postignue nepoznatog i beskonanog
moe biti svedeno samo na logiku, nije li istinito i u isto vreme apsurdno da je beskonani
fenomen unutar orbite konanog uma?
To izgleda apsurdno, to izgleda nelogino, ali egzistencija je apsurdna i egzistencija je
nelogina. Nebo je beskonano, ali se moe reflektovati u vrlo malenoj barici, beskonano
nebo se moe reflektovati u malom ogledalu. Naravno ono celo se nee reflektovati; ne moe
biti reflektovano. Ali deo je takoe celina i deo takoe pripada nebu.
Ljudski um je samo ogledalo. Ako je ist onda beskonano moe biti reflektovano u
njemu. Refleksija nee biti beskonana, bie samo deo, samo delimian uvid. Ali i taj
delimian uvid postaje prolaz. Onda, postepeno, moete ostaviti ogledalo i kroz taj uvid ui u
beskonano, ostaviti refleksiju i ui u realno.
Izvan vaeg prozora, malog okvira prozora, beskonano nebo je tu. Moete gledati
kroz prozor, neete videti celo nebo, naravno, ali koliko god da vidite jeste nebo. Dakle,
jedina stvar koju treba zapamtiti jeste da ne mislite da to to ste videli jeste beskonano. To
moe biti od beskonanog, to nije beskonano. Dakle ta god ljudski um moe shvatiti moe
biti boansko, ali je samo deo njega, jedan uvid. Ako se stalno seate toga, onda nema greke.
Onda uskoro, razbijete okvir, uskoro unitite um potpuno tako da on kao ogledalo vie nije tu,
osloboeni ste od refleksije i ulazite u samu realnost.
Povrno gledano izgleda apsurdno. Kako, u tako malenom umu, moe biti ikakvog
kontakta sa venim, sa beskonanim, sa beskrajnim? Druga stvar treba takoe da se razume.
Ovaj siuni um nije malen zaista, jer je i deo beskonanog. On izgleda malen zbog vas; on
izgleda konaan zbog vas. Vi ste stvorili te granice. Granice su lane. Va maleni um pripada
beskonanom; on je deo njega.
Ima mnogo stvari koje treba razumeti. Jedna od najparadoksalnijih stvari o
beskonanom je ovo: da je deo uvek jednak celini - jer ne moete deliti beskonano. Sve
podele su lane. Moe biti korisno deliti ga. Ja mogu rei da je nebo nad mojom kuom, nad
mojom terasom, moje nebo kao to Indija kae da je nebo iznad indijskog kontinenta indijsko
nebo. ta pod tim mislite? Ne moete deliti nebo. Ono ne moe biti indijsko ili kinesko, ono
je jedno nedeljivo prostranstvo. Nigde ne poinje i nigde se ne zavrava.
Isto se deava sa umom. Vi to nazivate vaim umom; to "vae" je greka. Um je deo
beskonanog. Upravo kao to je materija deo beskonanog, um je deo beskonanog. Vaa
dua je takoe deo beskonanog.
Kada je "moje" izgubljeno, vi ste beskonani. Dakle, ako vi izgledate ogranieni, to je
jedna iluzija. Ogranienja nisu realna, to su samo koncepcije, iluzije. I zbog vae koncepcije
vi ste ogranieni u tome. Ma ta da mislite, vi to postajete. Buda je rekao - i ponavljao je to
neprekidno etrdeset godina - da ta god vi mislite to postajete. Miljenje ini ma ta da jeste.
Ako ste ogranieni, to je stajalite koje ste uzeli. Odbacite to stajalite i postaete beskonani.
Ceo proces joge je kako da se to odbaci - kako da se odbaci okvir, kako da se uniti
ogledalo, kako da se kreete od refleksije do realnosti, kako da odete izvan granica.
62
Granice ste sami stvorili; one stvarno nisu tu. One su samo misli. Zbog toga, kad god
nema misli u umu, vi niste. Um bez misli je bez ega; nerazmiljajui um je bezgranian um,
nerazmiljajui um je ve beskonaan. ak i za jedan trenutak, ako nema misli, vi ste
beskonani - jer bez misli ne moe biti granice; bez misli vi iezavate i boansko se sputa.
Da se bude u mislima, znai da se bude ovek; da se bude ispod misli je da se bude
ivotinja; a da se bude iznad misli je biti boanski. Meutim, logini um e postavljati pitanja.
Logini um e rei: "Kako deo moe biti jednak celini? Deo mora biti manji nego celina. To
ne moe biti jednako."
Uspenski pie, u jednoj od najboljih, u jednoj od nekoliko najboljih knjiga u svetu,
Tertium organum, da deo ne moe samo biti jednak celini, on moe biti ak vei nego celina.
Inae on to naziva viom matematikom. Matematika pripada Upaniadama. U isha vasyi (Ia
upaniada) je reeno: "Moete izvaditi celo iz celog, a jo celo ostaje celo. Moete staviti celo
u celo, a jo celog staje u celom."
19
To je apsurdno. Ako elite da zovete to apsurdom, moete nazvati apsurdom, ali je
realnost, to je via matematika gde se granice gube i kap postaje okean. A okean nije nita
drugo nego kap.
Logika postavlja pitanja, nastavlja da ih postavlja. To je priroda loginog uma, da
postavlja pitanja. Ako nastavite da sledite ta pitanja, moete ii dalje ad infinitum. Ostavite po
strani um - njegovu logiku, njegovo rezonovanje i za nekoliko trenutaka pokuajte da budete
bez misli. ak i za jedan trenutak ako biste mogli postii to stanje bez misli, vi ete shvatiti da
je deo jednak celini, jer iznenada ete videti da su sve granice iezle. One su bile granice iz
sna. Sve podele su iezle, a vi i celina postali ste jedno.
Ovo moe biti samo iskustvo; to ne moe biti logiko zakljuivanje. Ali kada kaem
da je Patanjali logian, ta mislim? U zakljucima niko ne moe biti logian to se tie
unutarnjeg, duhovnog, najvieg iskustva. Ali dok ste na stazi moete biti logini. to se tie
najviih rezultata joge, Patanjali takoe ne moe biti logian; niko ne moe biti. Ali da bi
postigli taj cilj moete da sledite logian put.
U tom smislu Patanjali je logian i racionalan, matematiki nauan. On ne trai
nikakvu veru. On trai samo hrabrost za eksperiment, hrabrost za kretanje, hrabrost da se
skoi u nepoznato. On ne kae: "Veruj, i onda e iskusiti." On kae: "Iskusi, i onda e
poverovati."
On je napravio strukturu kako da se napreduje korak po korak. Njegova staza nije
nasumina, ona nije kao lavirint, ona je kao odlian autoput. Sve je isto i ide se najkraim
moguim putem. Ali morate ga slediti u svakom detalju, inae kretaete se izvan staze i u
divljini.
Zbog toga kaem da je logian, i videete kako je logian. On zapoinje od tela jer vi
ste ukorenjeni u telu. On zapoinje i radi s vaim disanjem, jer vae disanje je va ivot. Prvo
on radi na telu, onda on radi na prani - na drugom sloju egzistencije - vaem disanju; onda
zapoinje da radi na mislima.
Ima mnogo metoda koje zapoinju direktno sa mislima. One nisu tako logine i
naune jer ovek s kojim radite je ukorenjen u telu. On je soma, telo. Nauni pristup mora
zapoeti sa telom. Vae telo prvo mora biti promenjeno. Kada se vae telo menja, onda vae
disanje moe biti promenjeno. A kada se vae disanje promeni, tada vae misli mogu da se
promene. I kada se vae misli promene, onda vi moete biti promenjeni.
Moda niste primetili da ste vi gusto isprepleten sistem od mnogo slojeva. Ako trite,
onda se vae disanje menja jer je potrebno vie kiseonika. Kada trite vae disanje se menja, a
kada se vae disanje menja i vae misli se odmah menjaju.
Na Tibetu kau da ako ste ljuti, onda samo trite. Napravite dva ili tri kruga oko kue,
a onda se vratite natrag da vidite da li je ljutnja prestala - jer ako trite brzo, vae disanje se
menja; ako se vae disanje menja, obrazac vaih misli ne moe ostati isti, on mora da se
promeni.
Nije potrebno da se tri. Moete jednostavno uzeti pet dubokih udisaja - izdahnite,
19
Drugi prevod: Puno je ono, puno je ovo. Iz punoe puno izvire. Od punoe kad se puno uzme, punoa opet
ostaje.
63
udahnite - i vidite gde je vaa ljutnja otila. Teko je promeniti ljutnju direktno. Lake je
promeniti telo, onda disanje, pa onda ljutnju. Ovo je nauni proces. Zbog toga kaem da je
Patanjali naunik.
Niko nije bio tako nauan. Ako odete kod Bude on e rei: "Odbaci ljutnju."
Patanjali nikada nee to rei. On e rei da ako ste ljuti, to znai da imate obrazac disanja
koji pomae ljutnju, i dok se obrazac disanja ne promeni vi ne moete odbaciti ljutnju. Moete
se boriti, ali to nee pomoi - ili, to moe uzeti vrlo dugo vreme. Nepotrebno. Dakle, on e
posmatrati va obrazac disanja, ritam disanja, ako imate odreen ritam disanja, to znai da
imate odreeni telesni stav za to.
Najgrublje je telo, a najsuptilniji je um. Nemojte zapoinjati od suptilnog, jer e to biti
tee. To je nejasno; ne moete shvatiti to. Zaponite sa telom. Zbog toga Patanjali zapoinje
sa poloajima tela.
Moda niste zapazili, jer smo mi tako nesvesni u ivotu, da kad god imate odreeno
raspoloenje u umu vi imate odreeni poloaj tela spojen s njim. Ako ste ljuti, moete li sedeti
oputeno? Nemogue. Ako ste ljuti poloaj vaeg tela e se menjati; ako ste paljivi onda e
se va poloaj tela promeniti; ako ste pospani poloaj vaeg tela e se promeniti.
Ako ste potpuno smireni sedeete kao Buda, hodaete kao Buda. Ako hodate kao
Buda, osetiete izvesnu tiinu kako se sliva unutar vaeg srca. Izvestan tihi most je stvoren
vaim hodom nalik Budi. Samo sednite ispod drveta kao Buda. Samo sedite, samo telesno.
Iznenada ete videti da se vae disanje menja. Ono je mnogo oputenije; ono je mnogo
harmoninije. Kada je disanje harmonino i oputeno, osetiete da je um manje napet. Misli je
manje, manje oblaka, vie prostora, vie neba. Osetiete kako unutra i spolja tee tiina.
Zato kaem da je Patanjali naunik. Ako elite da promenite poloaj tela, Patanjali
e vam rei da promenite svoje navike hrane, jer svaka navika hrane stvara suptilne poloaje
tela. Ako ste mesoder ne moete sedeti kao Buda. Ako niste vegetarijanac va poloaj e biti
razliit, ako ste vegetarijanac va poloaj e biti drugaiji - jer telo je izgraeno od hrane. To
nije sluajnost. ta god da stavite u telo, telo e to odraavati.
Stoga vegetarijanstvo za Patanjalija nije moralistiki kult, to je nauna metoda. Kada
jedete meso vi ne uzimate samo hranu, vi dozvoljavate odreenoj ivotinji, od koje je meso,
da ue u vas. Meso je bilo deo odreenog tela; meso je bilo deo odreenog obrasca instinkta.
Meso je bilo ivotinja samo pre nekoliko sati, i to meso nosi sve impresije ivotinje, sve
navike ivotinje. Kada jedete meso mnoga vaa stanovita i dranja e biti uslovljena njme.
Ako ste senzitivni moete postati svesni da kad god pojedete odreene stvari, odmah
dolaze izvesne promene. Moete uzeti alkohol i onda niste isti. Odmah nova linost stie
unutra. Alkohol ne moe kreirati linost, ali on menja va obrazac tela. Telo je hemijski
promenjeno. Sa promenom hemije tela, um mora da promeni svoj obrazac; a kada um
promeni obrazac nova linost je stigla unutra.
uo sam jednu od najstarijih kineskih pria, da se desilo da je boca rakije pala sa stola
- sluajno; moda je skoila maka. Boca se razbila i rakija se razlila svuda po podu. Nou su
tri mia pila rakiju, jedan mi je odmah rekao: "Sada, idem kod kralja, u palatu, da ga stavim
na njegovo pravo mesto." Drugi je rekao: "Ja se ne brinem za kraljeve. Ja u sam biti car
celog sveta." A trei je rekao: "Radite vi, drugari, ta god elite. Ja idem na sprat da vodim
ljubav sa makom."
itava linost se promenila - mi razmilja da vodi ljubav sa makom? To se moe
dogoditi; to se deava svakog dana. ta god pojedete menja vas, ta god popijete menja vas,
jer telo je veliki deo vas. Devedeset procenata, vi ste vaa tela.
Patanjali je naunik jer on zapaa sve - hranu, poloaje, nain kako spavate, nain
kako ustajete ujutru, kada ustajete ujutru, kada idete da spavate. On uzima sve u obzir tako da
vae telo postane mesto za neto vie.
Onda on obraa panju na vae disanje. Ako ste tuni, vi imate razliit ritam disanja.
Samo to zabeleite. Probajte, moete imati vrlo lep eksperiment. Kad god ste tuni samo
posmatrajte svoje disanje - koliko dugo udiete, a onda koliko dugo izdiete. Samo to
64
zapazite, beleite. Samo brojte unutra; jedan, dva, tri, etiri, pet Brojite do pet i onda je
udisanje zavreno. Onda brojte izdisanje - brojanje dolazi do deset; izdisanje je zavreno.
Samo posmatrajte to tano tako da moete saznati odnos. Onda, kad god oseate sreu, odmah
probajte da diete po tom obrascu tuge - pet, deset. Sva srea e ieznuti.
Obrnuto je takoe istina. Kad god se osea srenim, primeti kako die. I kad god se
osea tunim, probaj taj obrazac. Tuga e odmah nestati, jer um ne moe postojati u
vakuumu. On postoji u sistemu, a disanje je za um najdublji sistem.
Disanje je misao. Ako prestane disati, misli odmah stanu. Pokuaj na sekundu.
Zaustavi disanje. Odmah nastaje pauza u procesu miljenja; proces je prekinut. Miljenje je
nevidljivi deo vidljivog disanja.
To je ono to mislim kada kaem da je Patanjali nauan. On nije pesnik. Ako kae:
"Ne jedi meso", on to ne kae zato to je jedenje mesa nasilje, ne. Kae zato to je jedenje
mesa samodestruktivno. Ima pesnika koji kau da je biti nenasilan lepo; Patanjali kae da
biti nenasilan znai biti zdrav, da je biti nenasilan dobro za tebe. Ne saosea s nekim drugim,
saosea sa sobom.
On je zaokupljen tobom i transformacijom. A ne moe promeniti stvari samo
razmiljanjem o promeni. Mora stvoriti situaciju. Inae, svuda po svetu ljubav se poduava,
ali ljubav nigde ne postoji, jer ne postoji situacija. Kako moe voleti ako si mesoder? Ako
jede meso, tu je nasilje. A s tako dubokim nasiljem, kako moe voleti? Tvoja e ljubav biti
samo lana. Ili, ona moe biti samo oblik mrnje.
Ima jedna stara indijska pria. Hranski misionar prolazio je umom. Naravno, on je
verovao u ljubav, tako da nije nosio puku. Odjednom je spazio tigra kako se pribliava.
Uplaio se. Poeo je misliti: "Sada Jevanelje ljubavi nee delovati. Bilo bi pametno da sam
uzeo puku."
Ali neto se moralo uiniti, i to hitno. Onda se setio da je neko negde rekao da e,
ako tri, tigar krenuti za tobom, i za as e te uhvatiti i ti si mrtav. Ali ako zuri u tigrove oi,
onda postoji mogunost, moda ga impresionira, hipnotie. Moda promeni miljenje. I
postoje prie da su mnogo puta tigrovi promenili miljenje, odunjali su se dalje.
Dakle, vredelo je pokuati, nije bilo koristi od bega. Misionar je zurio. Tigar je priao
blizu. I on je zurio u misionarove oi. Pet minuta stajali su licem u lice, zurei jedan drugome
u oi. Onda je odjednom misionar ugledao udo. Tigar je odjednom sastavio ape i sagnuo se
preko njih u vrlo moliteljskoj pozi - kao da moli.
To je bilo previe! ak ni misionar nije oekivao tako neto - da bi tigar poeo da se
moli. Bio je srean. Ali onda je pomislio: "ta sad uiniti? ta u sad?" Ali, za to vreme je i
on postao hipnotisan, ne samo tigar - tako pomisli: "Bolje da sledim tigra."
I on se sagnuo, poeo moliti. Prolo je jo pet minuta. Onda je tigar otvorio oi i
rekao: "ovee. ta to radi? Ja izgovaram zahvalnicu, ali ta ti radi?" Tigar je bio
religiozan, poboan - ali samo u mislima. U stvari je bio tigar, i bie opet tigar. Doao je da
ubije oveka; izgovara zahvalnicu.
Takvo je stanje kod svih ljudi, celog oveanstva - pobonost samo u mislima; u
delima, ovek ostaje ivotinja. I uvek e biti tako dok se ne prestanemo vezivati za misli i
ponemo stvarati situacije u kojima se misli menjaju.
Patanjali nee rei da je dobro voleti. On e vam pomoi da stvorite situaciju u kojoj
ljubav moe cvetati. Zbog toga kaem da je on nauan. Ako ga sledite korak po korak
videete u sebi mnoge procvate koji su pre bili neshvatljivi, nezamislivi. Nikada niste mogli
niti sanjati o njima. Ako promenite hranu, ako promenite poloaje tela, ako promenite obrasce
spavanja, ako promenite uobiajene navike, videete da se u vama uzdie nova osoba. A onda
su mogue i drugaije promene. Nakon jedne promene i druga promena postaje mogua.
Korak po korak otvara se vie mogunosti. Zbog toga kaem da je on logian. On nije logini
filozof, on je logian, praktian ovek.
Pitanje drugo.
65
Jue ste govorili o zapadnom misliocu koji je poeo sumnjati u sve u to se moe
posumnjati, ali koji nije mogao sumnjati u sebe. Rekli ste da je to veliko postignue u pravcu
otvaranja prema Boanskom. Kako?
Otvaranje prema vioj svesti podrazumeva da u sebi morate imati neto to je
nesumnjivo; to znai oslonac. Morate imati barem jednu pouzdanu taku, u koju ne moete
posumnjati sve i da hoete. Zato sam rekao da je Dekart doao do te take, svojim logikim
istraivanjem doao je do toga da "Ne moemo sumnjati u sebe. Ne mogu sumnjati da ja
jesam, jer ak i da kaem 'ja sumnjam', ja moram biti tu. Sama tvrdnja 'Ja sumnjam' dokazuje
da ja jesam."
Sigurno ste uli uvenu Dekartovu izjavu: Cogito, ergo sum - "Mislim, dakle jesam".
Sumnjanje je miljenje: sumnjam, dakle jesam. Ali to je samo jedan otvor, a Dekart nije
nikada, nikada otiao dalje od tog otvora. Vratio se nazad. Moete se vratiti i sa samih vrata.
On je bio srean to je naao centar, nesumnjivi centar, a onda je poeo da smilja filozofiju.
Tako je sve ono to je ranije negirao uvukao unutra kroz zadnja vrata: "Zato to jesam, mora
postojati i Tvorac koji me stvorio." I tu je zastranio - onda su nebesa i pakao, Bog i greh, i sva
hrianska teologija uli na zadnja vrata.
On je to uzeo kao filozofsko istraivanje. On nije bio jogin; zapravo nije ni bio u
potrazi za svojim biem, bio je u potrazi za teorijom. Ali vi to moete upotrebiti kao otvor.
Otvor znai da ga morate nadii; morate poi dalje; morate to prevazii; morate proi kroz to.
Ne smete se uhvatiti za to. Ako se uhvatite, svaki otvor e se zatvoriti.
Dobro je spoznati da barem "ne mogu sumnjati u sebe". Onda e ispravan korak biti
ovaj: "Ako ne mogu sumnjati u sebe, ako oseam da jesam, onda moram znati ko sam ja."
Tada to postaje pravo istraivanje. Tada zalazi u religiju, jer kada pita: "Ko sam ja?",
postavio si fundamentalno pitanje. Ne filozofsko ve egzistencijalno. Niko ne moe
odgovoriti ko si ti; niko ti ne moe dati unapred pripremljen odgovor. Mora traiti sam u
sebi; morae to iskopati unutar sebe.
Sama logika izvesnost da "Ja jesam" nije od velike koristi ako ne krene napred i
pita: "Ko sam ja?", a to i nije pitanje, to e postati potraga. Pitanje te moe odvesti filozofiji,
potraga te vodi religiji. Tako, ako osea da ne zna sebe, nemoj nikoga pitati "Ko sam ja?"
Niko ti ne moe odgovoriti. Ti si tamo unutra, skriven. Mora prodreti u tu dimenziju u kojoj
jesi, susresti sebe.
To je drugaija vrsta putovanja, unutarnja. Sva naa putovanja su vanjska: gradimo
mostove da stignemo do neeg ili nekog drugog. Potraga znai da mora sruiti sve mostove
ka drugima. Sve to si uinio izvana mora se odstraniti, i neto novo mora biti zapoeto
unutra. To e biti teko, samo zato to si postao tako fiksiran na vanjsko. Uvek razmilja o
drugima; nikada ne razmilja o sebi.
To je udno, ali niko ne razmilja o sebi - svi razmiljaju o drugima. Ako ponekad
razmilja o sebi, to je takoe u odnosu na druge. To nikada nije isto. Naprosto nije samo o
tebi. Onda kada misli samo o sebi razmiljanje se mora prekinuti, jer ta moe misliti? O
drugima moe misliti, misliti znai "o" neemu. ta moe misliti o sebi? Morae prekinuti
razmiljanje i morae pogledati unutra - ne misliti, ve gledati, promatrati, uoavati,
svedoiti. Celi proces e se promeniti. ovek mora traiti sebe.
Sumnja je dobra. Ako sumnja, i ako trajno sumnja, postoji samo jedan fenomen
koji je kao stena, u koji se ne moe sumnjati, a to je tvoje postojanje. Tada e se pojaviti novo
traganje, i to nee biti pitanje. Morae se zapitati "Ko sam ja?"
Ramana Mahari celog svog ivota svojim je uenicima davao samo jednu tehniku.
On bi rekao: "Samo sedni, zatvori oi, i pitaj se 'Ko sam ja?, Ko sam ja?' Koristi to umesto
mantre." To nije mantra. Ne smete to koristiti kao mrtve rei. To mora postati unutarnji
prodor.
Nastavi se pitati to. Tvoj e um mnogo puta odgovoriti da si dua, da si sopstvo, da si
boanski, ali nemoj sluati te stvari, one su sve pozajmljene, te stvari si uo. Ostavi ih po
strani sve dok ne sazna ko si ti. I ako nastavi ostavljati um po strani, jedan dan doi e do
eksplozije. Um eksplodira, i sve pozajmljeno znanje nestaje iz tebe. I po prvi put ti se nalazi
66
licem u lice sa sobom, gledajui unutar sebe. To je otvaranje. I to je put, to je potraga.
Pitaj se ko si ti i ne kai se za jeftine odgovore. Svi odgovori dati od drugih su
bezvredni. Pravi odgovor moe doi jedino iz tebe. Ba kao to pravi cvet moe doi jedino iz
samog stabla, ne moe ga tamo staviti izvana. Moe, ali to e onda biti mrtav cvijet. To
moe zavarati druge, ali nee zavarati samo stablo. Stablo zna da "to je samo mrtvi cvet koji
visi na mojoj grani. On je samo optereenje. To nije srea, to je samo teret." Stablo ga ne
moe slaviti; ne moe ga prihvatiti.
Stablo moe prihvatiti jedino ono to je stiglo iz samog korenja, iz unutarnjeg bia,
najdublje sri. A kada doe iz najdublje sri, cvet postaje dua stabla. I kroz cvet stablo
izraava svoj ples, svoj pev. Njegov celi ivot postaje smislen. Ba tako e odgovor stii iz
tebe, iz tvog korenja. Tada e plesati. Tada e tvoj celi ivot postati smislen.
Ako je odgovor dat izvana on e biti samo oznaka, mrtvi znak. Ako dolazi iznutra,
nee biti znak, bie znaenje. Zapamti ove dve rei - "znak" i "znaenje". Znak moe biti dat
izvana; znaenje moe procvetati samo iznutra. Filozofija se bavi znakovima, konceptima,
reima. Religija se bavi znaenjem. Ona nije zaokupljena reima, znakovima i simbolima.
Ali to e biti jedno mukotrpno putovanje, jer zapravo niko ne moe pomoi, i svi
pomagai su na neki nain prepreke. Ako se neko ponaa previe pokroviteljski i daje vam
odgovor, on je va neprijatelj. Patanjali vam nee dati odgovor, samo e vam naznaiti stazu,
put na kojem e se pojaviti va vlastiti odgovor, na kojem ete susresti odgovor.
Veliki Uitelji davali su samo metode, nisu davali odgovore. Filozofi su davali
odgovore, ali Patanjali, Isus ili Buda, oni nisu davali odgovore. Vi traite odgovore, a oni
vam daju metode, daju vam tehnike. Morate sami pronai odgovor iz sebe, kroz svoje napore,
kroz svoju patnju, kroz svoj prodor, kroz svoju tapascharyu.
20
Samo tako odgovor moe doi,
i on moe postati znaenje. Tako postiete ispunjenje.
Pitanje tree:
Buda je naposletku preneo Mahakajapi ono to nikome drugome nije mogao preneti
reima. Kojoj kategoriji znanja to pripada: neposrednom, zakljuivanju, ili reima
probuenoga? ta je bila poruka?
Najpre, ti pita "ta je bila poruka?" Ako Buda to nije mogao preneti reima, ne
mogu ni ja. To nije mogue.
Ispriau vam jednu anegdotu. Jedan uenik priao je Muli Nasrudinu i upitao ga:
"uo sam da ti poseduje tajnu, konanu tajnu, klju koji otvara sva vrata misterija." Nasrudin
ree: "Da, imam je. Pa ta s tim? Zato pita za nju?" ovek se baci dole pred njegova stopala
i ree: "Traio sam te, Uitelju. Ako ima klju i tajnu, reci je meni."
Nasrudin ree: "To je takva tajna da mora razumeti kako se ona ne moe lako izrei.
Morae ekati." Uenik upita: "Koliko dugo?" Nasrudin ree: "Ni to nije sigurno. Zavisi od
tvog strpljenja - tri godine ili trideset godina." Uenik je ekao. Nakon tri godine pitao je
ponovo. Nasrudin ree: "Ako opet pita, onda e trebati trideset godina. Samo ekaj. To nije
obina stvar. To je konana tajna."
Trideset je godina prolo i uenik ree: "Uitelju, sada je sav moj ivot proao.
Nisam dobio nita. Sada mi daj tajnu." Nasrudin ree: "Pod jednim uslovom: morae mi
obeati da e uvati tajnu, da nee nikome rei." Onda ovjek ree: "Obeavam ti da u
uvati tajnu do smrti. Nikome je neu spomenuti."
Nasrudin ree: "Hvala ti. To je ono to je moj Uitelj i meni rekao. To sam i ja
obeao mome Uitelju. I ako bi je ti mogao uvati do smrti, ta misli, da ja ne mogu uvati
tajnu?"
Ako je Buda bio tih, onda i ja moram biti tih oko toga. Postoji neto to ne moe biti
reeno. To nije poruka, jer poruke se uvek mogu rei. Ako se ne mogu rei, to ne mogu biti
20
Asketski napor, tapas, doslovno znai ar, gorljivost. Vie ukazuje na energiju uloenog truda, predanost
jednom cilju, nego na asketizam sam po sebi.
67
poruke. Poruka je neto izreeno, neto to se govori, to se moe rei. Poruka je uvijek
verbalna.
Buda nije imao poruku; zato je nije mogao ni izrei. Tamo je bilo deset hiljada
uenika. Samo Mahakajapa je dobio jer je mogao razumeti Budinu tiinu. To je tajna tajne.
Mogao je razumeti tiinu.
Jednog jutra je Buda ostao u tiini pod svojim stablom. A zapravo se spremao odrati
besedu, i svi su ekali. Ostao je u tiini, ostao je tih. Uenici su se uznemirili. To se nikada pre
nije dogodilo. On bi doao, i govorio, i otiao. Ali pola sata je prolo. Sunce je izalo, svima
je bilo vrue. Na povrini je vladala tiina, ali se svako iznutra oseao uznemireno, brbljajui
iznutra i pitajui se "Zato je Buda danas tih?"
A on je sedeo tamo ispod svog stabla sa cvetom u ruci i nadalje promatrao cvet, kao
da ak nije ni svestan tih deset hiljada uenika okupljenih da ga uju. Stigli su iz vrlo, vrlo
udaljenih sela. Sakupili su se iz cele zemlje.
Onda neko rekao, neko je skupio hrabrost i rekao: "Zato ne govori? Mi ekamo."
Reeno je da je Buda odgovorio: "Govorim. Ovih pola sata ja sam govorio."
To je bilo previe paradoksalno. Bilo je vie nego apsurdno - on je ostao tih, nije
rekao nita. Ali rei Budi "Ti govori apsurdnosti" nije bilo mogue. Uenici su opet utihnuli -
sada u jo veoj nevolji.
Odjednom se jedan uenik, Mahakajapa, poeo smejati. Buda ga je pozvao blie,
dao mu cvet i rekao: "Sve to moe biti reeno rekao sam drugima, a ono to se ne moe rei
dajem tebi." On mu je samo dao cvet, ali taj cvet je samo simbol. Sa cvetom mu je takoe dao
i odreeno znaenje. Taj cvet je samo znak, no predao mu je i neto to se ne moe preneti
reima.
I vi poznajete odreene oseaje koji se ne mogu preneti. Kada ste u dubokoj ljubavi,
ta radite? Oseaete da je besmisleno ponavljati "Volim te, volim te". Ako to budete previe
govorili, drugome e dosaditi. Ako nastavite ponavljati, drugi e misliti da ste samo papagaj.
Ako nastavite, drugi e misliti da ne znate ta je ljubav.
Kada oseate ljubav, besmisleno je rei da volite. Morate uiniti neto - neto
znaajno. To moe biti poljubac, to moe biti zagrljaj, moete samo uzeti neiju ruku u svoju,
ne radei nita - ali to je puno znaenja. Prenosite neto to se ne moe preneti reima.
Buda je preneo neto to se ne moe preneti reima. Dao je cvet, to je bio dar.
Darovanje je vidljivo; neto nevidljivo preneseno je tim darom. Kada uzmete ruku svog
prijatelja u svoju, to je vidljivo. Samo uzimanje njegove ruke u svoju nema mnogo smisla, ali
neto drugo se prenosi. To je razmena. Prenosi se neka energija, neto to se osea tako
duboko da se reima ne moe izraziti. To je znak; ruka je samo znak. Znaenje je nevidljivo;
ono se prenosi. To nije poruka, to je dar, milost.
Buda je dao sebe, nije dao nikakvu poruku. On je izlio sebe u Mahakajapu. Iz dva
razloga je Mahakajapa postao sposoban to da primi. Jedan je: ostao je potpuno tih dok je
Buda bio tih. I drugi su bili tihi, ali samo prividno, u sebi nisu bili. Neprestano su mislili:
"Zato je Buda tih?" Gledali su se meusobno, gestikulirajui: "ta se dogodilo Budi?
Poludeo je? Nikada nije bio tako tih."
Niko nije bio tih. Samo Mahakajapa, u tom ogromnom skupu od deset hiljada
monaha, bio je tih. On nije imao problema; on nije razmiljao. Buda je posmatrao cvet, a
Mahakajapa je posmatrao Budu. A ne moete pronai velianstveniji cvet od Bude. On je bio
najvii cvet ljudske svesti. Tako je Buda i dalje posmatrao cvet, a Mahakajapa je i dalje
posmatrao Budu. Samo dve osobe nisu razmiljale. Buda nije razmiljao, posmatrao je. Ni
Mahakajapa nije razmiljao, i on je posmatrao. To je bila jedna stvar koja ga je uinila
sposobnim za primanje.
A druga stvar je bila to to se smejao. Ako tiina ne moe postati slavlje, ako tiina
ne moe postati smeh, ako tiina ne moe postati ples, ako tiina ne moe postati ekstaza,
onda je patoloka. Onda e postati tuga. Onda e se pretvoriti u bolest. Onda tiina nee biti
iva, bie mrtva.
Moete postati tihi naprosto tako da postanete mrtvi, ali onda neete primiti Budinu
milost. Onda se Boansko ne moe spustiti u vas. Boansko treba dve stvari: tiinu i razigranu
68
tiinu, ivu tiinu. A u tom trenutku on je bio oboje. Bio je tih, i kada su svi bili ozbiljni, on se
smejao. Buda je izlio sebe; to nije poruka.
Postigni te dve stvari; onda se ja mogu izliti u tebe. Budi tih, i nemoj uiniti tu tiinu
tunom. Dopusti da bude nasmejana i rasplesana. Tiina mora biti poput deteta, puna energije,
vibrantna, ekstatina. Ne smije biti mrtva. Tada, samo tada, ono to je Buda uinio
Mahakajapi moe biti uinjeno tebi.
Sav moj napor je taj da jednog dana neko postane Mahakajapa. Ali to nije poruka.
Pitanje etvrto:
esto ste govorili da je veina spisa puna onog to se zove interpolacija ili umetanje.
Da li Patanjalijeve joga-sutre takoer pate od tog defekta, i kako ete vi postupiti s tim?
Ne, Patanjalijeve joga-sutre su apsolutno iste. Niko nikada nije nita umetnuo u
njih. Postoje razlozi zato se to ne moe uiniti. Prvo, Patanjalijeve yoga-sutre nisu
popularan spis. To nije kao Gita, to nije kao Ramajana, to nije kao Biblija. iroke mase
nikada se nisu zanimale za njega. Kada se iroke mase zanimaju za neto, uine to neistim.
Neminovno je tako, jer se tada spisi moraju odvui dole, na njihov nivo. Patanjalijeve joga-
sutre ostale su samo za znalce. Za njih e se zainteresovati samo nekolicina odabranih. Nee
se svi zainteresovati. I ako sluajno, nekom zgodom, naie na Patanjalijeve joga-sutre,
moi e proitati samo nekoliko stranica i onda e ih baciti. Nije to za tebe. To nije pria, to
nije alegorija. To je jednostavna, nauna rasprava - samo za nekolicinu.
I nain na koji su napisane takav je da e oni koji nisu spremni za njih automatski
okrenuti lea. Slian se sluaj u ovom veku dogodio sa Gurijevim. Tokom trideset godina
pripremao je jednu knjigu. ovek Gurijevog kalibra takvo delo moe napraviti za tri dana.
ak i tri dana bila bi vie nego dovoljna. Lao Ce uinio je tako: ceo Tao Te ing bio je
napisan u tri dana. Gurijev je to mogao uiniti u tri dana; bez potekoa. Ali je trideset
godina pisao prvu knjigu. I ta je uradio? Napisao bi jedno poglavlje, zatim bi dopustio da se
proita pred njegovim uenicima. Uenici bi sluali poglavlje, a on ih je promatrao. Ako
mogu razumeti, promenio bi ga. To je bio uslov: ako mogu razumeti, on e promeniti. Ako bi
video da prate, onda ne valja. Stalno, tokom trideset godina, svako poglavlje proitano je
hiljadu i jedan put, i on je svaki put promatrao. Dok knjiga nije postala potpuno nemogua,
tako da je niko nije mogao itati i razumeti...
ak i vrlo inteligentna osoba morala bi je proitati barem sedam puta; tada bi poeli
stizati bljeskovi znaenja. A i to bi bili samo bljeskovi. Ako bi elela da prodre dalje, onda bi
morala da praktikuje to god je rekao, i kroz praksu znaenje bi postalo jasno. A potreban je
barem jedan celi ljudski ivot da bi se postiglo potpuno razumevanje onoga to je pisao.
Takva vrsta knjige ne moe se interpolirati. Zaista, za njegovu prvu knjigu reeno je
da ju je celu proitalo tek nekoliko ljudi. To je teko - hiljadu stranica. Tako, kada je
objavljeno prvo izdanje, objavljeno je pod jednim uslovom: samo sto stranica, uvodni deo,
bilo je razrezano. Sve druge stranice nisu bile razrezane, i na knjizi je stajalo obavetenje:
"Ako moete proitati prvih sto stranica i nameravate itati dalje, razreite ostale stranice.
Inae vratite knjigu izdavau i uzmite svoj novac nazad."
Reeno je da ima samo nekoliko ivih ljudi koji su knjigu proitali u celosti. Pisana
je na takav nain da e vas zamoriti. Proitati dvadeset-dvadeset i pet stranica, to je dovoljno;
i taj se ovek ini mahnitim.
Ovo su sutre, Patanjalijeve sutre. Sve je saeto u seme. Neko me upitao: "Patanjali
je saeo sutre...", ba neki dan neko je doao i pitao, "...a ti govori tako puno o tim sutrama".
Moram, jer on je od stabla napravio seme, a ja seme opet moram napraviti stablom.
Svaka sutra je kondenzovana, potpuno saeta. Nita ne moe uiniti s njima, niti to
ikoga zanima. To je bila jedna od metoda kako bi se knjiga sauvala istom. A knjiga nije
napisana mnogo hiljada godina, uenici su je samo pamtili; jedni drugima su je predavali kao
seanje. Nije bila napisana, pa joj niko nije mogao nita uiniti. Ona je bila sveto seanje,
sauvano. Pa i kada je knjiga napisana, napisana je na takav nain da bi se odmah otkrilo ako
bi neto bilo umetnuto u nju.
69
Ukoliko to ne pokua osoba Patanjalijevog kalibra, vi ne moete uiniti nita. Samo
promisli, ako ima jednu Ajntajnovu formulu, ta joj moe napraviti? Ako bilo ta napravi,
to e se odmah primetiti. Ukoliko se um poput Ajntajnovog ne pokuava igrati s njom, vi ne
moete nita. Formula je potpuna - nita se ne moe dodati, nita se ne moe izbrisati. Ona je
celina sama po sebi. ta god napravi, bie uhvaen.
Ovo su savrene formule. Ako dodate ijednu re, svako ko radi na putu joge odmah
e opaziti da je to pogreno.
Ispriau vam anegdotu. Dogodila se ba u ovom veku. Jedan od najveih pesnika
Indije, Rabindranat Tagore, preveo je svoju knjigu, Gitanjali, s bengalskog na engleski jezik.
Sam ju je preveo, a onda se malo pokolebao je li prevod dobar ili ne. Pitao je C. F. Andrewsa,
jednog prijatelja i uenika Mahatme Gandija: "Samo pregledaj to. Kako ti izgleda prevod?" C.
F. Anrews nije bio pesnik, on je bio samo jedan Englez - dobro obrazovan, poznavalac jezika,
gramatike i svega - ali nije bio pesnik.
Rekao je Rabindranatu da na etiri mesta, u etiri take, promeni odreene rei: "One
su negramatike, Englezi ih nee shvatiti." Tako je Rabindranat naprosto promenio sve to mu
je Andrews rekao. Sveukupno je promenio etiri rei. Zatim je otiao u London, po prvi put
na skup pesnika... Jedan engleski pesnik toga vremena, Yeats, organizovao je taj skup. Po prvi
put proitan je taj prevod.
Svi su posluali itanje celog prevoda, i Rabindranat upita: "Imate li kakvih
primedbi? Jer ovo je samo prevod, a engleski nije moj maternji jezik."
A poeziju je vrlo teko prevesti. Yeats, koji je bio pesnik Rabindranatovog kalibra,
rekao je: "Samo u etiri take neto je krivo". I to su bile upravo one etiri rei koje je
predloio Andrews!
Rabindranat nije mogao verovati. On ree: "Kako, kako si otkrio? Jer te etiri rei
nisam ja preveo. Andrews ih je predloio, a ja sam ih uvrstio." Yeats ree: "Cela poezija tee,
samo su ove etiri kao kamenje. Tok je prekinut. Izgleda kao da je neko drugi uradio posao.
Tvoj jezik moda nije gramatiki, tvoj jezik nije sto posto taan. Ne moe biti; to moemo
razumeti. Ali to je stopostotna poezija. Te etiri rei dole su od kolskog uitelja. Gramatika
je postala ispravna, ali je poezija pola ukrivo."
S Patanjalijem ne moe uiniti nita. Svako ko se bavi jogom odmah e primetiti
da je neko ko nita ne zna umetnuo neto. Postoji samo nekoliko knjiga koje su jo uvek iste,
ija je istota sauvana. Ovo je jedna od njih. Nita nije promenjeno, ni jedna jedina re. Nita
nije dodano; ona je onakva kakva je Patanjali hteo da bude.
Ovo je delo objektivne umetnosti. Kada kaem "delo objektivne umetnosti", imam na
umu odreenu stvar. Preduzeta je svaka predostronost. Kada su se ove sutre kondenzovale,
preduzeta je svaka predostronost kako ne bi mogle biti unitene. Konstruisane su na takav
nain da bi bilo to strano, ikakav strani element, postao remetilaki faktor. Ali kaem,
pokua li ovek poput Patanjalija, on to moe uiniti.
Ali, ovek poput Patanjalija nikada ne bi pokuao takvu stvar. Uvek samo nii
umovi pokuavaju interpolirati. A nii umovi mogu pokuati, i stvar se moe nastaviti,
interpolirana, jedino kad to postane masovna stvar. Mase nisu svesne, ne mogu biti svesne.
Samo Yeats je bio svestan da je neto krivo. Skupu su prisustvovali i mnogi drugi; niko nije
bio svestan, samo Yeats.
Ovo je tajni kult, tajno naslee. Knjiga je ipak napisana,
21
ali se knjiga kao forma
nije smatrala pouzdanom. Jo ima ivih ljudi koji su Patanjalijeve sutre dobili neposredno od
svog uitelja, a ne iz knjige. Tradicija se jo odrava ivom, i nastavie se, jer knjiga nije
pouzdana. Ponekad se knjige mogu zagubiti. S knjigama mnoge stvari mogu poi krivo.
Dakle, tajna tradicija postoji. Tradicija se odrava, i oni koji znaju preko rei uitelja
stalno proveravaju je li u knjizi neto pogreno ili je neto menjano.
To se nije sprovodilo za druge spise. Biblija ima previe interpolacija, umetanja i
izmena; ako bi se Isus vratio, ne bi bio u stanju da razume ta se dogodilo, kako su te stvari
dospele tamo. Jer dve stotine godina od Isusove smrti... Nakon dvesta godina Biblija je po
21
Smatra se da je Patanjali samo zapisao joga sutre koje su se dugo prenosile usmenim putem kao tajno uenje.
Taj njegov zapis su ove joga sutre koje imamo.
70
prvi put zabeleena. U tih dvesta godina mnoge stvari su nestale. ak su i njegovi uenici
priali razliite prie.
Buda je umro. Njegove su rei zabeleene petsto godina nakon njegove smrti.
Postoje mnoge kole, mnogi spisi, i niko ne moe rei ta je lano, a ta istinsko. Ali Buda je
govorio masama, tako da on nije saet kao Patanjali. On je govorio masama, obinim,
uobiajenim ljudima. On je stvar obrazloio u detalje. U tim detaljima mogle su se dodati
mnoge stvari, mnoge stvari mogle su se izbrisati, a da niko ne bi primetio da je neto
uinjeno.
Ali Patanjali nije govorio masama. On je govorio samo nekolicini odabranih, grupi
- grupi od samo nekoliko osoba, ba kao Gurijev. Gurijev nikada nije govorio pred
masama. Vrlo probrana grupa njegovih uenika mogla ga je sluati, i to pod mnogim
uslovima. Skup nikada nije bio najavljen unapred. Ako bi govorio te veeri u osam i trideset,
oko osam sati dobili biste naznaku da e Gurijev negde govoriti. I morali ste krenuti odmah,
jer u osam i trideset vrata e se zatvoriti. A tih trideset minuta nikada nije bilo dovoljno. Kada
stignete, moete otkriti da je otkazao. Sledeeg dana, opet...
Jednom je otkazivao sedam dana za redom. Prvi dan je dolo etiri stotine ljudi,
zadnji dan samo etrnaest. Dan za danom su se obeshrabrivali. A onda se inilo nemoguim
da e govoriti. Zadnji dan, samo etrnaest ljudi... kad je video, ree: "Sada je ostao pravi broj
ljudi. Mogli ste ekati sedam dana i niste se obeshrabrili, pa ste sada zasluili to. Sada u
govoriti, i samo ovih etrnaest moi e sluati ovu seriju. Neka niko drugi ne bude obaveten
da sam poeo govoriti."
Ovaj nain rada je drugaiji. Patanjali je radio s vrlo zatvorenim krugom. Zato iz
toga nije proizala nikakva religija, nikakva organizacija. Patanjali nije imao sektu. Takva
ogromna snaga, ali on je ostao zatvoren unutar male grupe. I izveo je to na takav nain da se
istota moe odravati. Ona se odrala do danas.
Pitanje peto:
Da li biste, molim vas, objasnili delovanje te nepoznate sile koja ljudski um dri
vezanim za zemaljske stvari i navike, uprkos tome to smo potpuno svesni da konaan rezultat
nije nita drugo do beda?
Svest nije potpuna, svest je samo intelektualna. Logiki, ti prihvata da "to god
radio, to me vodi u bedu", ali to nije tvoje egzistencijalno iskustvo. Ti razume samo
racionalno. Kada bi ti bio samo razum, onda ne bi bilo problema, ali ti si takoe i "nerazum".
Kada bi imao samo svesni um, onda bi bilo u redu. Ti ima nesvesni um, takoe. Svesni um
zna da ti svakoga dana zapada u bedu svojim vlastitim naporima; stvara svoj vlastiti pakao.
Ali nesvesni nije svestan, a nesvesni je devet puta vei od tvog svesnog uma. I nesvesni
nastavlja istrajavati na vlastitim navikama.
Odluio si da se vie nee ljutiti jer ljutnja nije nita drugo do trovanje tvog vlastitog
sistema. Ona ti donosi bedu. Ali sledei put, kada te neko uvredi, nesvesno e ostaviti po
strani tvoj svesni razum, provalie, i ti e biti ljut. A to nesvesno uopte nije ni znalo za tvoju
odluku, i to nesvesno ostaje aktivna sila.
Svesni um nije aktivan, on samo misli. On je mislilac; nije initelj. Dakle, ta se
mora uiniti? Samo mislei svesno da je neto pogreno nee to zaustaviti. Morae raditi na
disciplini, a kroz disciplinu e to svesno znanje prodreti u nesvesno poput strijele.
Kroz disciplinu, kroz jogu, kroz praksu meditacije, svesna odluka e dopreti do
nesvesnog. A kada dopre do nesvesnog, samo tada e biti od neke koristi. Inae e nastaviti
misliti o neemu, a napravie upravo suprotno.
Sv. Augustin je rekao da "to god znam da je dobro - i uvek mislim da u napraviti
tako - kad se ukae prilika da tako postupim, uvek u napraviti to god je pogreno." To je
ljudska dilema.
A joga je put za premoavanje svesnog i nesvesnog. I kada zaemo dublje u
disciplinu shvatie kako se to moe postii. To se moe postii. Dakle, ne oslanjaj se na
svesno, ono je neaktivno. Nesvesno je aktivno. Promeni nesvesno; samo onda e tvoj ivot
71
imati drugaiji smisao. Inae e biti u jo veoj bedi.
Mislei jedno, a radei neto drugo, stalno e stvarati kaos - i malo-pomalo
izgubie samopouzdanje. Malo-pomalo oseae da si apsolutno nesposoban, impotentan, da
ne moe nita uiniti. Pojavie se samooptuivanje. Oseae krivicu. A krivica je jedini
greh.
Poglavlje 7
STALNA UNUTARNJA PRAKSA
31. decembar 1973.
I, 12: abhyasavayragyabhyam tannirodhah.
Vebanje i [duevna] proienost vode ka toj umirenosti (nirodha) [o kojoj je
prethodno bilo rei u YS, I, 2].
I, 13: tatra sthitau yatno 'bhyasah.
Napor da se tu [u umirenosti ovek] ustali jeste [ono to sutinski odreuje]
vebanje (abhyasa).
I, 14: sa tu dirghakalanairantaryasatkarasevito drdhabhumih.
Ovo [vebanje] pak postaje efikasno ukoliko se kroz dugi period, neprekidno i
sa panjom obavlja.
ovek nije samo njegov svesni um. On ima takoe devet puta vie od svesnog,
nesvesni sloj uma. Ne samo to, ovek ima telo, soma, u kome njegov um prebiva. Telo je
apsolutno nesvesno. Ono deluje preteno nevoljno. Samo povrina tela jeste voljna.
Unutranji izvori su nehotini, ne moete uiniti nita oko njih. Vaa volja nije delotvorna.
22
Ovaj obrazac ljudske egzistencije treba da se razume pre nego to ovek ue u sebe. A
razumevanje ne treba da ostane samo intelektualno. Ono mora ii dublje. Ono mora prodreti u
nesvesne slojeve; ono mora dopreti do celog tela.
Otuda vanost abhyase - konstantne unutranje prakse. Ove dve rei su vrlo znaajne;
abhyasa i vairagya. Abhyasa oznaava neprekidnu unutranju praksu, a vairagya oznaava
nevezanost, beeljnost. Sledee Patanjalijeve sutre bave se s ova dva znaajna koncepta, ali
pre nego to uemo u sutre, onaj obrazac ljudske linosti, koji nije potpuno intelektualan,
treba biti vrsto shvaen.
Da je on samo intelekt, ne bi bilo potrebe za abhyasom - konstantnim, ponavljanjem
napora. Vi moete razumeti odmah sve, ako je to racionalno, kroz um, ali samo to
razumevanje nee delovati. Moete razumeti lako da je ljutnja rava, otrovna, ali ovo
razumevanje nije dovoljno za ljutnju da vas ostavi, da iezne. Uprkos vaem razumevanju
ljutnja e se nastaviti, jer ljutnja opstaje u mnogim slojevima naeg nesvesnog uma - ne samo
u umu, nego i vaem telu takoe.
Telo ne moete razumeti samo pomou verbalne komunikacije. Samo vaa glava moe
razumeti, ali telo ostaje nedirnuto. A dok razumevanje ne dopre do samog korena tela, ne
moete biti preobraeni. Ostaete isti. Vae ideje mogu nastaviti da se menjaju, ali vaa
linost e ostati ista. Onda e se novi konflikt pojaviti. Biete u veem nemiru nego ikada, jer
sada moete znati ta je pogreno a i dalje istrajavate da inite to; nastavljate da radite to.
Stvoren je oseaj krivice i osude sebe samoga. Poinjete da mrzite sebe, poinjete da
mislite o sebi kao greniku. A to vie razumete, vie osuda raste, jer vidite kako je to teko,
gotovo nemogue, da promenite sebe.
Joga ne veruje u intelektualno razumevanje. Ona veruje u telesno razumevanje, u
22
Podela nervnog sistema na autonomni i periferni.
72
totalno razumevanje u kome je vaa celovitost ukljuena. Ne samo da se menjate u svojoj
glavi, ve se duboki izvori vaeg bia takoe menjaju.
Kako oni mogu da se menjaju? Konstantno ponavljanje posebne prakse postaje
nevoljno. Ako sprovodite odreenu praksu konstantno - samo ponavljajui je neprekidno
ubrzo to ispada iz svesti, dosee nesvesno i postaje deo nesvesnog. Jednom kada postane deo
nesvesnog, to zapoinje da funkcionie iz tog dubljeg izvora.
Sve moe postati nesvesno ako nastavljate da ponavljate to neprekidno. Na primer,
vae ime je ponavljano tako neprekidno od vaeg detinjstva. Sada ono nije deo svesnog, ono
je postalo deo nesvesnog. Vi moda spavate sa sto osoba u sobi, a ako neko doe i pozove
"Ram, je li Ram tu?" devedeset devet osoba koje nisu povezane s imenom nastavie da
spavaju. Njima to nee smetati. Ali osoba koja nosi ime "Ram" iznenada e pitati: "Ko me
zove? Zato mi smetate u spavanju?"
ak i u spavanju on zna da je njegovo ime Ram. Kako je to ime doseglo tako duboko?
Samo pomou neprestanog ponavljanja. Svako ponavlja svoje ime, svako poziva sebe,
predstavlja sebe. Neprekidna upotreba. Sada to nije svesno. To je dospelo do nesvesnog.
Jezik, va maternji jezik, postaje deo nesvesnog. Sve to jo nauite kasnije nikada
nee biti tako nesvesno; to e ostati svesno. Zbog toga e va nesvesni jezik neprekidno
uticati da va svesni jezik.
Ako Nemac govori engleski, to je drugaije; ako Francuz govori engleski, to je
razliito; ako Indijac govori engleski, to je razliito. Razlika nije u engleskom, razlika je u
njihovim unutarnjim obrascima. Francuz ima razliit obrazac - nesvesni uzorak. To utie.
Tako, sve to nauite kasnije bie pogoeno vaim maternjim jezikom. Ako padnete u
nesvesno stanje, onda samo va maternji jezik moe prodreti.
Seam se jednog od mojih prijatelja koji je bio maharashtrian.
23
Bio je u Nemakoj
dvadeset godina, ili ak vie. Potpuno je zaboravio svoj vlastiti maternji jezik, marathi. Nije
mogao da ga ita, nije mogao da govori na njemu. Svesno, jezik je bio potpuno zaboravljen
zato to nije korien.
Onda se razboleo. I u toj bolesti on bi postao nesvestan. Kad god bi postao nesvestan,
potpuno razliit tip linosti se ispoljavao. Poeo bi da se ponaa na drugaiji nain. U svom
nesvesnom stanju izgovarao bi rei iz marathia, ne iz nemakog. Kada je bio nesvestan, onda
bi izgovarao rei koje su iz marathi jezika. A posle nesvesti, kada bi se vratio natrag u
svesnost, za nekoliko trenutaka ne bi mogao da razume nemaki.
Konstantno ponavljanje u detinjstvu ide dublje jer dete nema pravu svesnost. Ono ima
vie nesvesnog vrlo blizu povrine; sve ulazi u nesvesno. Kako ono ui, kako postaje vie
obrazovano, svesnost e postati deblji sloj - onda sve manje i manje prodire prema
nesvesnom.
Psiholozi kau da se gotovo pedeset posto vaeg uenja obavlja do sedme godine. U
sedmoj godini vaeg detinjstva, vi ste gotovo upoznali polovinu stvari koje ete ikada znati.
Pola vaeg obrazovanja je zavreno, a ta polovina e postati osnova. Dakle sve drugo e biti
samo nadograeno na tome. I ti dublji obrasci e ostati iz detinjstva.
Zbog toga moderna psihologija, moderna psihoanaliza, psihijatrija, svi pokuavaju da
prodru u vae detinjstvo, jer ako ste mentalno bolesni, seme negde treba da se nae u vaem
detinjstvu - ne u sadanjosti. Obrazac mora biti lociran tamo u detinjstvu. Jednom kada je
duboki obrazac lociran, onda neto moe da se uradi i moete biti preobraeni.
Ali kako prodreti dotle? Joga ima metodu. Metoda se naziva abhyasa. Abhyasa
oznaava konstantnu, ponavljajuu praksu odreene stvari. Zato, kroz ponavljanje, neto
postaje nesvesno? Ima nekoliko razloga za to.
Ako elite da nauite neto, moraete to da ponavljate. Zato? Ako proitate pesmu
samo jednom, zapamtiete nekoliko rei tu i tamo; ali ako je proitate dva puta, tri puta,
mnogo vie puta, onda moete zapamtiti redove, strofe. Ako ponovite sto puta, onda je
moete zapamtiti kao celu. Ako je ponovite ak i vie, onda ona moe da se nastavi, istraje u
vaem pamenju godinama. Neete moi da je zaboravite.
23
Stanovnik Maharatra drave u Indiji.
73
ta se deava? Kada ponavljate odreenu stvar, to je vie ponavljate, vie se urezuje u
modane elije. Neprekidno ponavljanje je kao konstantno udaranje ekiem. Onda se to
urezuje. To postane deo vaih modanih elija. A to vie postane deo vaih modanih elija,
manje svesnosti je potrebno. Vaa svesnost moe da ode; sada ona nije potrebna.
Dakle, ta god nauite duboko, za to ne treba da budete svesni. U poetku, ako uite
vonju, kako da vozite kola, onda je to konstantan napor. Zbog toga ima tako mnogo nevolja,
jer morate biti oprezni neprekidno, a ima tako mnogo stvari da ih se bude svestan - put,
saobraaj, mehanizam, volan, pedala za gas, konice, i sve drugo, kao i saobraajna pravila na
putu. Morate neprekidno biti svesni svega. Dakle tako ste mnogo angaovani u tome da to
postaje teko, to postaje veoma naporno.
Ali ubrzo, vi moi ete kompletno da zaboravite sve. Voziete, a vonja e postati
nesvesna. Nije potrebno da unosite svoj um u to, moete nastaviti da mislite ta god elite,
moete da budete gde god elite, a kola ete voziti nesvesno. Sada je vae telo to nauilo.
Sada itav mehanizam zna to. To je postalo jedno nesvesno uenje.
Kad god neto postane tako duboko da ne treba da budete svesni o tome, to pada u
nesvesno. A jednom kada stvar padne u nesvesno, to e zapoeti da menja vae bie, va
ivot, va karakter. I promena e biti sada nenaporna; ne treba da se brinete o tome.
Jednostavno ete se kretati u pravcu gde vas nesvesno vodi.
Joga je radila vrlo mnogo na abhyasi, na konstantnom ponavljanju. Ovo konstantno
ponavljanje je potrebno samo da bi dovelo vae nesvesno u rad. A kada nesvesno pone da
funkcionie, vi ste spokojni. Nikakav napor nije potreban; stvari postaju prirodne. Kae se u
starim spisima da mudrac nije onaj koji ima dobar karakter, jer ak i ta svesnost pokazuje da
"protiv" jo postoji, suprotnost jo postoji. Mudrac je ovek koji ne moe initi loe, ne moe
misliti o tome. Dobrota je postala nesvesna; postala je kao disanje. ta god da on uradi to e
biti dobro. To je postalo tako duboko u njegovom biu da nikakav napor nije potreban. To je
postalo njegov ivot. Tako da ne moete rei mudracu da je on dobar ovek. On ne zna ta je
dobro, ta je loe. Sada ne postoji konflikt. Dobro je prodrlo tako duboko da ne postoji
potreba da se bude svestan toga.
Ako ste svesni o vaoj dobroti, ravost jo postoji uporedo. I postoji stalna borba. I
svaki put kada morate da se pokrenete u akciju, morate izabrati: "Moram initi dobro; ne
smem initi ravo." I ovaj izbor e biti veliki nemir, konstantno unutranje nasilje, unutranji
rat. Ako konflikt postoji, ne moete se oseati oputeno, kao kod kue.
Sada emo ui u sutru. Prestajanje uma jeste joga, ali kako moe um, i njegove
modifikacije, da prestanu?
Njihov prekid nastaje pomou trajne unutarnje prakse i nevezivanja.
Dve stvari - kako um moe da prestane sa svim svojim modifikacijama: jedna -
abhyasa, istrajna unutarnja praksa, a druga - nevezivanje. Nevezivanje e stvoriti situaciju,
uporna praksa je tehnika koja se koristi u toj situaciji. Pokuajte da razumete oboje.
ta god da radite, vi radite jer imate odreene elje. A ove elje mogu biti ispunjene
samo injenjem odreenih stvari. Dok ove elje ne budu odbaene, vae aktivnosti ne mogu
biti odbaene. Vi imate neko ulaganje u ovim aktivnostima, u ovim akcijama. Ovo je jedna od
nedoumica ljudskog karaktera i uma, da moete eleti da zaustavite odreene akcije jer vas
one vode u nevolju.
Ali zato ih inite? Vi ih inite jer imate odreene elje, a ove elje ne mogu biti
ispunjene bez njihovog izvoenja. Dakle ovo su dve stvari. Jedna, vi morate initi odreene
stvari. Na primer, ljutnja. Zato postajete ljuti? Vi postajete ljuti samo kada negde, na neki
nain, neko stvara prepreku. Nameravate postii neto, a neko stvori prepreku. Vaa elja je
ometena. Vi postajete ljuti.
Moete postati ljuti ak i na stvari. Ako se kreete, i pokuavate da stignete negde
odmah, a stolica vam se nae na putu, vi se naljutite na stolicu. Pokuavate da otkljuate
vrata, a klju ne radi, postanete ljuti na vrata. To je apsurdno, jer ljutiti se na stvar jeste
besmislica. Sve to stvara bilo koju vrstu prepreke stvara ljutnju.
74
Imate elju da dosegnete, da uradite, da postignete neto. Ko god se isprei na putu do
vae elje izgleda da je va neprijatelj. elite da ga unitite. To je ono to znai ljutnja: elite
da unitite prepreke. Inae ljutnja vodi do nevolje; ljutnja postaje jedno oboljenje. Stoga ne
elite da budete ljuti.
Ali kako moete odbaciti ljutnju ako imate eljene ciljeve? Ako imate elje i ciljeve,
onda ljutnja je obavezna da bude tu, jer ivot je sloen, vi niste sami ovde na ovoj zemlji.
Milioni i milioni se bore za svoje vlastite elje, oni se ukrtaju jedni s drugima, dolaze jedni
drugima na stazu. Ako imate elje, onda je nuno da ljutnja bude tu, frustracija e obavezno
biti tu, nasilje e nuno biti tu. I sve to doe na vau stazu, va um e misliti da uniti.
Ovaj odnos prema unitenju prepreka jeste ljutnja. Zato to ljutnja stvara nevolju,
elite da ne budete ljuti. Ali samo eleti da ne budete ljuti nee biti od velike pomoi jer
ljutnja je deo veeg obrasca - od uma koji eli, uma koji ima ciljeve, uma koji eli da stigne
negde. Ne moete odbaciti ljutnju.
Dakle, problem je u elji. S njom je odbaeno pola mogunosti ljutnje; osnova je
odbaena. Ali onda takoe nije nuno da e sva ljutnja da iezne, jer ste bili ljuti milionima
godina. Ona je postala duboko ukorenjena navika.
Moete odbaciti elje, ali ljutnja e jo odoleti. Ona nee biti tako snana, ali e
istrajati jer sada je navika. Postala je nesvesna navika. Tokom mnogo, mnogo ivota vi ste je
nosili. Ona je postala vae nasledstvo. Ona je u vaim elijama; telo ju je preuzelo. Ona je
sada hemijska i fizioloka. Samo vaim odbacivanjem svojih elja vae telo nee promeniti
svoj obrazac. Obrazac je vrlo star. Moraete da promenite i ovaj obrazac.
Za tu promenu bie potrebna ponavljajua praksa. Da se promeni unutranji
mehanizam, ponavljajua praksa e biti potrebna - preuslovljavanje itavog obrasca telo-um.
Ali ovo je mogue samo ako ste odbacili eljenje.
Pogledajte to s druge take gledita. Jedan ovek je doao kod mene i rekao: "Ne
elim da budem alostan, ali sam uvek tuan i snuden. Ponekad ne mogu ak ni da osetim
razlog zato sam tuan, ali jesam tuan. Nema vidljivog uzroka, nita na ta mogu tano
pokazati da je razlog. Izgleda da je da je to postalo moj stil da budem tuan. Ne seam se",
rekao je, "da li sam ikada bio srean. Ne elim da budem tuan, to je teret. Sad sam
najnesrenija osoba. Zaista, kako mogu to odbaciti?"
Tako sam ga pitao: "Jesi li neto uloio u svoju oaloenost?" On je rekao: "Zato bih
imao bilo kakvo ulaganje?" Ali jeste. Znao sam dobro tu osobu. Znao sam ga mnogo godina,
ali on nije bio svestan da postoji neko steeno interesovanje u tome. Tako, eleo je da odbaci
alost, ali nije bio svestan zato tuga postoji. On je smatrao da su to neki drugi razlozi koje
nije mogao da povee.
Njemu treba ljubav, ali da bi bio voljen... Ako vam treba ljubav treba da budete
zaljubljeni. Ako traite ljubav, treba da date ljubav, i treba da date vie nego to moete
traiti. Ali on je tvrdica, on ne moe dati ljubav. Davanje je nemogue, on ne moe dati nita.
Samo od rei "davanje", on e se stegnuti u sebi. On moe samo da uzima; on ne moe da
daje. On je zatvoren kada je davanje u pitanju.
Ali bez ljubavi ne moete cvetati. Bez ljubavi ne moete postii nikakvu radost; ne
moete biti sreni. A on ne moe voleti jer ljubav izgleda kao davanje neega. To je davanje,
davanje svega to imate, i vaeg bia, takoe. On ne moe dati ljubav, on ne moe primiti
ljubav. Onda ta da radi? Inae on arko udi, kao to svako arko udi za ljubavlju. To je
osnovna potreba ba kao hrana. Bez hrane telo e umreti, a bez ljubavi vaa dua e se
stegnuti. To je neminovno.
Onda je on stvorio zamenu, a ta zamena je saoseanje. On ne moe dobiti ljubav jer ne
moe dati ljubav, ali moe dobiti sauee. Sauee je siromana zamena za ljubav. Stoga je
on alostan. Kada je on tuan ljudi mu daju sauee. Ko god mu doe ima saoseanje jer on
uvek plae i zapomae. Njegovo raspoloenje je uvek kao kod vrlo nesrenog oveka. Ali on
uiva! Kada god mu pruite saoseanje on uiva u tome. On postaje vie nesrean, jer to je
vie nesrean, vie moe dobiti saoseanja.
Stoga sam mu ja rekao: "Vi imate odreeno ulaganje u vau alost. Ovaj ceo obrazac,
samo alost ne moe se odbaciti. Ona je ukorenjena negde drugde. Prestanite da traite
75
saoseanje. Moete prestati da traite saoseanje samo kada zaponete da dajete ljubav, jer to
je zamena. A jednom kada zaponete da dajete ljubav, ljubav e vam se dogoditi. Onda ete
biti sreni. Onda je stvoren razliit obrazac."
uo sam: ovek je uao u jedan auto-park. Bio je u vrlo smenom poloaju. Izgledalo
je skoro nemogue kako je hodao, jer se bio pogurio kao da vozi auto. Ruke su mu se na
nekom nevidljivom volanu pokretale, a noga na nevidljivom gasu; a on je hodao. A to je bilo
tako teko, skoro nemogue, kako je on hodao. Gomila se sakupila tu. On je radio neto
nemogue. Oni su pitali pratioca: "ta se deava? ta ovaj ovek radi?"
Taj pratilac je rekao: "Ne pitaj glasno. ovek je u svojim prolim voljenim kolima.
Bio je jedan od najboljih vozaa. On je ak dobio nacionalnu nagradu na auto trkama. Ali
sada, usled nekog mentalnog nedostatka, on se srozao. Nije mu dozvoljeno da vozi kola, to
mu je inae ba stari hobi."
Iz gomile su rekli: "Ako znate to, onda zato mu to ne kaete, kaite mu: "Nemate
auto, ta radite ovde?" ovek je odgovorio: "To je ono zbog ega ja kaem: "Ne govorite
naglas." Ja ne mogu to uiniti, jer mi on daje jedan rupi dnevno da operem kola. Zato mu ne
mogu to rei: "Vi nemate kola". On e parkirati kola, a onda u ih ja oprati."
To ulaganje od jednog rupija, steena korist, postoji. Imate mnogo steenih koristi u
vaoj nevolji takoe, u vaem bolu takoe, u vaoj bolesti takoe. A stalno govorite: "Mi ne
elimo to. Mi ne elimo da budemo ljuti, ne elimo da budemo ovo i ono." Ali dok ne doete
do uvida kako su se sve te stvari dogodile vama, dok ne uvidite ceo obrazac, nita se ne moe
promeniti.
Najdublji obrazac uma je elja. Vi ste ono to jeste jer imate odreene elje, grupu
elja. Patanjali kae: "Prva stvar je nevezivanje." Odbacite sve elje; ne budite vezani. A
onda, abhyasa.
Na primer, neko doe kod mene i kae: "Ne elim da sakupljam vie masti u svom
telu, ali nastavljam da jedem. Ja elim da prestanem, ali nastavljam da jedem."
eljenje je povrinsko. Postoji obrazac unutra, zato on jede vie i vie. ak i ako
prestane za nekoliko dana, onda opet s vie ukusa on jede. I on e sakupiti veu teinu nego
to je izgubio kroz nekoliko dana posta ili dijete. A to se deavalo neprekidno, godinama. To
nije pitanje da se jede manje. Zato on jede vie? Telu to ne treba, onda negde u umu hrana je
postala zamena za neto.
On se moda boji smrti. Ljudi koji se boje smrti jedu vie jer jedenje izgleda da je
osnova ivota. to vie jedete vie ivite. Ovo je aritmetika u njihovom umu. Jer ako ne jedete
vi umirete. Dakle ne jedenje je ekvivalentno smrti, a vie jedenja je ekvivalentno sa vie
ivota. Dakle, ako se bojite smrti vi ete jesti vie, ili ako vas niko ne voli vi ete jesti vie.
Hrana moe postati zamena za ljubav, jer dete u poetku, dolazi do toga da povee
hranu i ljubav. Prva stvar za koju e dete biti svesno jeste majka, hrane od majke i ljubavi od
majke. Ljubav i hrana ulaze u njegovu svest istovremeno. A kad god majka voli, ona daje vie
mleka. Dojka se daje sreno. Ali kad god je majka ljuta, nije milostiva, ona otrgne dojku.
Hrana se uklanja kad god majka ne voli; hrana se daje kad god ona voli. Ljubav i
hrana postaju jedno. U umu, u dejem umu, oni postaju udrueni. Tako, kad god dete dobije
vie ljubavi, ono e smanjiti svoju hranu, jer ljubavi je toliko mnogo da hrana nije nuna. Kad
god nema ljubavi, ono e jesti vie jer ravnotea mora da se odrava. Ako uopte nema
ljubavi, onda e ono samo puniti svoj stomak.
Moete biti iznenaeni - kad god su dve osobe u ljubavi, one izgube debljinu. Zbog
toga devojke postaju deblje onog momenta kada se udaju. Kada je ljubav utvrena brakom,
zapoinju da se debljaju jer ljubav i svet ljubavi je, na neki nain, okonan.
U zemljama gde vie preovlauju razvodi, ene pokazuju bolje figure. U zemljama
gde razvodi nisu rasprostranjeni, ene ne brinu o svojim figurama, jer ako je razvod mogu
onda e ena morati da nae nove ljubavnike i svesno istie svoju figuru. Traganje za
ljubavlju pomae telesnoj pojavi. Kada je ljubav utvrena, ona je dovrena u ivotu. Ne treba
da brinete o telu; ne treba uopte da brinete o njemu.
Dakle, ova osoba se moda boji smrti; moda ona nije u nekoj dubokoj, intimnoj
ljubavi s nekim. A ovo dvoje su opet povezani. Ako ste u dubokoj ljubavi, vi se ne bojite
76
smrti. Ljubav je tako ispunjavajua da ne brinete ta e se dogoditi u budunosti. Ljubav sama
je ispunjenje. ak i ako smrt doe, ona moe biti dobrodola. Ali ako niste u ljubavi, onda
smrt kreira strah; jer vi niste ak ni voleli jo, a smrt se pribliava. Smrt e se desiti i vie nee
biti vremena i nema budunosti posle nje.
Ako ne postoji ljubav, straha od smrti e biti vie. Ako ima ljubavi, manje je straha od
smrti. Ako ima potpune ljubavi, smrt potpuno iezava. Ovo je sve povezano unutra. ak i
vrlo jednostavne stvari su duboko ukorenjene u veim obrascima.
Mula Nasrudin je jednom stajao ispred svog veterinara sa psom i insistirao je: "Isecite
rep mom psu." Doktor je rekao: "Ali zato, Nasrudine? Ako iseem rep vaem psu, ovaj lepi
pas e biti upropaen. Izgledae runo. Zato zahteva to?" Nasrudin je rekao: "Meu nama,
ne kaite to nikome, elim odsei psu rep jer moja tata e uskoro doi a ja ne elim nikakav
znak dobrodolice u mojoj kui. Uklonio sam sve. Samo ovaj pas je ostao, on moe izraziti
dobrodolicu mojoj tati."
ak i psei rep ima vei obrazac od mnogih uzajamnih odnosa. Ako Mula Nasrudin ne
moe da izrazi dobrodolicu svojoj tati ak ni kroz svog pasa, on ne moe biti u ljubavi sa
svojom enom; to je nemogue. Ako ste u ljubavi sa svojom suprugom, iskazaete
dobrodolicu i svojoj tati. Biete ljubazni prema njoj.
Jednostavne stvari na povrini duboko su ukorenjene u kompleksnim stvarima, i sve je
meusobno zavisno. Dakle, samom promenom miljenja, nita se ne menja. Dok vi ne odete
do kompleksnog obrasca, oslobodite ga uslovljavanja, dovedete ga red, stvorite nov obrazac,
samo onda novi ivot moe nastati iz toga. Dakle, ove dve stvari treba da se obave:
nevezivanje, i nevezivanje to se tie svega.
To ne znai da treba da prestanete da uivate. Ovo pogreno razumevanje je postojalo,
a joga je pogreno interpretirana na mnogo naina. U jednom od njih - izgleda da joga kae
da vi umirete za ivot jer nevezivanje znai da vi ne elite nita. Ako ne elite nita, niste
vezani ni uz ta, ako ne volite nita, onda ete biti samo mrtav le. Ne, to nije znaenje.
Nevezivanje znai da ne budete zavisni ni od ega, da ne inite svoj ivot i sreu
zavisnim ni od ega. Davanje prednosti je u redu, vezivanje nije u redu. Kada ja kaem
davanje prednosti je u redu, mislim da moete davati neemu prednost, morate davati
prvenstvo. Ako su mnoge osobe prisutne, moete voleti nekoga, moete odabrati nekog,
moete biti prijatelj s nekim. Dajte prvenstvo nekome, ali ne budite vezani.
Koja je razlika? Ako budete vezani, onda to postaje jedna opsesija. Ako osoba nije tu,
vi ste nesreni. Ako je osoba odsutna, vi ste u patnji. A vezanost je takva bolest da ako osoba
nije tu vi ste u nevolji, a ako je osoba prisutna vi ste ravnoduni. Tada je to u redu, to je
prihvatljivo. Ako je osoba tu, onda je u redu - nita vie od toga. Ako osoba nije tu, onda ste u
patnji. To je vezanost.
Davanje prvenstva je upravo suprotno. Ako osoba nije tu, vi ste u redu; ako je osoba
tu, vi se oseate srenim, zahvalnim. Ako je osoba tu vi ne prihvatate to ravnoduno. Vi ste
sreni, uivate u tome, slavite to. Ako osoba nije tu, vi ste u redu. Vi ne zahtevate, niste
opsednuti. Vi takoe moete biti sami i sreni. Vie biste voleli da je osoba tu, ali to nije
opsesija.
Davanje prednosti je dobro, vezivanje je bolest. ovek koji ivi sa davanjem prednosti
ivi ivot u dubokoj srei. Ne moete ga uiniti nesrenim. Moete ga samo uiniti srenim,
vie srenim. Ali ne moete ga uiniti nesrenim. A osobu koja ivi s vezanou ne moete
uiniti srenom, moete je uiniti samo vie nesrenom. I vi znate ovo, znate ovo vrlo dobro.
Ako je va prijatelj tu, vi mnogo ne uivate; ako prijatelj nije tu, nedostaje vam mnogo.
Upravo je pre nekoliko dana dola kod mene devojka. Videla me pre mesec dana sa
svojim momkom. Stalno su se meusobno tukli, da je to postalo samo jedna bolest, pa sam im
rekao da se razdvoje na nekoliko sedmica. Rekli su mi da im je nemogue da ive zajedno, pa
sam ih poslao daleko odvojeno.
Tako je devojka bila ovde za badnje vee, i ona je rekla: "Ova dva meseca, mnogo mi
je nedostajao moj momak! Stalno mislim na njega. ak i u mojim snovima poeo je da se
javlja. Nikada se to ranije nije dogaalo. Kada smo bili zajedno, nikada ga nisam videla u
snovima. U snovima sam vodila ljubav s drugim mukarcem. Ali sada, stalno mi je u snovima
77
moj momak. Dozvoli nam sada da ivimo zajedno."
Onda sam joj rekao: "to se mene tie, moete iveti opet zajedno. Ali seti se da ste
iveli zajedno upravo pre dva meseca i da nikada niste bili sreni."
Vezanost je bolest. Kada ste zajedno, vi niste sreni. Ako imate bogatstvo vi niste
sreni. Biete nesreni ako ste siromani. Ako ste zdravi, vi nikada ne oseate zahvalnost.
Ako ste zdravi, nikada ne oseate zahvalnost za egzistenciju. Ali ako ste bolesni vi proklinjete
ceo ivot i egzistenciju. Sve je beznaajno, i ne postoji Bog.
ak i obina glavobolja je dovoljna da izbrie sve bogove. Ali kada ste sreni i zdravi,
nikada se ne setite da odete u crkvu ili hram samo da se zahvalite: "Ja sam srean i zdrav, a
nisam to zasluio. Ovo su jednostavno darovi od tebe."
Mula Nasrudin je jednom pao u reku, i skoro da se udavio. On nije bio religiozan
ovek, ali iznenada, na ivici smrti, on je zavapio: "Alahu, Boe, molim te spasi me, i od
danas, moliu se i iniu sve to je zapisano u spisima."
Dok je izgovarao "Boe, pomozi mi," uhvatio se za granu koja je visila iznad reke.
Dok je grabio i iao prema sigurnom, osetio je oputenost i rekao: "Sada je uredu. Sada ne
treba da brine." Opet je rekao Bogu: "Sada ne treba da brine. Sada sam siguran." Iznenada
se grana slomila i on je opet pao. Tako da je rekao: "Ne moe li da prihvati prostu alu?"
Inae, tako se kreu nai umovi. Vezanost e vas uiniti vie i vie jadnim, ono to ste
slobodno izabrali e vas uiniti sve srenijim i srenijim. Patanjali je protiv vezanosti, nije
protiv onog to se vie voli. Ako hrana po vaoj sklonosti nije dostupna, onda ete odabrati
drugu hranu i biete sreni, jer ete znati da prva nije dostupna, ta god je dostupno treba u
tome da se uiva. Neete plakati i zapomagati. Prihvatiete ivot kakav vam se deava.
Ali osoba koja je stalno vezana uz sve, nikada ne uiva ni u emu i nikada ne postie
cilj. itav ivot postaje neprekidna patnja. Ako niste vezani, vi ste slobodni; imate mnogo
energije; ne zavisite ni od ega. Vi ste nezavisni, a ova energija moe da se premesti u
unutranji napor. To moe da postane praksa. To moe postati abhyasa. ta je abhyasa?
Abhyasa je borba sa starim obrascem navike. Svaka religija je razvila mnoge vebe, ali
osnova je ova Patanjalijeva sutra.
Na primer, kad god nastaje ljutnja, nainite stalnom praksom da pre ulaska u ljutnju
uzmete pet dubokih udisaja. Jednostavna praksa, oevidno uopte nije povezana sa ljutnjom.
Svakoga to moe nasmejati, "Kako e to pomoi?" Ali to e pomoi. Kad god osetite da
ljutnja dolazi, pre nego to je izrazite, uzmite pet dubokih udisaja i izdisaja.
ta e to uiniti? To e uiniti mnogo stvari. Ljutnje moe biti samo ako ste nesvesni,
a ovo je svestan napor. Upravo pre nego to se naljutite svesno udahnite i izdahnite pet puta.
Ovo e uiniti va um ivahnim, opreznim, a sa opreznou ljutnja ne moe ui. To nee samo
uiniti va um ivahnim, uinie takoe i vae telo ivahnim, jer sa vie kiseonika u telu, telo
je ivahnije. U ovom ivahnom momentu, iznenada ete osetiti da je ljutnja iezla.
Drugo, va um moe biti samo na jedno usmeren. Um ne moe misliti o dve stvari
istovremeno; to je nemogue za um. On se moe menjati od jedne do druge stvari vrlo brzo,
ali ne moete imati dve stvari zajedno u umu istovremeno. Jedna stvar u jednom trenutku. Um
ima vrlo uzan prozor, samo jedna stvar u jednom vremenu. Tako ako je ljutnja tu, ljutnja je tu.
Ako vi udahnete i izdahnete pet puta, neoekivano um je usmeren na disanje. On se odvratio.
Sada se kree u razliitom pravcu. ak i ako se preselite ponovo na ljutnju, ne moete biti isto
ljuti opet jer vanost je izgubljena.
Gurijev kae: "Kada je moj otac umirao, rekao mi je da zapamtim samo jednu stvar:
"Kad god si ljut, saekaj dvadeset etiri sata, a onda uini ta god eli. ak i ako eli da
ubije, idi i ubij, ali ekaj za dvadeset etiri sata."
Dvadeset etiri sata je previe, dvadeset etiri sekunde e delovati. Samo ekanje vas
promeni. Energija koja je tekla prema ljutnji uzela je novi pravac. To je ista energija. Ona
moe postati ljutnja, ona moe postati saoseanje. Samo joj pruite priliku.
Tako stari spisi kau: "Ako dobra misao doe u tvoj um, nemojte je odgaati; delujte
odmah. A ako rava misao doe u va um, odloite je; nikada ne delujte odmah." Ali mi smo
vrlo lukavi i promuurni, mi mislimo. Kad god dobra misao doe, mi je odgodimo.
Mark Tven je pisao u svojim memoarima da je sluao svetenika u crkvi deset minuta.
78
Predavanje je bilo divno, i on je mislio u svom umu: "Danas u dati donaciju od deset dolara.
Svetenik je divan. Crkva mora da se pomogne!" Odluio se da pokloni deset dolara posle
predavanja. Posle deset minuta je poeo da misli da bi deset dolara bilo previe, pet e biti
dovoljno. Posle jo deset minuta je mislio: "Ovaj ovek ak ne vredi ni pet."
On vie nije sluao. Brinuo je o svojih deset dolara. Nije nikome govorio, ali sada
ubeuje sebe da je ovo previe. Vremenom je rekao: "Predavanje se zavrilo, odluio sam da
ne dam nita. A kada je ovek doao blizu mene da uzme priloge, dok se kretao, pomislio sam
da uzmem nekoliko dolara i pobegnem iz crkve!"
Um se stalno menja. On nikada nije statian, on je tok. Ako je neto ravo tu,
saekajte malo. Ne moete privrstiti um, um je tok. Samo ekajte! Samo saekajte malo, i
neete biti sposobni da uinite zlo. Ako je tu neko dobro i elite da ga uinite, uinite to
odmah jer um se menja, posle nekoliko minuta neete biti sposobni to da uinite. Dakle ako je
to delo ljubavi, ne odlaite ga. Ako je neto nasilno ili destruktivno, odgodite to malo.
Ako ljutnja doe, odloite je makar za nekoliko udisaja, i neete biti sposobni da je
iskaete. Onda ste slobodni da delujete. Nastavite neprekidno. To postaje navika; ne treba da
mislite. Onog momenta kada ljutnja ue, odmah va mehanizam zapoinje da die brzo,
duboko. Za manje od jedne godine postae vam apsolutno nemogue da budete ljuti. Neete
biti sposobni da budete ljuti.
Bilo koja praksa, bilo koji svesni napor, moe promeniti vae stare obrasce. A to nije
posao koji se moe obaviti odmah; to e traiti vreme - jer ste stvorili va obrazac navika u
mnogim, mnogim ivotima. ak ni u jednom ivotu vi ne moete promeniti to - to je previe
rano.
Moji sannyasini mi dolaze i kau: "Kada e se to dogoditi?" a ja kaem: "Ubrzo." A
oni kau: "ta mislite pod vaim "uskoro", jer ste nam godinama govorili "uskoro"?"
ak i u jednom ivotu se to deava - to je ubrzo. Kad god se to dogodi, to se desilo pre
njegovog vremena jer ste vi stvorili ovaj obrazac u tako mnogo ivota. To treba da bude
uniteno, osveeno. Stoga u bilo koje vreme, u bilo kom ivotu, to nije prekasno.
Njihov prekid nastaje uz pomo trajnog unutranjeg napora i nevezivanja.
Od ovo dvoje, abhyasa unutranja praksa je napor da se bude vrsto utvren u sebi
samom.
Sutina abhyase je da se bude usrediten u sebi. ta god da se dogodi, ne treba odmah
da se uzbuujete i reagujete. Prvo treba da budete usrediteni u sebi, iz te usredsreenosti da
posmatrate okolo i onda odluite.
Neko vas uvredi i vi ste povueni njegovom uvredom. Vi ste uzbueni bez
savetovanja sa svojim centrom. ak i bez vraanja do centra ni za jedan trenutak, vi ste
uzbueni.
Abhyasa oznaava unutranju praksu. Svesni napor znai: "Pre nego to se pokrenem
van, moram se pokrenuti unutra. Prvo kretanje mora biti prema mom centru; prvo moram biti
u kontaktu sa svojim centrom. Tamo, usrediten, pogledau situaciju i onda odluiti." A ovo
je tako ogroman, tako preobraavajui fenomen. Jednom kada ste usrediteni unutra, cela
stvar izgleda drugaija; perspektiva se promenila. To moda nee izgledati kao uvreda. ovek
moe samo da izgleda glup. Ili, ako ste stvarno usrediteni, vi ete saznati da je on u pravu.
"To nije uvreda. Nije rekao nita pogreno o meni."
uo sam da se jednom dogodilo - ne znam da li je to istina ili ne, ali sam uo ovu
anegdotu - da je jedan novinar neprekidno pisao protiv Riarda Niksona, neprekino! -
klevetajui ga, osuujui ga. Onda je Riard Nikson otiao kod izdavaa i rekao: "ta inite?
Govorite lai o meni i to dobro znate!" Izdava je rekao: "Da, znamo da govorimo lai o
vama, ali ako ponemo govoriti istinu o vama, biete u veoj nevolji!"
Dakle, ako neko govori neto o vama on moda lae, ali samo pogledajte ponovo. Ako
je on stvarno u pravu, to moe biti gore. Ili, sve to on kae moe da se primeni na vas. Ali
samo kada ste usrediteni, moete posmatrati sebe nepristrasno.
Patanjali kae da od ova dva, abhyasa unutranja praksa - jeste napor da se bude
79
vrsto utvren u sebi. Pre pokretanja u delo, bilo koje vrste delovanja, krenite u sebe. Prvo
budite utvreni tamo - makar samo za jedan jedini trenutak - i vaa akcija e biti totalno
razliita. To ne moe biti neki nesvesni obrazac od ranije. To e biti neto novo, to e biti
jedan ivi odgovor. Samo pokuajte to. Kad god oseate da ete ii da delujete ili uinite
neto, pokrenite se prvo unutra, jer ta god da ste inili do sada postalo je slino robotu,
mehaniko. Vi ste to stalno inili, neprekidno, u ponavljanim ciklusima.
Samo vodite dnevnik trideset dana - od jutra do veeri, trideset dana, i moi ete da
vidite obrazac. Vi se kreete kao maina; vi niste ovek. Vai odgovori su mrtvi. Sve to
inite jeste predvidljivo. A ako izuite svoj dnevnik pronicljivo moda ete moi da
deifrujete obrazac - da ste ponedeljkom, svakog ponedeljka ste ljuti; svake nedelje ulni,
seksualni; svake subote ste borbeni. Ili ujutru ste dobri, posle podne oseate gorinu, a uvee
ste protiv celog sveta. Moete videti obrazac. Jednom kada sagledate obrazac, moete zapaziti
da radite kao robot. A biti robot je ono to je nevolja. Treba da budete svesni, a ne mehanika
stvar.
Gurijev je imao obiaj da kae: "ovek, ovakav kakav jeste, je maina". Vi postajete
ovek samo kada postanete svesni. A ovaj konstantan napor da se bude utvren u sebi uinie
vas svesnim, oslobodie vas mehaninosti, uinie vas nepredvidljivim, uinie vas
slobodnim. Onda neko moe da vas vrea a vi ete se jo smejati; ranije se nikada niste
smejali. Neko moe da vas uvredi, a vi da oseate ljubav prema oveku; ranije to niste oseali.
Neko moe da vas uvredi, a vi moete biti zahvalni prema njemu. Neto novo se rodilo. Sada
vi stvarate svesno bie u sebi.
Prva stvar koju treba uraditi pre kretanja u akciju - jer delovanje znai kretanje spolja -
je kretanje unutra, a onda prema drugima, odlaenje od sebe. Svaki in je odlaenje dalje od
sebe. Pre nego to odete dalje od sebe, pogledajte, imajte kontakt, uronite u unutranje bie.
Prvo budite utvreni.
Pre svakog trenutka, neka bude trenutak meditacije; to je abhyasa. ta god da radite,
pre rada zatvorite svoje oi, ostanite smireni, kreite se unutra. Samo postanite bestrasni,
nevezani, tako da moete gledati na sve kao posmatra, nepristrasno - kao da niste ukljueni,
vi ste samo svedok. A onda se kreite!
24
Jednog dana, ba ujutru, ena Mule Nasrudina je rekla Muli: "Noas dok si ti spavao,
uvredio si me. Govorio si stvari protiv mene. ta si time mislio? Mora mi objasniti." Mula
ree: "Ali ko kae da sam spavao? Ja nisam spavao. Ba stvari koje elim da kaem, ne mogu
rei danju. Ne mogu skupiti tako mnogo hrabrosti."
U vaim snovima, u vaoj budnosti, konstantno inite stvari, a te stvari se svesno ne
ine - kao da ste prisiljeni da ih uinite. ak i u vaim snovima vi niste slobodni. Ovo
konstantno mehaniko ponaanje je ropstvo. Dakle kako da se bude utvren u sebi? Kroz
abhyasu.
Sufiji upotrebljavaju neprekidnost. ta god da kau, uine, sede, stoje, bilo ta Pre
nego to sufi uenik ustane, on e uzeti Alahovo ime. Prvo e uzeti boje ime. Ako sedne, on
e uzeti boje ime. Jedna akcija treba da se izvede - ak i sedenje je akcija - on e rei:
"Alah!" Tako, sedajui, on e rei: "Alah!" Ustajui on e rei; "Alah!" Ako nije mogue rei
glasno, on e rei u sebi. Svaka akcija se izvodi kroz seanje. I ubrzo, ovo seanje postaje
konstantna ograda izmeu njega i akcije - podela, procep.
25
A to vie taj procep raste, vie on moe da gleda na svoje akcije kao da on nije
poinilac. Neprekidnim ponavljanjem Alah, ubrzo, on poinje da vidi da je samo Alah inilac.
24
Ovo je ujedno i opis prakse budistike meditacije vipassana i satipatthana.
25
U pravoslavnom monatvu postoji slina praksa "Stalne molitve u srcu", opisana je u delu "Dobrotoljublje".
Razlike od sufijske, joginske (abhyasa) i budistke stalne prakse negovanja panje (vipasanna) je u tome to se u
pravoslavlju, pod uticajem lane dogme, to ini na magijski nain, naime tu se naglasak i smisao cele prakse ne
stavlja na svest i panju koja se time jaa, nego na Isusa koji se zaziva u toj molitvi reima "Isuse Hriste, sine
Boiji, pomiluj me grenog". Ipak ta praksa ima efekta ako se stalno radi due vremena, Isus ne dolazi nikome,
ali zato dolazi stalno prisustvo svesti "u srcu", odnosno iza promenljivog uma (ukoliko ne prevagne sugestija o
naoj iskonskoj grenosti). Zato je to jedina podvinika praksa u celom hrianstvu koja ima efekta, iako se on
tumai kao prisustvo ili "silazak Duha Svetoga", dakle kao magijska intervencija spoljanje sile, a ne kao stalno
prisutvo svesti. Programiranje uma o ovekovoj grenosti je, naalost, i tu prisutno, kao i u celom hrianstvu.
80
"Ja nisam poinilac. Ja sam samo vozilo ili instrument." A onog momenta kada ovaj procep
raste, sve to je zlo otpada. Vi ne moete biti zli. Moete initi zlo samo kada nema procepa
izmeu poinioca i akcije. Sada dobro tee automatski.
to je vei procep izmeu poinioca i akcije, bolje je. ivot postaje sveta stvar. Vae
telo postaje hram. Sve to vas ini budnim, utvrenim unutar sebe, jeste abhyasa.
Od ovo dvoje, abhyasa unutranja praksa je napor da se bude vrsto utvren u sebi
samom.
To postaje vrsto utemeljeno u neprekidnom postojanju za dugo vreme, bez prekida i
sa smernom predanou.
Dve stvari. "Neprekidna praksa za dugo vreme." Koliko dugo? To e zavisiti. To e
zavisiti od vas, od svake osobe, koliko dugo. Duina e zavisiti od intenziteta. Ako je jaina
totalna, onda se ubrzo to moe dogoditi, ak i odmah. Ako intenzitet nije tako jak, onda e
uzeti dui period.
uo sam da je jednog jutra sufi mistik, Junaid, poao u etnju van svog sela. Jedan
ovek je dotrao i pitao Junaida: "Glavni grad ovog kraljevstva elim da stignem u glavni
grad, jo koliko u morati da putujem? Koliko vremena e trebati?"
Junaid pogleda u oveka, i ne odgovorivi mu, nastavio je da hoda. ovek je takoe
iao u istom pravcu, tako da ga je pratio. ovek je mislio: "Ovaj stari ovek izgleda da je
gluv" pa je po drugi put pitao mnogo glasnije: "elim znati koliko vremena mi treba da
stignem do glavnog grada!"
Meutim, Junaid je nastavio da hoda. Nakon hodanja dve milje s tim ovekom, Junaid
ree: "Moraete da hodate najmanje deset sati." Onda je ovek rekao: "Ali mogli ste mi to rei
ranije!" Junaid je kazao: "Kako sam mogao to rei? Prvo sam morao znati vau brzinu. To
zavisi od vae brzine. Tokom ove dve milje posmatrao sam koja je vaa brzina. Samo onda
sam mogao da odgovorim." To zavisi od vae jaine, vae brzine.
Prva stvar je neprekidna praksa tokom dugog vremenskog perioda bez prekida. Ovo
treba zapamtiti. Ako prekinete, ako radite nekoliko dana, a onda ostavite nekoliko dana,
itav napor je izgubljen. A kada zaponete ponovo, to je opet poetak.
Ako meditirate a onda kaete za nekoliko dana da nema problema, oseate lenjost,
oseate pospanost ujutru i kaete: "Mogu da odgodim, mogu to raditi sutra," - ak i za jedan
proputen dan, vi ste izgubili rad od mnogo dana, zato to ne radite meditaciju danas, ve ete
raditi mnoge druge stvari. Te mnoge druge stvari pripadaju vaem starom mentalnom obrascu,
tako je stvoren sloj. Vae jue i vae sutra je odseeno. Danas je postalo sloj, razliit sloj.
Kontinuitet je izgubljen, a kada sutra ponete ponovo to je opet poetak. Ja vidim mnoge
osobe kako zapoinju, prestaju, opet zapoinju. Rad koji moe biti obavljen za nekoliko
meseci onda traje godinama.
Dakle ovo treba zapamtiti: bez prekidanja. Koju god praksu da ste odabrali, izaberite
je za ceo ivot, i nastavite da kujete po njoj, ne sluajte um. Um e pokuati da vas ubedi, a
um je najvei zavodnik. On moe dati sve vrste razloga da je danas nuno da se ne radi jer se
oseate bolesnim, postoji glavobolja, ne moete spavati nou, toliko ste umorni da danas
moete samo da se odmarate. Meutim to su trikovi uma.
Um eli da sledi svoj stari obrazac. Zato um eli da sledi svoj stari obrazac? Jer
postoji najmanji otpor; to je lake. Svako eli da sledi laki put, laki smer. Umu je lako samo
da sledi staro. Novo je teko.
Dakle um se opire svemu to je novo. Ako ste u praksi, u abhyasi, ne sluajte um,
nastavite da radite. Postepeno e ova nova praksa ui duboko u va um, a um e prestati da se
odupire tome jer e to onda postati lake. Onda e umu biti lake da tee. Dok on ne postane
jedan lagani tok, nemojte prekidati. Moete ponititi dug napor sa malo lenjosti. Dakle, to
mora da bude neprekidno.
I drugo, sa smernom predanou. Moete vriti praksu mehaniki, bez ljubavi, bez
predanosti, bez oseaja svetosti u tome. Onda e trajati jako dugo, jer kroz ljubav stvari
prodiru lako u vas. Kroz predanost vi ste otvoreni, vie otvoreni. Seme pada dublje.
81
Bez predanosti vi moete raditi istu stvar. Pogledajte u hram, moete imati
unajmljenog svetenika. On e raditi molitve neprekidno godinama, bez rezultata, bez
ispunjenja kroz njih. On ih vri kako je propisano, ali to je posao bez predanosti. On moe
pokazivati predanost, ali je samo sluga. Zainteresovan je samo za svoju platu - ne za molitvu,
ne za puu, ne za ritual. To se samo odrauje - to je sluba; to nije ljubav. Stoga e on to
raditi, godinama. ak celog svog ivota on e biti iznajmljeni svetenik, plaenik. Na kraju,
on e umreti kao da se nikada nije molio. Umree u hramu molei - ali e umreti kao da se
nikada nije molio, jer nije bilo predanosti.
Stoga ne vrite abhyasu, praksu, bez predanosti, jer onda nepotrebno rasipate energiju.
Mnogo moe doi iz toga ako predanosti ima. Kakva je razlika? Razlika je u dunosti i
ljubavi. Dunost je neto to morate da uradite, ali ne uivate da radite to. Morate da iznesete
to nekako; morate da zavrite to pre. To je samo povran rad. Ako je takav odnos, kako onda
moe prodreti u vas?
Ljubav nije dunost, vi uivate. Ne postoji granica u njenom uivanju, nema urbe da
se zavri to. to je dua, bolje je. Nje nikada nije dovoljno. Uvek oseate neto vie, neto
vie. Ona je uvek nezavrena. Ako je ovakvo dranje, onda stvari idu duboko u vas. Seme
dosee dublju zemlju. Predanost znai da ste u ljubavi sa posebnomabhyasom, praksom.
Posmatram mnoge ljude, radim s mnogim ljudima. Ovo vidim vrlo jasno. Oni koji
praktikuju meditaciju kao da rade samo tehniku, oni nastavljaju da je rade godinama, ali se
promene ne deavaju. To moe pomoi malo, telesno. Oni mogu biti zdraviji, njihova telesna
graa e dobiti neke dobrobiti iz toga. Ali to je samo jedna veba. A onda oni dolaze kod
mene i kau: "Nita se ne dogaa."
Nita se i nee dogoditi, jer nain na koji oni to rade je neto spoljanje, samo posao -
kao kada idu do kancelarije u devet i odlaze iz nje u pet. Bez uea, oni mogu ii u dvoranu
za meditaciju. Mogu meditirati jedan sat i vratiti se natrag, bez uea. To nije u njihovom
srcu.
Druga kategorija ljudi je ona koja to ini s ljubavlju. To nije pitanje da se ini neto.
To nije kvantitativno, to je kvalitativno - koliko ste ukljueni, koliko duboko volite to, koliko
mnogo uivate u tome - nije cilj, nije kraj, nije rezultat, ve sama praksa.
Sufiji kau da je ponavljanje imena boijega - ponavljanje imena Alaha - samo po sebi
blaenstvo. Oni stalno ponavljaju i uivaju. Ovo postaje njihov ceo ivot, samo ponavljanje
imena.
Nanak
26
kae nam smaram - seanje imena je dovoljno. Vi jedete, odlazite da spavate,
kupate se, a neprekidno vae srce je ispunjeno seanjem. Samo stalno ponavljate "Ram" ili
"Alah" ili bilo ta, ali ne kao re, ve kao predanost, kao ljubav.
Celo vae bie osea se ispunjeno, vibrira s tim, to postaje va najdublji dah. Ne
moete iveti bez toga. To postepeno stvara unutarnju harmoniju, muziku. itavo vae bie
zapoinje da pada u harmoniju. Ekstaza se raa, brujea senzacija, slast vas okruuje. Ubrzo
ova slatkoa postaje vaa priroda. Onda ta god da kaete, to postaje ime Alahovo; ta god
kaete, to postaje seanje na boansko.
Svaka praksa bez prekida i sa smernom predanou... za zapadni um je vrlo teka. Oni
mogu razumeti praksu, ali ne mogu razumeti smernu predanost. Oni su potpuno zaboravili taj
jezik, a bez tog jezika prakse zapadni tragaoci dolaze kod mene i kau: "ta god da kaete mi
emo uraditi," i oni slede tano onako kako im je reeno. Ali oni rade na tome upravo kao to
rade na bilo kakvom drugom znanju, tehnici. Oni nisu u ljubavi s tim; oni nisu postali ludi;
oni nisu izgubljeni u tome. Oni ostaju manipulanti.
Oni su majstori, i oni nastavljaju da manipuliu tehnikom ba kao to e sa svakim
mehanikim izumom manipulisati. Upravo kao kada ukljuite dugme i ventilator startuje -
nema potrebe ni za kakvom smernom predanou za dugme ili za ventilator. A sve u ivotu vi
radite tako, ali abhyasa se ne moe raditi na taj nain. Morate biti duboko povezani sa svojom
abhyasom, svojom praksom, tako da vi postanete sporedni, a praksa da postane primarna, da
vi postanete senka, a praksa da postane dua - kao da to niste vi koji vrite praksu. Tako
26
Guru Nanak, duhovni uitelj Sika.
82
praksa poinje da se odvija sama od sebe, a vi ste samo deo nje, vibrirate s njom. Onda moe
biti da nikakvo vreme ne bude potrebno.
Sa dubokom predanou rezultati mogu uslediti odmah. U jednom trenutku predanosti
moete ponititi, otkopati mnogo ivota iz prolosti. U momentu duboke predanosti moete
postati potpuno slobodni od prolosti.
Inae je teko objasniti to, tu smernu predanost. Postoji prijateljstvo, postoji ljubav, ali
postoji i razliit kvalitet prijateljstva plus ljubav to je nazvano smernom predanou.
Prijateljstvo i ljubav postoje izmeu jednakih. Ljubav izmeu suprotnog pola, prijateljstvo s
istim polom, ali na istom nivou - vi ste jednaki.
Saoseanje je upravo suprotno smernoj predanosti. Saoseanje potie od vieg izvora
prema niem izvoru. Sauee je kao reka koja tee sa Himalaja do okeana. Buda je
saoseanje. Ko god doe kod njega, njegovo saoseanje tee nanie. Potovanje je ba
suprotno, kao da Gang tee od okeana prema Himalajima, od nieg prema viem.
Ljubav je izmeu jednakih, saoseanje je od vieg prema niem; predanost je od nieg
prema viem. Saoseanje i predanost su oboje iezli; samo prijateljstvo je ostalo. A bez
sauea i predanosti prijateljstvo samo visi izmeu. Mrtvo, jer dva pola nedostaju. A ono
moe da postoji, ivi, samo izmeu ova dva pola.
Ako ste u predanosti, onda e pre ili kasnije saoseanje zapoeti da tee prema vama.
Ako ste u predanosti, onda e neki vii vrhunac zapoeti da tee prema vama. Ali ako niste u
predanosti, saoseanje ne moe tei prema vama, vi niste otvoreni prema njemu.
Sva abhyasa, sva praksa, je da se postane smeran, najnii tako da najvie moe da
utie u vas - da postanete smerni. Kao to je Isus rekao: "Samo oni koji stoje poslednji,
postae prvi u mom carstvu Bojem."
27
Postanite najnii... poslednji. Iznenada, kada ste najnii, vi ste sposobni da primate
najvie. A samo prema najnioj dubini najvie je privlaeno, povueno. To postaje magnet.
"Sa predanou" znai vi ste najnii. Zbog toga budisti biraju da budu prosjaci, sufiji su
izabrali da budu prosjaci - ba najnii, prosjaci. I vidimo da se u ovim prosjacima dogodilo
ono najvie.
Ali to je njihov izbor. Oni su stavili sebe u poslednje. Oni su zadnji ljudi - ne u
nadmetanju sa nekim, samo slini dolini, niski, najnii.
Zbog toga se u starim sufi izrekama kae: "Postani rob Boiji" - ba rob, ponavljajui
njegovo ime, stalno zahvaljujui njemu, stalno oseajui zahvalnost, stalno ispunjeni s tako
mnogo blagoslova koje je on izlio na vas.
Sa ovim potovanjem i predanou primenjuje se neprekidna praksa, abhyasa.
Patanjali kae da to dvoje, vairagya i abhyasa, pomau da se um obustavi. A kada se um
obustavi, vi onda Jeste, po prvi put, zaista ste ono to ste namenjeni da budete, ono to je vaa
sudbina.
27
"Blago smernima duhom, jer njihovo je carstvo nebesko" - to je pogreno prevedeno u Bibliji kao "blago
siromanima duhom". Radi se o smernosti, o svoenju sebe na pravu, istinitu meru i usklaenost, biti s pravom
merom u odnosu na boansko, otvoren i predan za boansko, a ne o mentalnom siromatvu i tuposti. Biti otvoren
i predan za boansko mogue je jedino predanim smirenjem. Smernost je smirenje; smirenje ovde nastaje kao
rezultat usaglaenosti sa pravom merom (s-mernost) onoga to jeste, sa boanskim. Stoga Isusova izjava zapravo
znai: "Blago onima koji su smirenog uma, njihovo je carstvo nebesko".
83
Poglavlje 8
STANI, I TO JE TU!
1. januara 1974.
Prvo pitanje:
Patanjali je istakao vanost nevezivanja, a to znai, prestanak elja, da se bude
ukorenjen u sebi samom. Inae da li je nevezivanje zaista na poetku putovanja, ili na samom
kraju?
Poetak i kraj nisu dve stvari. Poetak je kraj, stoga ih ne delite i ne razmiljajte u
terminima dualnosti. Ako elite da budete smireni na kraju, moraete da budete smireni od
samog poetka. U poetku tiina e biti kao seme, na kraju e biti kao drvo. Jer drvo je
skriveno u semenu, zato je poetak kao seme.
Koji god da je krajnji cilj, on mora biti skriven ovde i sada, upravo u vama, na samom
poetku. Ako nije tu u poetku, ne moete ga postii na kraju. Naravno, tu e postojati razlika
- u poetku to moe biti samo seme; na kraju to e biti potpuno cvetanje. Moda ga neete
moi prepoznati kada je seme, ali je prisutan bilo da ga prepoznajete ili ne. Tako kada
Patanjali kae da je nuno nevezivanje na samom poetku putovanja, on ne kae da to nee
biti potrebno i na kraju.
Nevezanost u poetku e biti s naporom; nevezanost na kraju e biti spontana. U
poetku vi ete morati da budete svesni toga, na kraju nee biti potrebno da imate svest o
tome. To e biti samo va prirodan tok.
U poetku morate to da praktikujete. Neprekidna budnost e biti potrebna. Postojae
borba s vaom prolou, sa vaim obrascima vezanosti; borba e biti prisutna. Na kraju nee
biti borbe, nema alternative, nema izbora. Vi ete jednostavno tei u pravcu beeljnosti. To e
morati da postane vaa priroda.
Ali zapamtite, koji god da je cilj, on mora biti praktikovan od samog poetka. Prvi
korak je takoe i poslednji. Dakle ovek mora biti vrlo paljiv oko prvog koraka. Ako je u
prvom ispravan smer, samo onda e zadnji biti ostvarljiv. Ako promaite sa prvim korakom,
vi ste promaili sve.
Ovo e dolaziti esto u va um, stoga shvatite to duboko jer mnoge stvari e Patanjali
rei koje izgledaju kao ciljevi. Nenasilje je cilj - kada osoba postane tako saoseajna, tako
duboko ispunjena ljubavlju, da ne postoji nasilje, nema mogunosti za nasilje. Ljubav ili
nenasilje je cilj. Patanjali e rei da praktikujete to od samog poetka.
Cilj mora biti u vaem vidokrugu od samog poetka. Prvi korak putovanja mora biti
potpuno posveen cilju, usmeren prema cilju, kreui se prema cilju. To ne moe biti potpuno
ostvarena stvar u poetku, niti Patanjali oekuje to. Vi ne moete biti totalno nevezani, ali
moete pokuati. Sam napor e vam pomoi.
Imaete neuspeha mnogo puta; esto ete postajati vezani. A va um je takav da ete
ak biti vezani uz nevezivanje. Va obrazac je toliko nesvestan, ali napor, svesni napor,
uskoro e vas uiniti paljivim i svesnim. Jednom kada ponete oseati bedu vezanosti, manja
e biti potreba za naporom, jer niko ne eli da bude jadan, niko ne eli da bude nesrean.
Mi smo nesreni jer ne znamo ta inimo, ali enja u svakom ljudskom biu je prema
srei. Niko ne ezne za patnjom; svako stvara patnju jer ne znamo ta radimo. Ili se mi moda
kreemo u eljama prema srei, ali obrazac naeg uma je takav da se mi zapravo kreemo
prema patnji.
Od samog poetka, kada je dete je roeno, odgajano, pogreni mehanizmi su uvoeni
u njegov um, pogreno dranje je hranjeno. Niko ne pokuava da ga naini pogrenim, ali
pogreni ljudi su svuda okolo. Ono ne moe biti nita drugo, ono je bespomono.
Dete je roeno bez ikakvog obrasca. Samo duboka enja za sreom je prisutna, ali
84
ono ne zna kako da postigne to; nije poznato kako. Ono zna, sasvim sigurno, da ta srea treba
da bude postignuta. Ono e se boriti celog svog ivota, ali sredstva, metode kako to treba da
se postigne, gde to treba da se postigne, gde treba da ide da nae to, ono ne zna. Drutvo ga
ui kako da postigne sreu, a drutvo je u tome pogreno.
Dete eli sreu, ali mi ne znamo da ga nauimo da bude sreno. emu god da ga
uimo to postaje put prema patnji. Na primer, mi ga uimo da bude dobro. Mi ga uimo da ne
ini odreene stvari, a da ini izvesne stvari ak i bez razmiljanja da li je to prirodno ili
neprirodno. Kaemo: "Radi ovo, nemoj raditi ono." Nae "dobro" moe da bude neprirodno -
ako ga neemu uimo da je dobro, a to je neprirodno, onda mu stvaramo obrazac patnje.
Na primer, dete je ljuto, a mi mu kaemo: "Ljutnja je loa. Ne budi ljuto." Inae ljutnja
je prirodna, i samo govorei: "Ne budi ljuto", mi ne unitavamo ljutnju, mi samo uimo dete
da potisne to. Potiskivanje e postati patnja, jer sve to je potisnuto postaje otrovno. To
pokree same hemikalije tela; to je toksino. A neprekidnim uenjem, "Ne budi ljuto," mi ga
uimo da otruje svoj vlastiti sistem.
Jednoj stvari ga ne uimo: kako da ne bude ljuto. Samo ga uimo da suzbija ljutnju. A
mi ga moemo prisiliti zato to je zavisno od nas. Ono je bespomono, mora da nas sledi. Ako
kaemo: "Ne budi ljuto", onda e se ono nasmejati. Taj osmeh e biti laan. Iznutra ono
kljua, unutra je u meteu, unutra postoji vatra, a spolja se smeje.
Malo dete - mi pravimo licemera od njega. Ono postaje lano i podeljeno. Ono zna da
je njegov osmeh laan, njegova ljutnja je prava, ali realno treba da bude potisnuto, a nerealno
da bude forsirano. Ono e biti podvojeno. Ubrzo, podvojenost e postati tako duboka, da kad
god se ono nasmeje, osmeh e biti laan.
A ako ono ne moe biti stvarno ljuto, onda ono ne moe biti stvarno niuemu jer
realnost je odbaena. Ono ne moe izraziti svoju ljubav, ono ne moe izraziti svoju ekstazu -
ono e postati uplaeno od realnog. Ako odbacite deo realnosti, cela realnost je odbaena, jer
realnost ne moe biti podeljena i dete je ne moe deliti.
Jedna stvar je sigurna: dete je dolo do shvatanja da ono nije prihvaeno. Onakvo
kakvo ono jeste, nije prihvatljivo. Realno je ponekad zlo, dakle ono mora biti lano. Ono
mora da koristi spoljni izgled, maske. Jednom kada ono naui ovo, ceo ivot e se kretati u
lanoj dimenziji. A la moe samo voditi do patnje, la ne moe voditi do sree. Samo istina,
autentina realnost, moe vas voditi prema ekstazi, prema vrhuncu iskustva ivota - ljubavi,
radosti, meditaciji, kako god to nazivate.
Svako je odgajan po ovom obrascu, tako da vi eznete za sreom, ali ta god da inite
kreira bedu. Prva stvar prema srei je da prihvatite sebe, a drutvo vas nikada ne ui da
prihvatite sebe. Ono vas ui da osuujete sebe, da budete krivi u pogledu sebe samog, da
odsecate mnoge delove. Ono vas obogaljuje, a obogaljen ovek ne moe dostii cilj. Svi smo
mi obogaljeni.
Vezanost je patnja, ali od samog poetka dete je ueno za vezanost. Majka bi govorila
detetu: "Voli me, ja sam tvoja majka." Otac bi rekao: "Voli me, ja sam tvoj otac" - kao da, ako
je neko otac ili majka, onda on automatski postaje dostojan ljubavi.
Samo da se bude majka ne znai mnogo ili samo da se bude otac ne znai mnogo. Biti
otac znai prolaziti kroz veliku disciplinu. ovek mora da bude dostojan ljubavi. Biti majka
nije samo u raanju. Biti majka podrazumeva veliki trening, veliku unutranju disciplinu.
ovek mora da bude dostojan ljubavi.
Ako majka jeste dostojna ljubavi, onda e je dete voleti bez ikakvog vezivanja. Kad
god ono otkrije da je neko dostojan ljubavi, ono e ga voleti. Ali majke nisu dostojne ljubavi,
oevi nisu dostojni ljubavi; oni nikada nisu razmiljali u ovim terminima - da je ljubav
kvalitet. Vi morate da ga stvorite; vi to morate postati.
Morate da rastete. Samo onda moete stvoriti ljubav u drugima. To ne moe biti
traeno. Ako traite to, to moe biti jedna vezanost, ali ne ljubav. Tako e dete voleti majku
jer je ona njegova majka. Majka ili otac, oni postaju ciljevi. Ovo su uzajamni odnosi, ne
ljubav. Onda ono postane vezano za porodicu, a porodica je destruktivna sila jer porodica
suseda je razjedinjena. Ona nije dostojna ljubavi, jer vi joj ne pripadate. Onda i vaa
zajednica, vaa nacija... jer susedna nacija je neprijatelj.
85
Ne moete voleti celo oveanstvo. Vaa porodica je izvorni uzrok. Porodica vas nije
vaspitala da budete osoba dostojna ljubavi - i osoba koja voli. Ona vas je prisiljavala na neke
uzajamne odnose. Vezanost je uzajamni odnos, a ljubav - ljubav je stanje uma. Va otac vam
nee rei: "Budi pun ljubavi", jer ako ste puni ljubavi moete voleti bilo koga. ak vam
ponekad i sused moe biti vie dostojan ljubavi nego va otac, ali otac to ne moe da prihvati -
da bilo ko moe biti vie dostojan ljubavi od njega, jer je on va otac. Tako uzajamni odnos
treba da bude nauen, ne ljubav.
Ovo je moja drava; zato moram voleti ovu dravu. Ako je jednostavno samo ljubav
nauena - onda mogu da volim svaku dravu. Ali politiari e biti protiv toga, jer ako volim
svaku dravu, ako volim celu Zemlju, onda ne mogu biti uvuen u rat. Dakle politiari e
uiti: "Voli ovu dravu. Ovo je tvoja domovina. Roen si ovde. Pripada ovoj zemlji; tvoj
ivot, tvoja smrt, pripadaju ovoj zemlji." Tako vas oni rtvuju za nju.
Celo drutvo vas ui uzajamnim odnosima, vezivanjima, ne ljubavi. Ljubav je opasna
jer ona ne zna za granice. Ona moe da se kree; ona je sloboda. Dakle vaa ena e vas uiti:
"Voli me jer ja sam tvoja ena." Mu ui enu: "Voli me jer ja sam tvoj mu." Niko ne ui
ljubavi.
Ako bi se ljubav poduavala, onda bi ena rekla: "Ali druga osoba je dostojnija
ljubavi." Ako je svet zaista slobodan da voli, onda samo biti mu ne moe nositi nikakvo
znaenje, samo biti ena ne bi znailo nita. Onda e ljubav slobodno tei. Ali to je opasno;
drutvo ne moe to dozvoliti, porodica ne moe to dozvoliti, religija ne moe to dozvoliti.
Stoga u ime ljubavi oni ue vezanost, i tako je svako u patnji.
Kada Patanjali kae: "Nevezanost", on nije protiv ljubavi. Zaista, on je za
ljubav. Nevezanost znai biti prirodan, pun ljubavi, tean, ali bez opsednutosti i s opsesijom.
Opsesija je problem. Onda je to kao bolest. Vi ne moete voleti nikoga osim svog deteta - to
je opsesija. Onda ete biti u patnji. Vae dete moe umreti; onda nema mogunosti za vau
ljubav da tee. ak i ako vae dete ne umre, ono e odrasti. A to vie odraste, vie e postati
nezavisno. I zato e biti bola. Svaka majka pati, svaki otac pati.
Dete e postati odraslo, ono e se zaljubiti u neku drugu enu. A onda majka pati;
suparnik je uao. Inae, to je zbog vezanosti. Ako majka zaista voli dete, pomoi e mu da
bude nezavisno. Pomoi e mu da se kree u svetu i naini koliko je mogue vie ljubavnih
kontakata, jer e ona znati da to vie volite vie ste ispunjeni. A kada se njeno dete zaljubi u
neku enu, ona e biti srena; plesae od radosti.
Ljubav vam nikada ne daje patnju, jer ako volite nekoga, vi volite njegovu sreu. Ako
ste vezani za nekoga, vi ne volite njegovu sreu, volite samo svoju sebinost; vi ste
usredsreeni samo na svoje vlastite egoistine potrebe.
Frojd je otkrio mnoge stvari. Jedna od njih je majina ili oeva preterana odanost. On
kae da je najopasnija ona majka koja prisiljava dete da je voli toliko da ono postaje u tome
fiksirano, i nee biti sposobno da voli nikoga drugog. Tako ima miliona ljudi koji pate od
takvih preteranih odanosti.
to se tie mog izuavanja drugih ljudi... Gotovo svi muevi, barem devedeset devet
procenata, pokuavaju da nau svoje majke u svojim enama. Naravno, ne moete nai svoju
majku u vaoj eni; vaa ena nije vaa majka. Ali u dubokoj fiksiranosti na majku, oni su
nezadovoljni sa enom jer ona se ne ponaa materinski s njima. A svaka ena traga za ocem u
muu. Nijedan mu nije va otac. Ako nije zadovoljna sa oinskim ponaanjem, onda je
razoarana.
Ovo su fiksacije. U Patanjalijevom jeziku, on ih naziva vezanostima. Frojd ih naziva
fiksacijama. Re se razlikuje ali znaenje je isto. Nemojte biti fiksirani; budite teni.
Nevezanost znai da niste fiksirani. Ne budite kao ledene kocke, budite kao voda - teni. Ne
budite zaleeni.
Svaka vezanost postaje zaleena stvar, mrtva. Ona ne vibrira ivotom; ona nije stalno
pokretan odgovor. Ona nije iz trenutka u tranutak iva, ona je fiksirana. Vi volite osobu - ako
je to ljubav, onda ne moete predvideti ta e se dogoditi sledeeg trenutka. Nemogue je to
predvideti; raspoloenje se menja kao atmosfersko vreme. Ne moete rei da e sledeeg
trenutka va ljubavnik biti zaljubljen u vas. Sledeeg trenutka moda on nee oseati
86
zaljubljenost. Ne moete to oekivati.
Ako sledeeg trenutka on takoe bude voleo vas, to je dobro, vi ste zahvalni. Ako vas
ne voli sledeeg trenutka, nita se ne moe uraditi, vi ste bespomoni. Morate prihvatiti
injenicu da on nema takvu sklonost. Nikako ne plaite zbog toga, jednostavno ne postoji
naklonost! Prihvatite situaciju. Ne prisiljavajte ljubavnika da se pretvara, jer pretvaranje je
opasno.
Ako oseam zaljubljenost prema vama, kaem: "Ja vas volim," ali sledeeg trenutka
mogu rei: "Ne, ja ne oseam nikakvu ljubav u ovom trenutku." Tako postoje dve mogunosti
- bilo da prihvate moje nezaljubljeno raspoloenje, ili prisiljavate: "Bilo da me volite ili ne,
barem pokaite da me volite." Ako me prisiljavate, onda ja postajem neiskren i uzajamni
odnos postaje pretvaranje, licemerje. Onda nismo iskreni jedno prema drugom. A kada dve
osobe nisu iskrene jedna prema drugoj, kako one mogu biti u ljubavi? Njihov uzajamni odnos
e postati fiksiranost.
ena i mu, oni su fiksirani, mrtvi. Sve je odreeno. Oni se ponaaju jedno prema
drugom kao stvari. Doete kod svoje kue, va nametaj e biti isti jer nametaj je mrtav.
Vaa kua e biti ista jer kua je mrtva. Ali ne moete oekivati od svoje ene da bude ista,
ona je iva, ona je osoba. Ako oekujete od nje da bude ista kao to je bila kada ste ostavili
kuu, onda je prisiljavate da bude samo kuni nametaj, samo stvar.
28
Vezanost prisiljava
povezane osobe da budu stvari, a ljubav pomae osobama da budu vie slobodne, da budu
vie nezavisne, da budu vie istinite. Ali istina moe biti samo u stalnom proticanju, ona
nikada ne moe biti zamrznuta.
Kada Patanjali kae: "Nevezanost" on ne kae da ubijete svoju ljubav. On zapravo
kae: "Ubijte sve to truje vau ljubav, ubijte sve prepreke, unitite sve prepreke koje ubijaju
vau ljubav." Samo jogin moe da voli. Svetovna osoba ne moe biti zaljubljena, ona moe
biti samo vezana.
Zapamtite ovo: vezanost oznaava fiksaciju - i ne moete prihvatiti nita novo u njoj,
samo prolost. Ne dozvoljavate sadanjosti, ne dozvoljavate budunosti da ita promeni. A
ivot je promena. Samo smrt je nepromenljiva.
Ako ste nevezani, onda se iz trenutka u trenutak kreete bez ikakvog fiksiranja.
Svakog trenutka ivot e doneti nove sree, nove nevolje. Bie tamnih noi, a bie i sunanih
dana, ali vi ste otvoreni; nemate fiksiran um. Kada nemate fiksiran um ak i bedne situacije ne
mogu vam dati patnju, jer nemate nita da ih uporedite. Niste oekivali neto protiv toga,
stoga ne moete biti frustrirani.
Postajete frustrirani zbog vaih potreba. Mislili ste da kada se vratite kui, vaa ena
e upravo stajati napolju da vam izrazi dobrodolicu. Ako ona ne stoji napolju da vam iskae
dobrodolicu, vi ne moete to prihvatiti. To vam stvara frustraciju i patnju. Vi zahtevate, a
kroz zahtevanje stvarate patnju. Zahtevanje je mogue samo ako ste vezani. Ne moete
zahtevati nita od osobe koja vam je nepoznata. Samo sa vezanou zahtevanje ulazi unutra.
Zbog toga vezivanje postaje pakleno.
Patanjali kae: "Ne budite vezani." To znai tecite, prihvatajte, ta god ivot donese.
Ne zahtevajte i ne prisiljavajte. ivot nee slediti vas. Ne moete prisiliti ivot da bude po
vama. Bolje je tei s rekom nego je gurati. Samo tecite s njom! Postaje mogue mnogo sree.
Ve ima mnogo sree svuda oko vas, ali je ne moete videti zbog vaih pogrenih fiksiranosti.
Inae ova nevezanost u poetku bie samo seme. Na kraju, nevezanost e znaiti
beeljnost, nepostojanje elje. U poetku nevezanost znai nefiksaciju; na kraju nevezanost
znai beeljnost. U poetku, nemanje potreba, na kraju nemanje elja.
Ali ako elite da dostignete taj cilj nemanja elje, zaponite od nemanja potrebe. ak i
za dvadeset etiri asa probajte Patanjalijevu formulu. Samo dvadeset etiri sata tecite s
ivotom ne zahtevajui nita. ta god da ivot d, oseajte zahvalnost, blagodarnost.
Nepristrasno se dvadeset etiri sata kreite u pobonom stanju uma - ne pitajui, ne
zahtevajui, ne oekujui - i imaete novi poetak. Ovih dvadeset etiri sata e postati novi
prozor. I osetiete kako ekstatini moete postati.
28
Ovde Osho govori braku na osnovu iskustva u Indiji, gde je brak formalna institucija strogo determinisana.
87
Ali moraete biti budni u poetku. Ne moe se oekivati da tragaocu nevezanost bude
spontan in.
Drugo pitanje:
Kako to da prosvetljen ovek predaje sebe samo oveku, kao to je Buda to uinio u
sluaju Mahakajape? Zaista, ovo je specifina budistika tradicija da uenik prima svetlost
direktne spoznaje uenja neprekidno tokom osam generacija. Zar nije bilo mogue grupi da
bude njegov primalac?
Ne, to nikada nije mogue jer grupa nema duu, grupa nema Sopstvo. Samo pojedinac
moe biti onaj koji prima, primalac, jer samo individua ima srce. Grupa nije osoba.
Vi ste ovde, ja govorim, ali ja ne govorim grupi jer sa grupom ne moe biti
komunikacije. Ja govorim ovde svakom pojedincu. Vi ste se sakupili u grupi, ali me ne sluate
kao grupa; vi me sluate kao pojedinci. Zaista, grupa ne postoji. Samo pojedinci postoje.
"Grupa" je samo re. Ona nema realnost, nema sutinu. To je samo ime kolektiva.
Ne moete voleti grupu, ne moete voleti naciju, ne moete voleti oveanstvo.
Meutim postoje osobe koje tvrde da vole oveanstvo. One obmanjuju sebe jer ne postoji
nigde nita slino oveanstvu, samo postoje ljudska bia. Idi i trai, nikada nee nigde nai
oveanstvo.
Zaista, one osobe koje tvrde da vole oveanstvo, to su osobe koje ne mogu voleti
osobe. One su nesposobne da budu u ljubavi sa osobama. Otuda velika imena - oveanstvo,
nacija, univerzum. One ak mogu voleti Boga, ali ne mogu voleti osobu, jer da se voli osoba
jeste naporno, teko. To je borba. Morate promeniti sebe. Da volite oveanstvo, nema
problema - ne postoji oveanstvo; vi ste sami. Istina, lepota, ljubav ili bilo ta to je znaajno
uvek pripada pojedincu. Samo pojedinci mogu biti primaoci.
Deset hiljada monaha je bilo tamo kada je Buda izlio svoje bie u Mahakajapu, ali
grupa je bila nesposobna. Nijedna grupa ne moe biti sposobna, jer svest je individualna,
budnost je individualna. Mahakajapa se uzdigao do najvie take gde je mogao da primi
Budu. Druge individue mogu takoe postati najvia taka, ali ne grupa.
Religija u osnovi ostaje individualistika, i to ne moe biti drugaije. To je jedna od
osnovnih borbi izmeu komunizma i religije. Komunizam razmilja u terminima grupe,
drutva, kolektiva, a religija misli u terminima individualne osobe, Sopstva. Komunizam misli
da drutvo moe biti promenjeno kao celina, a religija misli da samo individue mogu biti
promenjene. Drutvo ne moe biti promenjeno kao celina jer drutvo nema duu, ono se ne
moe preobraziti. Zapravo, ne postoji drutvo, samo pojedinci.
Komunizam kae da ne postoje individue, samo drutvo. Komunizam i religija, oni su
potpuno suprotstavljeni, tako da ako komunizam postane nadmoan, onda individualna
sloboda iezava. Onda samo drutvo postoji. Individui zaista nije dozvoljeno da bude tu. Ona
moe postojati samo kao deo, kao zubac u toku. Individui ne moe biti dozvoljeno da bude
svoja.
uo sam jednu anegdotu. Jedan ovek je izvestio moskovsku policiju da je njegov
papagaj izgubljen. Tako je on upuen slubeniku koji je nadlean. Slubenik je zapisao, i
pitao: "Da li papagaj govori? On govori?" ovek se uplaio, malo se uznemirio, bilo mu je
neudobno. ovek je rekao: "Da, on govori. Inae koju god politiku opciju on izraava, te
politike opcije su njegove vlastite!" Papagaj! Ova osoba se uplaila jer papagaj misli da sve
politike opcije koje je uo moraju pripadati njegovom gospodaru. Papagaj jednostavno
imitira.
Individualnost nije dozvoljena. Ne moete imati svoja miljenja. Miljenja su briga
drave, grupnog uma. Grupni um je najnia mogua stvar. Individue mogu dosegnuti vrh;
nijedna grupa ne moe nikada postati slina Budi, ili slina Isusu. Vrhovi su samo
individualni.
Buda predaje svoje itavo ivotno iskustvo Mahakajapi, jer ne postoji drugi nain. To
ne moe biti predato nijednoj grupi. To ne moe biti; to je nemogue. Komunikacija moe biti
samo izmeu dve individue. Ona je lina, duboko lina vera. Grupa je bezlina. I zapamtite da
88
grupa moe uiniti mnoge stvari - mahnitost je mogua u grupi, ali Budinstvo nije mogue.
Grupa moe biti luda, ali grupa ne moe biti prosvetljena.
to je nia pojava, grupa moe u njoj uestvovati vie. Tako svi veliki grehovi su
poinjeni od grupe, ne od pojedinaca. Pojedinac moe da ubije nekoliko ljudi, ali pojedinac ne
moe postati "Faizam", on ne moe ubiti milione. Faizam moe ubiti milione, i to sa
mirnom saveu!
Posle drugog svetskog rata svi ratni zloinci izjasnili su se da oni nisu odgovorni;
njima je samo bilo nareeno odozgo, i oni su sledili nareenja. Oni su samo bili deo grupe.
ak i Hitler i Musolini su bili veoma mnogo osetljivi u svojim privatnim ivotima. Hitler je
imao obiaj da slua muziku, voleo je muziku. Ponekad je ak imao obiaj da slika, voleo je
slikanje. Izgleda nemogue, Hitler je voleo slikanje, tako osetljivo, a ubijao je milione Jevreja
bez ikakve neugodnosti, bez ikakvog nemira u svojoj savesti, ak i bez truke savesti. On "nije
bio odgovoran". Onda je on bio voa grupe.
Kada se kreete u gomili, moete poiniti sve jer oseate: "Gomila to ini. Ja sam
samo deo nje." Sami, vi ete promisliti tri puta, da li da to uinite ili ne. U gomili odgovornost
se gubi, vae individualno miljenje se gubi, vaa diskriminacija se gubi, vaa svesnost se
gubi. Vi postajete samo deo gomile. Gomila moe da poludi. Svaka zemlja zna, svako vreme
zna da gomila moe da poludi, a onda mogu uiniti sve. Inae nikada se nije ulo da gomila
moe postati prosvetljena.
Via stanja svesnosti mogu da postignu samo pojedinci. Vie odgovornosti mora da se
oseti - vie individualne odgovornosti, vie svesnosti. to vie oseate da ste odgovorni, vie
oseate da morate biti svesni, vie postajete individualni.
Buda saoptava Mahakajapi svoje tiho iskustvo, svoj mirni sambodhi, svoje tiho
prosvetljenje, jer Mahakajapa je takoe postao vrh, visina, a dve visine sada mogu da se
sretnu. To e uvek biti tako. Dakle, ako elite da dosegnete najvii vrh, ne razmiljajte u
terminima grupa, razmiljajte u terminima svog vlastitog identiteta. Grupa moe biti korisna u
poetku, ali to vie rastete, grupa sve manje i manje moe da bude korisna.
Nastupa taka kada grupa ne moe biti ni od kakve pomoi, vi ste ostavljeni sami. A
kada ste totalno sami i poinjete da rastete iz svoje osamljenosti, po prvi put ste se
kristalizovali. Vi postajete dua, Sopstvo.
Tree pitanje:
Praksa je vrsta uslovljavanja na fizikom i mentalnom nivou, a kroz uslovljavanje
drutvo dri oveka svojim robom. U tom sluaju kako je Patanjalijeva praksa orue za
oslobaanje?
Drutvo vas uslovljava da bi od vas nainilo roba, poslunog lana, tako da pitanje
izgleda valjano - kako novo uslovljavanje uma moe da nas oslobodi? Pitanje izgleda
ispravno samo zato jer vi brkate dva tipa uslovljavanja.
Doli ste kod mene, preli ste put. Kada se vraate natrag, putovaete istim putem. Um
moe da pita: "Put koji me je doveo ovde, kako moe da me vrati natrag, isti put?" Staza e
biti ista, va pravac e biti razliit - sasvim suprotan. Dok ste dolazili prema meni vi ste bili
okrenuti licem prema meni, kada odlazite okreete lice u suprotnom pravcu, a staza e biti
ista.
Drutvo vas uslovljava da vas naini poslunim lanom, da vas naini robom. To je
samo put. Isti put treba da se pree da vas uini slobodnim, samo pravac treba da bude
suprotan. Ista metoda treba da se koristi da se oslobodite uslovljenosti.
Seam se jedne parabole. Jednom je Buda doao kod svojih monaha; iao je da odri
propoved. Seo je ispod drveta. U ruci je drao maramicu. itavo bratstvo je posmatralo ta on
radi. Onda je on vezao pet vorova na maramici i pitao: "ta treba da uinim da bih odvezao
vorove ove maramice? ta treba da uinim?" Postavio je dva pitanja. Jedno: "Da li je
maramica ista kada nije bilo vorova na njoj ili je razliita?"
Jedan bhikkhu, jedan monah, je rekao: "U nekom smislu je ista jer se kvalitet
maramice nije promenio. ak i sa vorovima ona je ista, ista maramica. Unutranja priroda
89
ostaje ista. Ali u jednom smislu se promenila jer se neto novo pojavilo. vorova nije bilo, a
sada vorova ima. Dakle, povrinski ona se promenila, ali duboko dole ona je ostala ista."
Buda je rekao: "Ovo je stanje ljudskog uma. Duboko dole on ostaje nevezan u
vorove. Kvalitet ostaje isti." Kada postanete Buda, prosvetljen ovek, vi neete imati
razliitu svest. Kvalitet e biti isti. Razlika je samo da ste sada vezani u vorove kao
maramica; vaa svest ima nekoliko vorova.
Druga stvar, pitao je Buda: "ta treba da uradim da bih razvezao vorove na
maramici?" Drugi monah je rekao: "Dok ne znamo kako ste je vezali u vorove, ne moemo
rei nita, jer e morati da se primeni obrnuti proces. Nain na koji ste napravili vorove prvo
mora da se zna, jer e to u obrnutom redosledu biti opet put da se odveu vorovi." Onda je
Buda rekao: "To je druga stvar. Kako ste doli u ovo ropstvo, to treba razumeti. Kako ste
uslovljeni u vaem ropstvu, to treba razumeti, jer isti e biti proces, u obrnutom redosledu, da
se oslobodite uslovljenosti."
Ako je vezanost uslovljavajui faktor, onda e nevezanost biti faktor oslobaanja
uslovljenosti. Ako vas oekivanje vodi u patnju, onda neoekivanje e vas voditi u nemanje
patnje. Ako ljutnja stvara pakao u vama, onda saoseanje e kreirati raj. Dakle kakav god da
je proces patnje, obrnuto e biti proces sree. Oslobaanje od uslovljavanja znai da ste
razumeli ceo proces vezivanja u vor ljudske svesti, kakav on jeste. Ceo proces joge je nita
drugo do razumevanje sloenih vorova i njihovo odvezivanje, oslobaanje od njihovog
uslovljavanja. To nije preuslovljavanje, zapamtite. To je jednostavno uklanjanje
uslovljavanja; to je obratan proces. Ako bi to bilo preuslovljavanje, onda biste opet postali rob
- novi tip roba i novo utamnienje. Dakle ovu razliku treba zapamtiti: to je oslobaanje od
uslovljenosti, ne preuslovljavanje.
Zbog ovoga su nastali mnogi problemi. Krinamurti stalno govori da ako bilo ta
uinite to e postati preuslovljavanje, stoga ne inite nita. Ako uinite ma ta, to e postati
preuslovljavanje, moete biti bolji rob, ali ete ostati rob. Sluajui njega, mnogi ljudi su
prekinuli sve delatnosti. Ali to ih nije uinilo osloboenim. Oni nisu osloboeni. Uslovljenost
je prisutna. Oni se ne preuslovljavaju. Sluajui Krinamurtija, oni su se zaustavili, oni nisu
preuslovljeni. Ali takoe nisu ni osloboeni uslovljenosti. Oni ostaju robovi.
Zato ja ne preuslovljavam, niti je Patanjali za preuslovljavanje, za prepravljanje. Ja
sam za oslobaanje od uslovljavanja, i Patanjali je takoe za uklanjanje uslovljavanja. Samo
razumite um. Koja god da je bolest, razumite bolest, dijagnostikujte je, i uklonite u obrnutom
sledu.
Kakva je razlika? Uzmimo neki realan primer. Ljutnja je uslovljavanje; to ste nauili.
Psiholozi kau da je to naueno, to je programirana stvar. Vae drutvo vas ui tome. Postoje
ak i sada drutva koja se nikada ne ljute. Postoje drutva, male plemenske zajednice jo
postoje, koje nikada nisu upoznale nikakvu borbu, nisu ratovali.
Na Filipinima, postoje mala praistorijska plemena. Za tri hiljade godina nisu upoznala
nikakvu borbu, nijedno ubistvo, nijedno samoubistvo. ta se dogodilo njima? Oni su najvei
ljubitelji mira, najsreniji. Njihovo drutvo od samog poetka nikada ih ne uslovljava za
ljutnju. U tom plemenu, ak i u vaim snovima ako ubijete nekoga, morate otii i moliti za
oprotaj - ak i u snu. Ako se naljutite na nekoga u snu i potuete se, sledeeg dana morate
objaviti selu da ste uradili neto pogreno. Onda e se selo sakupiti zajedno, i mudri ljudi e
postaviti dijagnozu vaeg sna i preporuie vam ta sada treba da uradite - ak i mala deca!
itao sam analize njihovih snova. Izgleda da su oni jedni od najpronicljivijih ljudi.
Malo dete sanja. U snu ono vidi deaka iz susedstva, vrlo tunog. Ono ispria san svom ocu
ujutru: "Video sam deaka iz susedstva vrlo tunog." Tako otac razmilja o tome, zatvori
svoje oi, meditira, i onda kae: "Ako si ga video tunog, to znai na neki nain je njegova
alost povezana s tobom. Niko drugi nije sanjao o njemu da je on tuan, tako da si znajui i
neznajui uinio neto to je stvorilo njegovu alost. Ili, ako ti nisi uradio, u budunosti e to
uraditi. Dakle, san je samo predskazanje za budunost. Idi sa mnogo slatkia, mnogo poklona.
Daj slatkie i poklone deaku za njegov oprotaj - bilo da je neto uinjeno u prolosti ili e
neto uraditi u budunosti."
Tako dete odlazi, daje voe, slatkie, darove, i moli njegov oprotaj jer je nekako, u
90
snu, on odgovoran za njegovu alost. Od samog poetka dete se odgaja na taj nain. Ako je
ovo pleme postojalo bez borbe, ubistva, samoubistva, to nije udo. Oni ne mogu to pojmiti.
Drugaija vrsta uma tamo funkcionie.
Psiholozi kau da mrnja ili ljutnja nisu prirodni. Ljubav je prirodna; mrnja i ljutnja
su samo stvorene. One su prepreka u ljubavi, i drutvo vas uslovljava njima. Neuslovljavanje
znai da ta god je drutvo uradilo, ono je uradilo. Nema koristi nastavljati osuivati ga; to je
ve sluaj. Govorei jednostavno da je drutvo odgovorno, vama se ne pomae. To je
uraeno. Sada, ba sada, moete ukloniti uslovljenost. Dakle, kakav god da je va problem,
pogledajte duboko u problem. Prodrite u njega, analizirajte ga, i vidite kako ste uslovljeni
njime.
Na primer, postoje drutva koja nikada ne oseaju nadmetanje. ak u Indiji, ima
drevnih plemena u kojima ne postoji nadmetanje. Naravno, oni ne mogu biti mnogo napredni
po naim merilima, jer na napredak moe jedino da bude kroz nadmetanje. Oni nisu
konkurentni. Zato to nisu konkurentni, oni nisu ljuti, nisu ljubomorni, nisu tako ispunjeni
mrnjom, nisu nasilni. Oni ne oekuju mnogo, a s onim ta god da im ivot d, oseaju se
sreni i zahvalni.
Vama, ma ta da ivot d, vi se neete oseati zahvalni. Uvek ete biti frustrirani, jer
uvek traite vie. I nema kraja vaim oekivanjima i eljama. Tako, ako se oseate bedno,
pogledajte u nevolju i analizirajte je. Koji su uslovljavajui faktori koji kreiraju patnju? Nije
mnogo teko da se to razume. Ako moete stvoriti patnju, ako ste tako sposobni da stvorite
nevolju, nije teko razumeti je. Ako je moete stvoriti, moete je razumeti.
itavo Patanjalijevo gledite je ovo: posmatrajui ljudsku patnju, otkriveno je da je
ovek sam odgovoran za nju. On ini neto da bi je stvorio. To injenje je postalo navika, tako
da on nastavlja to da ini. To je postalo ponavljanje, mehaniko, slino robotu. Ako postanete
paljivi, moete odbaciti to. Moete jednostavno rei: "Neu u tome da uestvujem."
Mehanizam e prestati da radi.
Neko vas uvredi. Vi samo ostanite mirni, ostanite tihi. Mehanizam e zapoeti, on e
doneti proli obrazac. Ljutnja e dolaziti, dim e se dizati, a vi ete se oseati na ivici da
postanete ludi. Ali mirujte. Nemojte saraivati i samo posmatrajte ta mehanizam ini.
Osetiete obrtanja, kotrljanja unutra u vama, ali ona su nemona jer vi ne saraujete.
Ili, ako oseate da je nemogue ostati u takvom mirnom stanju, onda zatvorite svoja
vrata, krenite u sobu, uzmite jastuk i udarajte po jastuku. Budite ljuti na jastuk. A kada ga
udarate, postajui ljuti i ludi s jastukom, samo nastavite da posmatrate ta radite, ta se
dogaa, kako se obrazac sam ponavlja.
Ako moete ostati mirni, to je najbolje. Ako oseate da je to teko, povucite se, onda
krenite u sobu i budite ljuti na jastuk, jer s jastukom svoju ludost moete potpuno da vidite;
ona e postati transparentna. A jastuk nee reagovati pa moete posmatrati mnogo lake. Ne
postoji opasnost, nema, ne postoji problem bezbednosti. Moete posmatrati. Lagano,
podizanje ljutnje i opadanje ljutnje.
Posmatrajte oboje, ritam. A kada je vaa ljutnja iscrpljena, ne oseate se vie kao da
udarate jastuk, ili ste zapoeli da se smejete ili se oseate smenim, zatvorite svoje oi, sednite
na pod, i meditirajte o tome ta se deavalo. Da li jo uvek oseate ljutnju prema osobi koja
vas je uvredila, ili je to izbaeno na jastuk? Oseate neki mir koji vas obuzima. Neete oseati
ljutnju sad na dotinu osobu. Pre ete oseati saoseanje prema njoj.
Pre dve godine ovde je bio jedan ameriki mladi. On je pobegao iz Amerike samo
zbog jednog problema, jedne opsesije: stalno je mislio da ubije svog oca. Otac mora da je bio
opasan ovek; mora da je previe guio ovog mladia. U svojim snovima razmiljao je da
ubije, u svojim dnevnim sanjarenjima takoe je razmiljao da ubije svog oca. Pobegao je od
kue samo zato da ne bude blizu oca. Inae, svakog dana neto se moglo dogoditi. Kad je
ludilo tu, ono moe buknuti svakog momenta.
Bio je ovde sa mnom. Rekao sam mu: "Nemoj guiti to." Dao sam mu jastuk i rekao:
"Ovo je tvoj otac. Sada uini ta god eli." U poetku je poeo da se smeje, smejao se
ludaki. Rekao je: "To izgleda smeno." Ja sam mu rekao: "Pusti neka bude smeno. Ako je to
u umu, pusti to da izae." Petnaest dana je on stalno tukao i cepao jastuk, i radio je to.
91
esnaestog dana je doao s noem. Ja mu to nisam rekao. Pa sam ga pitao: "ta e ti taj no?"
Rekao je: "Sada me ne zaustavljaj. Pusti me da ubijem. Sada jastuk nije za mene
jastuk. Jastuk je zaista postao moj otac." Tog dana je ubio svoga oca. Onda je poeo da plae;
suze su lile iz njegovih oiju. Postao je smiren, oputen i rekao mi je: "Oseam mnogo ljubavi
prema mom ocu, mnogo saoseanja. Dozvoli mi sada da se vratim natrag."
On se vratio sada. Odnos se potpuno promenio. ta se dogodilo? Samo je mehanika
opsesija izbaena.
Ako moete ostati mirni kada neki stari obrazac hvata va um, to je dobro. Ako ne
moete, onda mu dozvolite da se dogodi na dramatian nain, ali sam, ne sa nekim. Jer kad
god ispoljavate va obrazac, i to delite sa nekim, to stvara novu reakciju i to je zaarani krug.
Najznaajnija stvar je da se bude paljiv za obrazac - bilo da stojite smireno ili
odraujete vau ljutnju i mrnju - paljivo posmatrajte kako se odvija. Ako moete uvideti
mehanizam, moete ga ponititi.
Svi koraci u jogi su samo za ponitavanje neega to ste inili. Oni su negativni; nita
novo ne treba da se kreira. Samo nepravilno treba da bude poniteno, i ispravno je ve tu.
Nita pozitivno ne treba da se ini, samo neto negativno. Pozitivno je skriveno tu. To je ba
kao to je potok tu, skriven ispod stene. Vi ne treba da stvarate potok. Stena je tu. Stena mora
da bude uklonjena. Jednom kada je stena uklonjena, potok zapoinje da tee.
Blaenstvo, srea, radost ili kako god da to nazivate je tu, ve tee u vama. Samo neke
stene su tu. Ove stene su uslovljavanja iz drutva. Uklonite njihovo uslovljavanje. Ako
oseate vezanost, ona je stena, onda uinite napor za nevezivanje. Ako oseate ljutnju, ona je
stena, onda uloite napore za nemanje ljutnje. Ako oseate poudu, ona je stena, onda uloite
napore za nemanje poude. Samo uinite suprotno. Nemojte guiti poudu. Samo inite
suprotno, uinite neto to nije poudno. Nemojte samo potiskivati ljutnju; inite neto to
nije ljutnja.
U Japanu, kada se neko naljuti, imaju tradicionalno uenje. Ako se neko naljuti,
odmah mora da uini neto to nije ljutnja. Ista energija koja bi krenula u ljutnju, odlazi u ne-
ljutnju. Energija je neutralna. Ako oseate ljutnju na nekoga i elite da ga oamarite, dajte mu
cvet i posmatrajte ta se dogaa.
elite da ga tresnete po licu, elite da uinite neto - to je bila ljutnja. Dajte mu cvet i
samo posmatrajte ta se dogaa u vama - vi inite neto to je suprotno od ljutnje. Ista
energija koja je htela da pokrenete svoju ruku, pokrenue vae srce. Ista energija koja je htela
da ga udari sada e mu dati cvet. Ali kvalitet se promenio. Uinili ste neto. A energija je
neutralna. Ako ne uinite neto, onda vi potiskujete - a potiskivanje je otrovno. Uinite neto,
ali samo suprotno. I to nee biti novo uslovljavanje, bie samo uklanjanje starog
uslovljavanja. Kada je staro iezlo, kada energetski vorovi nestanu, nije nuno da brinete ni
o emu. Onda moete tei spontano.
Poslednje, etvrto pitanje:
Rekli ste da duhovno nastojanje moe da uzme dvadeset do trideset godina ivota, ili
ak ivot, i da je ak i toliko nedovoljno. Meutim, zapadni um izgleda da je orijentisan na
rezultate, nestrpljiv i previe praktian. On eli odmah rezultate. Religijske tehnike dolaze i
odlaze kao drugi hirovi na zapadu. Kako onda nameravate da uvedete jogu u zapadni um?
Ja nisam zainteresovan za zapadni um ili istoni um. To su dva aspekta uma. Ja sam
zainteresovan za sm um. A ova istono-zapadna dihotomija nije mnogo znaajna, nije ak
bitna sada. Ima istonih umova na Zapadu, a ima i zapadnih umova na Istoku. Sada je cela
stvar postala izmeana. Stari Istok je potpuno nestao.
Seam se taoistike anegdote. Tri taoista su meditirali u peini. Jedna godina je prola.
Bili su smireni, sedeli su i meditirali. Jednog dana je proao u blizini jedan konjanik. Oni su
ga ugledali. Jedan od trojice pustinjaka je rekao: "Konj koga je jahao bio je beo." Druga
dvojica su ostali nemi. Posle jedne godine, drugi pustinjak je rekao: "Konj je bio crn, nije bio
beo." Onda je opet prola jo jedna godina. Trei pustinjak je rekao: "Ako e biti rasprave, i
svae ja odlazim! Odlazim! Ometate moju tiinu!"
92
ta znai da li je konj bio beo ili crn? Tri godine. Meutim, ovakav je tok na Istoku.
Vremena nema. Istok nije svestan vremena uopte. Istok ivi u venosti, kao da vreme ne
prolazi. Sve je bilo statino.
Ali taj Istok vie ne postoji. Zapad je pokvario sve; Istok je nestao. Kroz zapadno
obrazovanje sada je sve zapadno. Samo je nekoliko ljudi slinih ostrvima koji su istonjaci -
oni mogu biti na Zapadu, mogu biti na Istoku, nisu ni na koji nain ogranieni na Istoku.
Inae svet kao celina, svet u potpunosti je postao zapadni.
Joga kae - i pustite da to prodre u vas vrlo duboko jer e to biti vrlo znaajno - joga
kae da to ste vie nestrpljivi, vie vremena e biti potrebno za va preobraaj. to ste vie u
urbi, vie ete biti zadrani. urba stvara takvu konfuziju da e odlaganje biti rezultat.
to ste manje u urbi, ranije e biti rezultata. Ako ste beskonano strpljivi, ba ovog
momenta transformacija se moe dogoditi. Ako ste spremni da ekate zauvek, moda neete
ekati ak ni do sledeeg trenutka. Ba ovog momenta stvar se moe dogoditi, jer to nije
pitanje vremena, to je pitanje kvaliteta vaeg uma.
29
Beskonano strpljenje. Jednostavno nemanje enje za rezultatima daje vam mnogo
dubine. urba vas ini plitkim. Vi ste u takvoj urbi da ne moete biti duboki. Ovog trenutka
vi niste zainteresovani ovde u ovom momentu, nego ta e se dogoditi u sledeem.
Zainteresovani ste za rezultat. Kreete se ispred sebe; vaa dinamika je luda. Tako moete
juriti previe, moete putovati previe, a da ne stignete nigde jer cilj koji treba postii je
upravo ve ovde. Treba da se bacite u to, ne da ga dostiete bilo gde. A baciti se moete samo
ako ste potpuno strpljivi.
Reci u vam jednu zen anegdotu. Jedan zen monah je prolazio kroz umu. Iznenada je
postao svestan da ga tigar sledi, pa je poeo da tri. Ali njegovo tranje je zenovskog tipa; on
se nije urio. On nije lud. Njegovo tranje je takoe glatko, harmonino. Uivao je u tome.
Reeno je da monah misli u umu: "Ako tigar uiva u tome, zato ne bih ja?"
A tigar ga je sledio. Onda je doao blizu provalije. Upravo da bi pobegao od tigra
obesio se o granu drveta. Onda je pogledao dole. Drugi tigar je stajao dole ekajui na njega.
Onda je stigao i prvi tigar, stao je pokraj drveta na vrhu breuljka. On je visio izmeu, samo
na grani, a tigar je ekao dole na njega. On se smejao. Onda je pogledao. Dva mia su upravo
grickala granu... jedan beo, a jedan crn. Onda se on nasmejao vrlo glasno. Rekao je: "Ovo je
ivot. Dan i no, beo i crni mi grickaju. Gde god da krenem, smrt me eka. Ovo je ivot!"
Reeno je da je tada dostigao satori - prvo svetlucanje prosvetljenja. To je ivot! Nita ne
treba brinuti; tako stvari idu. Gde god krenete smrt eka, a ak i ako ne idete nikuda, dan i no
seckaju va ivot. Stoga se on glasno smejao.
Onda je pogledao okolo, jer sada je fiksiran. Sada nema brige. Kada je smrt sigurna,
emu briga? Samo u nesigurnosti ima brige. Kada je sve izvesno, nema brige; sada je to
postala sudbina. Stoga je traio kako da uiva u ovih nekoliko trenutaka. Opazio je upravo
pored grane nekoliko jagoda, ubrao ih i pojeo. Bile su najbolje u njegovom ivotu. Uivao je
u njima, i kae se da je tog trenutka postao prosvetljen.
Postao je Buda jer smrt je tako blizu da ak ni tada nije bio u urbi. Mogao je da uiva
u jagodama. To je slatko! Ukus je sladak! On zahvaljuje Bogu. Kae se da u tom trenutku sve
nestaje - tigrovi, grana, on sam. On je postao kosmos.
Ovo je strpljenje, apsolutno strpljenje! Gde god da ste, u tom trenutku uivajte bez
pitanja za budunost. Nema budunosti u umu - samo sadanji trenutak, sadanjost trenutka, i
vi ste ispunjeni. Onda nije potrebno da se ide nigde. Gde god ste, sa same te take vi ete se
baciti u okean; postaete jedno s kosmosom.
Inae um nije zainteresovan za ovde i sada. Um je zainteresovan za neku budunost,
za neke rezultate. Dakle, pitanje je, na nain relevantan za takav um, moderan um, hoe li biti
bolje nazvati ga tako, nego zapadnim. Moderan um je stalno opsednut budunou, sa
rezultatima, ne sa ovde i sada.
Kako se taj um moe nauiti jogi? Ovaj um se moe nauiti jogi jer ova orijentacija ka
budunosti ne vodi nigde. Ova orijentacija ka budunosti je kreiranje konstantne patnje za
29
Um projektuje vreme. Bez relativnog (misaonog) uma nema relativnog (linearnog) vremena. Transcendencija
vremena je transcendencija uma - i obrnuto. To je cilj joge.
93
moderan um. Mi smo stvorili pakao, stvorili smo ga previe. Sada, ili e ovek morati da
iezne sa ove planete zemlje, ili e morati da preobrazi sebe. Ili e oveanstvo morati da
umre kompletno - jer ovaj pakao se vie ne moe nastaviti - ili emo mi morati da proemo
kroz preobraaj.
Otuda, joga moe postati vrlo sadrajna i bitna za moderni um, jer joga moe da
izbavi. Ona vas moe nauiti kako da budete ovde i sada - kako da zaboravite prolost, kako
da zaboravite budunost, i kako da ostanete u sadanjem trenutku sa takvim intenzitetom da
ovaj trenutak postane bezvremen, sam trenutak da postane venost.
Patanjali moe postati sve vie i vie znaajan. Kako se ovo stolee primie svom
kraju, tehnike o ljudskom preobraaju e postati sve vanije i vanije. One ve nastaju svuda
u svetu - bilo da ih nazivate joga, zen ili sufi metodama ili ih nazivate tantra metodama. Na
mnogo, mnogo naina, sve stare tradicionalne tehnike se razbuktavaju. Neka duboka potreba
postoji, a oni koji razmiljaju, svuda, u bilo kom delu sveta, postaju zainteresovani da otkriju
ponovo kako je oveanstvo u prolosti ivelo sa takvim blaenstvom, takvim ushienjem. Sa
tako nepovoljnim uslovima, kako su i bogati ljudi iveli u prolosti, a mi, s tako bogatim
stanjem, zato smo mi tako jadni.
Ovo je paradoks, moderni paradoks. Po prvi put na zemlji mi smo stvorili bogata,
nauna drutva, a ona su najrunija i najnesrenija. A u prolosti nije bilo naune tehnologije,
ni obilja, nita od udobnosti, ali oveanstvo je ivelo u tako duboko mirnoj ivotnoj sredini -
sreno, zahvalno. ta se dogodilo? Moemo biti sreniji nego ikada, ali smo izgubili kontakt
sa egzistencijom.
Ta egzistencija je ovde i sada, a nestrpljiv um ne moe biti u kontaktu s njom.
Nestrpljenje je kao grozniavo, ludo stanje uma; vi stalno trite. ak i ako cilj doe, ne
moete stati tamo, jer jurenje je postalo vaa navika. ak i ako postignete cilj vi ete ga
promaiti, vi ete ga propustiti jer se ne moete zaustaviti. Ako se moete zaustaviti, cilj se ne
treba traiti.
Zen majstor Hui-Hai je rekao: "Trai, i izgubie; ne trai i dobie to odmah. Stani, i
to je ovde. Tri, i nema ga nigde."
94
Poglavlje 9
PRAKSA I BEELJNOST
3. januar 1974.
I, 15: drtanuravikaviayavitrinasya vaikarasamjna vairagyam.
Oseanje da se zagospodarilo (vaikarasamjna) u sluaju onoga koji ne osea
vie e ni za objektima iz oblasti ula niti za onima iz oblasti slovesnosti
(anusravikaviaya) oznaava se [tehnikim terminom] - proienost (vairagya).
I, 16: tatparam puruakyatergunavaitrnyam.
Ova je [proienost] dostigla vrhunac kada se u zrenju sve-transcendirajue-
subjektivnosti (purua) i e za [samim] energetskim izvorima [u kojima su i sve
potencijalnosti prisutne] (guna) - gubi.
Abhyasa i vairagya - stalna unutarnja praksa i beeljnost; to su dva osnovna kamena
temeljca Patanjalijeve joge. Konstantan unutarnji napor je potreban jer neto treba da se
postigne, ali zbog pogrenih navika. Borba nije protiv prirode, borba je protiv navika. Priroda
je tu, svakog momenta dostupna da se ulije, da postane jedno s tim, ali ste dobili pogrean
obrazac navika. Ove navike stvaraju prepreke. Borba je protiv ovih navika, a dok se one ne
unite, priroda, vaa sutinska priroda, ne moe tei, ne moe se kretati, ne moe dostii
sudbinu za koju je namenjena da bude.
Stoga zapamtite prvu stvar: borba nije protiv prirode. Borba je protiv pogrenog
vaspitanja, pogrenih navika. Vi se ne borite sa sobom; vi se borite s neim drugim to je bilo
uvreno u vama. Ako se ovo ne shvati pravilno, onda svi vai napori mogu ii u pogrenom
pravcu. Moete zapoeti da se borite sa sobom, a ako jednom zaponete borbu sa sobom vi
bijete izgubljenu bitku. Nikada ne moete biti pobednik. Ko e biti pobednik, a ko e biti
pobeeni? - jer vi ste oboje. Onaj ko se bori i onaj s kim se borite je isti.
Ako obe moje ruke ponu da se bore, ko e pobediti? Jednom kada zaponete da se
borite sa sobom vi ste gubitnik. A tako mnogo osoba, u svojim nastojanjima, u svom traganju
za duhovnom istinom, padaju u tu greku. Oni postaju rtve ove greke; oni zapoinju da se
bore sa sobom. Ako se borite sa sobom, postaete sve vie i vie umobolni. Biete vie i vie
podeljeni, rascepljeni. Postaete izofreniar. To je ono to se deava na Zapadu.
Hrianstvo je uilo - ne Hrist - hrianska crkva je uila da se borite sa sobom, da
osuujete sebe, da poriete sebe. Hrianstvo je stvorilo veliku podelu izmeu nieg i vieg.
Nema nieg vieg i nieg u vama, ali hrianstvo govori o niem biu i viem biu, ili telu i
dui. Hrianstvo vas na neki nain deli i stvara borbu. Ova borba e biti beskrajna; nee
voditi nigde. Krajnji rezultat moe samo da bude samounitenje, izofrenini haos. To je ono
to se dogodilo na Zapadu.
Joga vas nikada ne deli, ali jo uvek postoji borba. Borba nije protiv vae prirode.
Naprotiv, borba je za vau prirodu. Vi imate akumulirane mnoge navike. Ove navike su vaa
postignua pogrenih obrazaca iz mnogih ivota. Zbog ovih pogrenih obrazaca vaa priroda
ne moe da se kree spontano, ne moe da tee spontano, ne moe da dosegne svoju sudbinu.
Ove navike moraju biti unitene, i one su samo navike. One vam mogu izgledati kao priroda
jer ste im se tako mnogo prepustili. Moda ste postali identifikovani s njima, ali one nisu vi.
Ova razlika mora jasno da se ima na umu, inae moete pogreno protumaiti
Patanjalija. Sve to je dolo u vas spolja i pogreno je, mora da bude uniteno tako da ono
to je u vama moe da tee, moe da cveta. Abhyasa, neprekidna unutarnja praksa, je protiv
navika.
Druga stvar, drugi kamen temeljac, je vairagya, beeljnost. To vas takoe moe voditi
u pogrenom pravcu. I zapamtite, ovo nisu pravila, ovo su jednostavno uputstva. Kada kaem
95
da ovo nisu pravila, mislim da ne treba da se slede kao neka opsesija. Njih treba razumeti -
smisao, znaenje. A to znaenje treba da bude uneto u ovekov ivot.
To e biti razliito za svakoga, stoga to nije fiksno pravilo. Ne treba da sledite to
dogmatski. Treba da razumete njihovo znaenje i da im dozvolite da rastu u vama. Cvetanje
e biti razliito kod svakog pojedinca. Dakle, to nisu mrtva, dogmatska pravila, ovo su
jednostavna uputstva. Ona pokazuju pravac. Ona vam ne daju detalje.
Seam se jednom je Mula Nasrudin radio kao uvar u muzeju. Prvog dana kada je
postavljen, pitao je za pravila: "Koja pravila treba da se slede?" Data mu je knjiga pravila koja
treba da slede uvari. On ih je zapamtio; uloio je svu brigu da ne zaboravi nijedan detalj.
Prvog dana kada je bio na dunosti, doao je prvi posetilac. Rekao je posetiocu da
ostavi svoj kiobran tamo spolja kod njega na vratima. Posetilac je bio zapanjen. Rekao je:
"Ali ja nemam nikakav kiobran." Na to je Nasrudin rekao: "U tom sluaju, moraete da se
vratite natrag. Donesite jedan kiobran jer to je pravilo. Dok posetilac ne ostavi svoj kiobran
ovde spolja, ne moe mu se dozvoliti da ue unutra."
Ima mnogo ljudi koji su opsednuti pravilima. Oni ih slede slepo. Patanjali nije
zainteresovan da vam daje pravila. Sve to e on uraditi je da vam da jednostavna uputstva -
ne da bi se sledila, nego da bi se razumela. Sleenje e proizai iz tog razumevanja. A obrnuto
ne moe da se dogodi - ako sledite pravila, razumevanje nee doi; ako razumete pravila,
sleenje e doi automatski, kao senka.
Beeljnost je uputstvo. Ako sledite to kao pravilo, onda ete zapoeti da ubijate svoje
elje. Mnogi su to uradili, milioni su to uradili. Oni ponu da ubijaju svoje elje. Naravno,
ovo je matematiki, ovo je logiki. Ako beeljnost treba da se postigne, onda je ovo najbolji
put: da se ubiju sve elje. Onda ete biti bez elja. Ali takoe ete biti i mrtvi. Vi ste sledili
pravilo tano, ali ako ubijete sve elje vi ubijate sebe, izvravate samoubistvo - jer elje nisu
samo elje, one su tok ivotne energije. Beeljnost treba da se postigne bez ubijanja iega.
Beeljnost treba da se postigne sa vie ivota, sa vie energije - ne manje.
Na primer, moete ubiti seks lako ako izgladnjujete telo, jer seks i hrana su duboko
povezani. Hrana je potrebna za vae preivljavanje, za preivljavanje pojedinca, a seks je
potreban za preivljavanje rase, vrste. Oni su oboje hrana na neki nain. Bez hrane individua
ne moe preiveti, a bez seksa vrsta ne moe preiveti. Inae primaran je pojedinac. Ako
pojedinac moe da preivi, onda se ne postavlja pitanje vrste.
Dakle, ako izgladnjujete svoje telo, ako mu dajete tako malo hrane da se energija
stvorena od nje iscrpljuje u svakodnevnom rutinskom radu - vaem hodanju, sedenju,
spavanju - ne akumulira se ni malo vika energije, onda e seks ieznuti jer seksa samo moe
biti kada pojedinac skupi vie energije, vie nego to mu je potrebno za preivljavanje. Onda
telo moe misliti o preivljavanju vrste. Ako ste vi u opasnosti, onda telo jednostavno
zaboravlja na seks.
Otuda toliko privlanosti u postu, jer u postu seks iezava - ali to nije beeljnost. To
je samo postajanje sve vie i vie mrtvim, manje i manje ivim. U Indiji su monasi postili
neprekidno ba radi tog cilja, jer ako postite neprekidno i stalno ste na dijeti gladovanja, seks
iezava; nita drugo nije potrebno - nikakav preobraaj uma, nikakav preobraaj unutranje
energije. Jednostavno gladovanje pomae.
Onda vi postajete naviknuti na gladovanje. Ako to radite neprekidno godinama,
jednostavno ete zaboraviti da seks postoji. Nikakva energija se ne stvara, nikakva energija se
ne kree do seksualnog centra. Nema energije da se kree. Osoba postoji ba kao mrtvo bie.
Nema seksa.
Meutim, to nije ono to Patanjali misli. To nije stanje bez elja. To je samo jedno
impotentno ili nemono stanje; tu ne postoji energija. Dajte telu hranu... Vi ste moda
izgladnjivali telo za trideset ili etrdeset godina - dajte pravu hranu telu i seks se ponovo
pojavljuje. Vi se niste promenili. Seks je upravo skriven tu i eka energiju da potee. Kad god
energija potee, on e opet postati iv.
Dakle, ta je merilo? Kriterijum treba da se zapamti. Biti vie iv, biti vie ispunjen sa
energijom, vitalnou, a postati be elja. Samo onda ako vas vaa beeljnost ini vie ivim,
onda ste sledili ispravno uputstvo. Ako vas uini jednostavno mrtvom osobom, vi ste samo
96
sledili pravilo. Lako je slediti pravilo jer se ne zahteva inteligencija. Lako je slediti pravilo jer
jednostavni trikovi to mogu uiniti. Post je jednostavan trik. Nita mnogo nije sadrano u
njemu; nikakva mudrost nee proizai iz toga.
Sproveden je jedan eksperiment na Oksfordu. Tokom trideset dana grupa od dvadeset
studenata je totalno gladovala, mladi, zdravi ljudi. Posle sedam ili osam dana oni su poeli da
gube interesovanje za devojke. Slike golih devojaka su im date, a oni su bili nezainteresovani.
A ta nezainteresovanost nije bila samo telesna, ak i njihovi umovi nisu bili zainteresovani -
jer sada postoje metode za prosuivanje uma.
Kad god mladi, zdrav mladi, gleda sliku gole devojke, zenice njegovih oiju postaju
velike. One su vie otvorene da prime golu figuru. A vi ne moete kontrolisati svoje zenice;
one nisu voljne. Tako vi moete rei da ste nezainteresovani za seks, ali slike e pokazati da li
ste zainteresovani ili ne. Vi ne moete uraditi nita voljno, ne moete kontrolisati zenice
svojih oiju. One se ire jer je neto tako interesantno dolo ispred njih, da se otvaraju vie,
kapci se otvaraju vie da bi vie mogli primiti unutra. Ne, ene nisu zainteresovane za golog
mukarca kada su zainteresovane za male bebe, tako ako im daju lepe slike beba njihove oi
se ire.
Svaka predostronost je preduzeta da se vidi da li su zainteresovani - nije bilo
zainteresovanosti. Ubrzo, njihov interes je opao. ak i u svojim snovima su prestali da viaju
devojke, prekinuti su seksualni snovi. Krajem druge sedmice, etrnaestog ili petnaestog dana,
oni su jednostavno bili mrtvi leevi. ak i ako bi lepa devojka prila blizu, oni je ne bi gledali.
Ako bi neko izrekao neku seksualnu alu, oni se ne bi smejali. Trideset dana su gladovali.
Tridesetog dana, cela grupa je bila neseksualna. Nije bilo seksa u njihovom umu, ni u
njihovom telu.
Onda im je data hrana opet. Prvog dana oni su ostali isti. Sledeeg dana oni su bili
zainteresovani, a treeg dana svi koji su gladovali trideset dana su iezli. Sada nisu bili samo
zainteresovani, bili su opsesivno zainteresovani - kao da je gladovanje pomoglo. Za nekoliko
sedmica oni su bili opsesivno seksualni, mislei samo na devojke i ni na ta vie. Kada je
hrana bila u telu, devojke su opet postale vane.
Inae ovo je uraeno u mnogim zemljama irom sveta. Mnoge religije su sledile ovaj
post. Onda su ljudi poeli misliti da su otili izvan seksa. Vi moete otii izvan seksa, ali post
nije nain. To je trik. A ovo moe da se uradi na svaki nain. Ako ste u postu vi ete biti
manje ljuti, a ako postanete naviknuti na post, onda e mnoge stvari iz vaeg ivota
jednostavno otpasti jer osnova je otpala: hrana je osnova.
Kada imate vie energije, vi se kreete u vie dimenzija. Kada ste ispunjeni sa obiljem
energije, vae obilje energije vas vodi u mnoge, mnoge elje. elje nisu nita do izrazi
energije. Dakle mogua su dva puta. Jedan je: vaa elja se menja, energija ostaje; drugi je:
energija se uklanja, elja ostaje. Energija moe biti uklonjena vrlo lako. Jednostavno moete
biti operisani, kastrirani, i tada seks nestaje. Neki hormoni mogu biti uklonjeni iz vaeg tela.
To je ono to ini post - neki hormoni nestaju; onda moete postati neseksualni.
Meutim, ovo nije cilj Patanjalija. Patanjali kae da energija treba da ostane, elje
da ieznu. Samo kada elja iezne, a vi ste ispunjeni energijom, moete postii to blaeno
stanje koje joga ima za cilj. Mrtva osoba ne moe postii boansko. Boansko moe biti
postignuto samo kroz bujanje energije, obilje energije, kroz okean energije.
Ovo je druga stvar koju treba neprekidno pamtiti - nemojte unititi energiju, unitite
elju. To e biti teko. To e biti teko, naporno, jer to trai totalnu transformaciju vaeg bia.
Meutim Patanjali je za to. Zato on deli njegovu vairagyu, njegovu beeljnost, u dva koraka.
On daje dve sutre.
Prva sutra:
Prvo stanje vairagye, beeljnost, je obustava preputanja ei za ulnim uivanjima,
sa svesnim naporom.
Mnoge stvari su sadrane i treba da se razumeju. Jedna, odavanje ulnim uivanjima.
Zato traite ulna uivanja? Zato um stalno misli o zadovoljenju? Zato se kreete opet i
opet u istom obrascu preputanja?
Za Patanjalija i za sve one koji su spoznali, razlog je to vi niste blaeni u nutrini;
97
otuda, elja za uivanjem. Na uivanje orjentisan um znai da takvi kakvi jeste, u sebi, vi ste
nesreni. Zbog toga stalno traite sreu negde drugde, spolja. Osoba koja je nesrena je
prisiljena da se kree u eljama. elje su putevi nesrenog uma da trai sreu. Naravno, nigde
taj um ne moe nai sreu. Najvie to moe je da nae nekoliko odsjaja. Ovi odbljesci
izgledaju kao uivanje. Uivanje oznaava letimino sagledavanje sree. A zabluda je u tome
to ovaj um koji traga za uivanjem misli da ovi odsjaji i uivanja dolaze odnekud drugde,
spolja, od drugoga. To uvek dolazi iznutra.
Pokuajmo sada da razumemo. Vi ste u ljubavi s nekom osobom. Ulazite u seks. Seks
vam daje letimino sagledavanje uivanja; to vam daje odsjaj sree. Za jedan trenutak vi
oseate spokojstvo. Sve nevolje su iezle; svih duevnih patnji nema vie. Za jedan trenutak
vi ste ovde i sada, zaboravili ste sve. Za jedan trenutak nema prolosti i nema budunosti.
Zbog toga to nema prolosti i nema budunosti, i za jedan trenutak ste ovde i sada - iznutra iz
vas tee energija. Vae unutranje bie tee u tom trenutku, i vi imate svetlucanje sree.
Meutim vi mislite da svetlucanje dolazi od partnera, od ene ili od mukarca. To ne
dolazi od mukarca ili ene. To dolazi od vas! Drugi vam je jednostavno pomogao da padnete
u sadanjost, da padnete izvan budunosti i prolosti. Drugi vam je jednostavno pomogao da
donesete sebe u sadanjost ovog trenutka.
Ako se moete preseliti u ovu sadanjost bez seksa, seks e ubrzo postati beskoristan,
on e nestati. On onda nee biti elja. Ako elite da se preselite u seks, moete se premestiti iz
zabave, ali ne iz elje. Onda nema opsesije u tome jer vi ne zavisite od toga.
Sednite ispod drveta jednog dana - upravo ujutru dok sunce nije izalo, jer s raanjem
sunca vae telo je nemirno, i teko je biti miran unutra. Zbog toga na Istoku su uvek meditirali
pre izlaska sunca, oni su to nazivali brahma muhurti - trenutak boanskog. Oni su u pravu, jer
sa suncem energije se bude i zapoinju da teku u starom obrascu koji ste stvorili.
Ba ujutru, kada sunce jo nije izalo na horizontu, sve je smireno i priroda je vrsto
uspavana - drvee spava, ptice spavaju, ceo svet spava, vae telo je takoe unutra uspavano, a
vi dolazite da sednete ispod drveta. Sve je smireno. Samo pokuajte da budete ovde u ovom
trenutku. Ne inite nita; nemojte ak ni meditirati. Ne inite nikakav napor. Samo zatvorite
svoje oi, ostanite tihi, u toj tiini prirode. Iznenada ete imati ista letimina sagledavanja,
odbljeske koja su dolazila kroz seks, ili ak vea, dublja. Iznenada ete osetiti navalu energije
koja tee iznutra. Sada ne moete biti obmanuti, jer nema drugog, to sigurno dolazi iz vas. To
sigurno tee iznutra. Niko drugi vam je ne daje, vi je dajete sebi.
Ali ta situacija je nuna - tiina, energija, ne u uzbuenju. Vi ne radite nita, samo ste
tu ispod drveta, i imaete odsjaj. A to zaista nee biti uivanje, to e biti srea, jer sada
gledate u pravi izvor, pravi smer. Jednom kada znate to, onda ete odmah kroz seks
prepoznati da je drugi (partner) bio samo ogledalo, vi ste se samo ogledali u njemu ili njoj. I
vi ste bili ogledalo za drugog. Vi ste pomagali jedno drugom da padnete u sadanjost, da
odete od razmiljajueg uma do nerazmiljajueg stanja bivanja.
30
to je vie um ispunjen brbljanjem, vie seks ima privlanosti. Na Istoku, seks nikada
nije bio takva opsesija kao to je bio opsesija na Zapadu. Filmovi, prie, romani, poezija,
magazini, sve je postalo seksualno. Ne moete prodati nita dok ne stvorite seksualnu
privlanost. Ako treba da prodate kola, moete ih prodati samo kao seksualni objekat. Ako
elite da prodate pastu za zube, moete je prodati kroz neku seksualnu reklamu. Nita se ne
moe prodati bez seksa. Izgleda da samo seks ima potranju, znaaj, nita drugo.
Svaka vanost dolazi kroz seks. Ceo um je opsednut seksom. Zato? Zato se to nije
nikada deavalo ranije? To je neto novo u ljudskoj istoriji. Razlog je to je sada Zapad
potpuno apsorbovan u mislima, nema mogunosti da se bude ovde i sada, osim u seksu. Seks
je ostao jedina mogunost, i ba to se deava.
Modernom oveku je ak ovo postalo mogue - da dok vodi ljubav moe misliti o
drugim stvarima. Jednom kada postanete tako sposobni da dok vodite ljubav nastavljate da
mislite o neemu - o vaim raunima u banci, ili nastavljate da razgovarate sa prijateljem, ili
nastavljate da budete negde drugde - dok vodite ljubav ovde - seks e takoe biti okonan.
30
Do Bitka, Sopstva ili Jastva.
98
Onda e biti samo dosada, frustracija, jer sam seks nije bitan. Stvar je bila samo u ovome -
zato to se seksualna energija kree tako brzo, va um dolazi do zaustavljanja, seks ga
prevladava. Energija tee tako brzo, tako vitalno, da se va obian obrazac miljenja
zaustavlja.
uo sam, jednom se dogodilo da je Mula Nasrudin prolazio kroz umu. Naiao je na
lobanju. Upravo radoznao, kakav je uvek bio, pitao je lobanju: "ta vas je dovelo ovde
gospodine?" Bio je zapanjen kada je lobanja rekla: "Prianje me je dovelo dovde, gospodine,"
Nije mogao da poveruje u to, ali je uo to i potrao je na dvor kod kralja. Rekao je: "Video
sam udo! Lobanja, lobanja koja govori, lei ba pored naeg sela u umi."
Kralj takoe nije mogao da poveruje, ali je takoe bio radoznao. Ceo dvor ih je sledio,
otili su umu. Nasrudin je priao blizu lobanje i pitao: "ta te je dovelo ovde, gospodine?" ali
lobanja je ostala nema. Pitao je ponovo, opet i opet, ali lobanja je bila mrtvaki nema.
Kralj je rekao: "Znao sam od ranije, Nasrudine, da si laov. Ali sada je previe.
Napravio si takvu alu da e morati da pati zbog nje." Naredio je svom uvaru da mu odsee
glavu i baci je pored lobanje mravima da je pojedu. Kada su svi otili - kralj, njegov dvor -
lobanja je poela opet da govori. Pitala je: "ta vas je dovelo ovde, gospodine?" Nasrudin je
odgovorio: "Prianje me je dovelo ovde, gospodine."
Govorenje je dovelo oveka dovde - do situacije koja je danas. Konstantno brbljajui
um ne dozvoljava nikakvu sreu, nikakvu mogunost sree, jer samo smireni um moe gledati
unutra, samo smireni um moe sluati tiinu, sreu, koja uvek kljua ovde. Ali ona je tako
suptilna da je s bukom iz uma ne moete uti.
Samo u seksu buka ponekad prestaje. Ja kaem: "Ponekad". Ako ste postali naviknuti
na seks, kao to muevi i ene postaju, onda se ona nikada ne zaustavlja. Ceo in postaje
automatizovan i um nastavlja po svome. Onda je seks takoe dosada.
Sve ima privlanost, ako vam moe dati taj odsjaj. Moe izgledati da odsjaj ili
letimina sagledavanja dolaze spolja; oni uvek dolaze iznutra. Spolja moe biti samo
ogledalo. Kada srea tee iznutra odraava se od neeg spolja, to se naziva zadovoljstvom.
Ovo je Patanjalijeva definicija - srea tee iznutra reflektovana od neega spoljanjeg,
spoljanje deluje kao ogledalo. Ako mislite da ta srea dolazi spolja, ona je nazvana
uivanjem. Mi smo u potrazi za sreom, ne u potrazi za uivanjem. Tako da sve dok ne budete
imali odsjaj sree, ne moete zaustaviti vae napore traganja za zadovoljstvima. Preputanje
uivanju znai traganje za zadovoljstvom.
Potreban je svestan napor. Za dve stvari. Jedna: kad god osetite da je trenutak uivanja
prisutan, preobrazite ga u meditativno stanje. Kad god osetite da oseate zadovoljstvo, sreu,
veselje, zatvorite svoje oi i pogledajte unutra, i vidite odakle to dolazi. Ne gubite taj trenutak;
to je dragoceno. Ako niste svesni nastaviete da mislite da to dolazi spolja, i to je zabluda
sveta.
Ako ste svesni, meditativni, ako tragate za pravim izvorom, pre ili kasnije ete saznati
da to dolazi iznutra. Jednom kada saznate da to uvek tee iznutra, da je to neto to ve imate,
preputanje strastima e otpasti, i to e biti prvi korak beeljnosti. Onda ne traite spolja, niste
u udnji. Niste ubili elje, niste se borili sa eljama, vi ste jednostavno nali neto vee. elje
sada ne izgledaju tako vane. One venu.
Zapamtite ovo: one ne treba da budu ubijene i unitene; one same venu. Jednostavno
ih zanemarujete jer imate vei izvor. Vi ste magnetski privueni prema njemu. Sada se itava
vaa energija kree unutra. elje se jednostavno zanemaruju.
Vi ih niste dotukli. Ako se borite s njima nikada neete pobediti. To je kao kada biste
imali neko kamenje, areno kamenje u svojim rukama. I odjednom opazite dijamante, da oni
lee okolo. Vi bacate kamenje da biste stvorili prostor za dijamante u svojim rukama. Vi se ne
borite s kamenjem. Kada su dijamanti tu, vi jednostavno ispustite kamenje. Ono je izgubilo
svoj znaaj.
elje moraju izgubiti svoj znaaj. Ako se borite, znaaj im se ne gubi. Naprotiv, ba
kroz borbu dajete im vei znaaj. Onda one postaju vanije. To se dogaa. Kada se neko bori
99
sa nekom eljom, ta elja postaje centar njegovog uma. Ako se borite sa seksom, seks postaje
centar. Onda ste neprekidno angaovani u tome, zauzeti s tim. To postaje kao rana. Gde god
da pogledate, ta rana se odmah projektuje, i ta god vidite postaje seksualno.
Um ima mehanizam, jedan stari mehanizam preivljavanja: ili borba ili bekstvo. Dva
su puta uma: ili se moete boriti s neim, ili moete pobei od toga. Ako ste jaki, onda se
borite. Ako ste slabi, onda beite, jednostavno pobegnete. Ali u oba sluaja neto drugo je
vano, drugo je centar. Moete se boriti ili pobei iz sveta - iz sveta gde su elje mogue;
moete otii na Himalaje. To je takoe borba, borba slabog.
uo sam: jednom je Mula Nasrudin kupovao u selu. Ostavio je svog magarca na ulici i
otiao u trgovinu da kupi neto. Kada se vratio bio je besan. Neko je obojio njegovog magarca
potpuno u crveno, svetlo crveno. Bio je gnevan raspitivao se: "Ko je to uinio? Ubiu tog
oveka!"
Tu je stajao mali deak. Rekao je: "Jedan ovek je to uinio, uao je u krmu." Tako je
Nasrudin otiao tamo, pourio je tamo, ljut, lud. Rekao je: "Ko je to uradio? Ko je obojio mog
magarca?"
Vrlo krupan ovek, vrlo jak, ustao je i rekao: "Ja sam, pa ta?" Na to je Nasrudin
rekao: "Hvala vam, gospodine. Uradili ste tako lep posao. Doao sam da vam kaem da je
prvi premaz suv."
Ako ste jaki, onda ste spremni da se borite. Ako ste slabi, onda ste spremni da
pobegnete. Ali u oba sluaja, vi ne postajete jai. U oba sluaja drugi je postao centar vaeg
uma. Ovo su dva dranja, boriti se ili pobei - i oba su pogrena jer se kroz njih vezujui
uticaj uma pojaava.
Patanjali kae da postoji trea mogunost: ne borite se i ne beite. Samo budite
budni. Samo budite svesni. Kakav god da je sluaj, samo budite svedok. Svesni napor znai,
prvo: traganje za unutarnjim izvorom sree; i drugo: svedoenje starog obrasca navika - ne
boriti se s tim, samo svedoiti to.
Prvo stanje vairagye, beeljnost je obustava preputanja ei za ulnim uivanjima, sa
svesnim naporom.
Svesni napor jeste kljuna re. Svesnost je potrebna, i napor je takoe potreban.
Napor treba da bude svestan jer moe postojati i nesvestan napor. Moete biti trenirani na
takav nain da moete odbaciti odreene elje bez znanja da ste ih odbacili.
Na primer, ako ste roeni u vegetarijanskoj kui vi ete jesti vegetarijansku hranu.
Nevegetarijanska hrana jednostavno nije pitanje. Nikada je niste odbacili svesno. Bili ste
odgajani na takav nain da je nesvesno odbaena sama od sebe. Ali vam to nee dati neki
integritet; nee vam to dati neku duhovnu snagu. Dok neto ne uinite svesno, to nije
postignuto.
Mnoga drutva su probala ovo za svoju decu, da ih podignu na takav nain da izvesne
pogrene stvari jednostavno ne uu u njihove ivote. One ne ulaze, ali nita se ne postie na
taj nain jer realna stvar koju treba zadobiti jeste svesnost. Svesnost moe biti zadobijena kroz
napor. Ako je bez napora neto uslovljeno u vama, to uopte nije postignue.
Dakle u Indiji ima puno vegetarijanaca. aini, Brahmani, mnogi ljudi su vegetarijanci.
Nita se ne postie time to ste samo roeni u ainskoj porodici, biti vegetarijanac ne znai
nita. To nije svestan napor; niste uinili nita oko toga. Da ste roeni u nevegetarijanskoj
porodici, vi biste prihvatili nevegetarijansku ishranu na slian nain.
Dok neki svesni napor nije uinjen, vaa kristalizacija se nikada ne dogaa. Morate
uiniti neto svoje. Kada neto uinite sami od sebe, vi to ostvarujete. Nita se ne postie bez
svesnosti, zapamtite to. To je jedna od osnovnih stvari. Nita se ne postie bez svesnosti!
Moete postati savreni svetac, ali ako to niste postali kroz svesnost, to je uzaludno,
beskorisno. Morate se boriti in po in, jer kroz borbu vie svesti e biti potrebno. A to vie
svesnosti primenjujete u svemu, vie svesni vi postajete. Dolazi trenutak kada postajete ista
svest.
100
Prvi korak je:
...obustava preputanja ei za ulnim uivanjima, sa svesnim naporom.
ta da se radi? Kad god ste u stanju uivanja - seks, hrana, novac, mo, bilo ta to
vam prua uivanje - meditirajte o tome. Samo pokuajte da naete to, odakle to dolazi. Vi ste
izvor, ili je izvor negde drugde? Ako je izvor negde drugde, onda nema mogunosti za bilo
kakvu transformaciju jer ete ostati zavisni od izvora.
Ali sreom, izvor nije nigde drugde, on je u vama. Ako meditirate, vi ete ga nai. On
kuca svakog trenutka iznutra, Ja sam ovde! Jednom kada osetite da je tu i da kuca svakog
trenutka - a vi ste samo stvarali spoljanje okolnosti u kojima se to se deavalo - to se moe
dogoditi bez okolnosti. Onda ne treba da zavisite ni od koga, od hrane, od seksa, od moi, bilo
ega. Vi ste dovoljni unutar samoga sebe. Jednom kada doete do tog oseanja, oseanja
samodovoljnosti, preputanje strastima - um koji je popustljiv vanjskim eljama - iezava.
To ne znai da neete uivati u hrani. Uivaete vie. Ali sada hrana nije izvor vae
sree, vi ste izvor. Ne zavisite od hrane, niste opsednuti hranom.
To ne znai da ne uivate u seksu. Moete uivati vie, ali sada je to veselje, igra; to je
samo slavlje. Ali niste zavisni od toga, izvor toga nije spolja. I jednom kada dve osobe, dvoje
ljubavnika, otkriju ovo - da drugi nije izvor njihovog uivanja - oni prestaju da se bore jedno s
drugim. Oni zapoinju da vole jedno drugo po prvi put.
Inae ne moete voleti osobu od koje ste zavisni ni na koji nain. Vi ete mrzeti, jer je
ona vaa zavisnost. Bez nje ne moete biti sreni. Dakle, ona je bila klju, a osoba koja ima
klju vae sree va je tamniar. Ljubavnici se bore jer vide da drugi ima klju, "Ona me
moe uiniti srenim ili nesrenim." Jednom kada saznate da ste vi izvor svoje, i drugi je
izvor njegove vlastite sree, moete deliti svoju sreu; to je druga stvar, ali vi niste zavisni.
Moete podeliti. Moete slaviti zajedno. To je ono ta ljubav znai: slavljenje zajedno,
deljenje zajedno - ne ganjati jedno drugo, ne eksploatisati jedno drugo.
Zato to eksploatacija ne moe biti ljubav. Onda koristite drugog kao sredstvo, a koga
god koristite kao sredstvo, on e vas mrzeti. Ljubavnici mrze jedno drugo jer koriste,
eksploatiu jedno drugo, a ljubav - koja treba da bude najdublja ekstaza - postaje najruniji
pakao. Ali jednom kada znate da ste vi izvor svoje sree, niko drugi nije izvor, moete
podeliti to slobodno. Onda drugi nije va neprijatelj, nije ak ni jedan intiman neprijatelj. Po
prvi put prijateljstvo se stvara, moete uivati u svemu.
A moi ete da uivate samo kada ste slobodni. Samo nezavisna osoba moe da uiva.
Osoba koja je luda i opsednuta hranom ne moe da uiva. Ona moe da napuni stomak, ali ne
moe da uiva. Njeno jedenje je nasilno. To je vrsta ubijanja. Ona ubija hranu; ona unitava
hranu. I ljubavnici koji oseaju da njihova srea zavisi od drugog, bore se, pokuavaju da
dominiraju nad drugim, pokuavaju da ubiju drugog, da unite drugog. Biete sposobni u
svemu da uivate vie kada znate da je izvor unutra. Onda ceo ivot postaje igra, iz trenutka u
trenutak moete nastaviti da uivate beskonano.
Ovo je prvi korak, sa naporom. Svesnou i naporom postiete beeljnost. Patanjali
kae da je ovo prvo, jer ak i napor, ak i svesnost, nije dobra, jer to znai da se neka borba,
neka skrivena borba, jo odvija.
Drugi i poslednji korak vairagye, poslednje je stanje beeljnosti:
... obustava svih elja uz pomo spoznaje unutarnje prirode purue, vrhovnog Sopstva.
Prvo morate znati da ste vi izvor sve sree koja se vama deava. Drugo, morate znati
svu prirodu vaeg unutarnjeg bia. Prvo, vi ste izvor. Drugo, Kakav je ovo izvor? Prvo,
samo toliko je dovoljno, da ste vi izvor sree. A drugo, ta je ovaj izvor u svojoj celokupnosti,
ovaj purua, unutarnje Sopstvo: "Ko sam ja?" u svojoj celosti.
Jednom kada znate ovaj izvor u njegovoj celokupnosti, vi ste spoznali sve. Onda je
ceo univerzum unutra, ne samo srea. Onda sve to postoji, postoji unutra - ne samo srea.
Onda Bog ne sedi negde u oblacima, on postoji unutra. Onda ste vi izvor, koreni izvor svega.
Onda ste vi sredite.
Jednom kada postanete sredite egzistencije, jednom kada znate da ste sredite
egzistencije, sva patnja e nestati. Tada beeljnost postaje spontana, sahaa. Nikakav napor,
nikakvo nastojanje, nikakvo odravanje nije potrebno. To je lako, to je postalo prirodno. Ne
101
vuete to, niti gurate to. Sada nema ja koje moe da vue i gura.
Zapamtite ovo: borba stvara ego. Ako se borite u svetu, to stvara krupan, grub ego: "Ja
sam neko s novcem, sa ugledom, sa snagom." Ako se borite unutra, to stvara suptilan ego: "Ja
sam ist; ja sam svetac; ja sam mudrac," ali Ja ostaje sa borbom. Dakle, postoje poboni
egoisti koji imaju vrlo suptilan ego. Oni moda nisu svetovni ljudi, nisu; oni su drugaije
svetovni. Ali borba postoji. Oni su postigli neto. To postignue jo nosi poslednju senku od
Ja.
Drugi korak i konani korak beeljnosti za Patanjalija je potpuni nestanak ega. Samo
prirodan tok. Nema ja, nema svesnog napora. To ne znai da neete biti svesni, vi ete biti
savrena svest - ali nikakav napor nije sadran u bivanju svesnim. Neete biti samosvesni -
biete isto svesni, nesebino. Prihvatili ste sebe i egzistenciju kakva ona jeste.
Totalno prihvatanje - to je ono to Lao Ce zove Tao, reka tee prema okeanu. Ona ne
ini nikakav napor; nije u urbi da stigne do okeana. ak i ako ne stigne, nee biti frustrirana.
ak i ako stigne za milione godina, sve je u redu. Reka jednostavno tee jer teenje je njena
priroda. Nikakvog napora nema. Ona e nastaviti da tee.
Kada se elje po prvi put ustanove, nastaje i napor za njihovo opaanje, suptilan napor.
ak i prvi korak je suptilan napor. Zapoinjete sa pokuajima da budete svesni, "Odakle moja
srea dolazi?" Morate uiniti neto, a to injenje e kreirati ego. Zbog toga Patanjali kae da
je to samo poetak, i morate zapamtiti da to nije kraj. Na kraju, ne samo da su elje nestale, vi
ste takoe nestali. Samo unutranje bie je ostalo u svom toku.
Ovaj spontani tok je vrhovna ekstaza jer za njega nije mogua patnja. Patnja dolazi
kroz oekivanje, potrebe. Nema nikoga da oekuje, da trai, tako da sve to se dogodi jeste
dobro. Sve to se dogaa je blagoslov. Ne moete nita porediti ni sa im drugim, sve je svoj
sluaj. I zato to nema poreenja sa prolou i sa budunou - nema nikoga da uporeuje -
ne moete gledati ni na ta kao na patnju, kao bol. ak i ako se bol dogodi u nekoj situaciji, to
nee biti bolno. Pokuajte da razumete ovo. Ovo je teko.
Isus je bio raspet na krstu. Hriani su slikali Isusa vrlo tunog. Rekli su ak da se on
nikada nije smejao, i u svojim crkvama imaju svuda tune figure Isusa. To je ljudsko; moete
razumeti to, jer osoba koja je razapeta na krstu mora biti tuna. Mora da je bio u unutranjoj
agoniji; mora da je patio.
Tako hriani stalno govore da je Isus ispatao za nae grehe - ali on je patio. Ovo je
potpuno pogreno! Ako pitate Patanjalija ili mene, to je sasvim pogreno. Isus ne moe da
pati. Nemogue je da Isus pati. Ako on pati, onda ne postoji razlika izmeu vas i njega.
Bol je tu, ali on ne moe da pati. To moe da izgleda nerazumljivo, ali nije, to je
jednostavno. Moemo da vidimo spolja da je razapet, ponien, da je njegovo telo uniteno.
Bol je tu, ali Isus ne moe da pati. Jer u tom trenutku kada je Isus raspet na krstu, on ne moe
nita da trai. On ne moe da zahteva. On ne moe da kae: "Ovo je pogreno. Ovo ne treba
da bude tako. Treba da budem krunisan, a ja sam raspet na krstu."
Ako je on to imao u svom umu - to: "Treba da budem krunisan, ali sam raspet," - onda
bi bilo bola. Ako nije imao budueg u umu, to da: "Ja treba da budem krunisan," nikakvog
oekivanja za buduim, nikakav odreeni cilj da dostigne, gde god se naao tu je cilj. On ne
moe da uporeuje. To ne moe biti drugaije. To je sadanji trenutak koji mu je dat. To
raspee je krunisanje.
On ne moe da pati jer patnja znai otpor. Morate se odupreti neemu, samo onda
moete patiti. Pokuajte to. Bie vam teko da budete raspeti, ali postoje mala, svakodnevna
raspinjanja na krst. Ona e delovati.
Imate bol u nozi ili u glavi, imate glavobolju. Moda niste uoili mehanizam toga.
Imate glavobolju, i stalno se borite i opirete. Ne elite to. Vi ste protiv toga, podeljeni ste.
Negde ste vi unutar glave i glavobolja je tamo. Vi ste zasebni i glavobolja je zasebna, i
insistirate da ne treba da bude tako. To je pravi problem.
Pokuajte jednom da se ne borite. Tecite sa glavoboljom, postanite glavobolja. I recite:
"To se sada dogaa. Ovakva je moja glava u ovom trenutku, i u ovom trenutku nita drugo
nije mogue. To moe otii u budunosti, ali u ovom trenutku glavobolja je ovde." Ne opirite
se. Dozvolite joj se da se deava; postanite jedno s njom. Ne navlaite sebe u podelu, tecite u
102
tome. A onda e biti iznenadnog napretka nove vrste sree koju niste znali. Kada nema nikoga
da se odupire, ak i glavobolja nije bolna. Borba stvara bol. Bol uvek znai boriti se protiv
bola - to je stvarna bol.
Isus prihvata. Na taj nain njegov ivot je doao na krst. To je sudbina. To su na
Istoku uvek nazivali sudbinom, bhagya, kismat. Dakle nije glavna stvar u dokazivanju s
vaom verom, nije u pitanju ni borenje s njom. Ne moete initi nita; to se deava. Samo vam
je mogua jedna stvar - moete tei s njom ili se moete boriti s njom. Ako se borite, to
postaje vea agonija. Ako teete s tim, agonija je manja. Ako moete potpuno tei, agonija
nestaje. Postali ste tok.
Pokuajte to kada imate glavobolju, pokuajte to kada vam je telo bolesno, pokuajte
kada imate neki bol - samo sledite to. A jednom, ako moete dopustiti, moraete doi do jedne
od najdubljih tajni ivota - da bol nestaje ako vi teete s njim. A ako moete da teete
potpuno, bol postaje srea.
Ali to nije neto to se logino moe razumeti. Moete shvatiti to intelektualno, ali to
nee delovati. Pokuajte to egzistencijalno. Postoje svakodnevne situacije. Svakog momenta
neto je nepravilno. Tecite sa tim i vidite kako e se preobraziti cela situacija. A kroz taj
preobraaj vi transcendirate to.
Buda nikada ne moe biti u bolu; to je nemogue. Samo jedan ego moe biti u bolu.
Ego mora biti u bolu. Ako je ego tu vi moete preobraziti svoje uivanje u bol; ako ego nije tu
moete preobraziti svoj bol u uivanje. Tajna lei u egu.
Poslednje stanje vairagye, beeljnost je obustava svih elja uz pomo saznavanja
unutarnje prirode purue, vrhovnog Sopstva.
Kako se to dogaa? Samo znajui najdublju sr sebe samoga, puruu, unutarnjeg
stanovnika. Samo znajui njega! Patanjali kae, Buda kae, Lao Ce kae, samo znajui
njega, sve elje nestaju.
To je misteriozno, i logini um je prinuen da pita kako se to deava da samo pomou
poznavanja sebe samih sve elje nestaju. To se dogaa jer sada znajui sami sebe, ovakve
kakvi smo, sve elje su nastale. elje su jednostavno neznanje o sebi. Zato? Sve to traite
kroz elje je tu, skriveno u Sopstvu. Ako znate Sebe, elje e nestati.
31
Na primer, traite snagu. Svako trai mo. Mo stvara ludilo u svakome. Izgleda da
samo ljudsko drutvo postoji na takav nain da se svako odaje moi.
Dete se rodi; ono je bespomono. To je prvo oseanje koje svi uvek nosite u sebi. Dete
se rodi, ono je bespomono, a bespomono dete eli snagu. To je prirodno jer svako je
snaniji od njega. Majka je snanija, otac je snaniji, braa su snanija, svako je snaniji, a
dete je apsolutno bespomono. Naravno, prva elja koja se javi je da ima mo - kako da
izraste snano, kako da bude dominantno. I dete zapoinje da biva politiar od tog trenutka.
Ono zapoinje da ui trikove kako da vlada.
Ako plae previe, saznaje da moe vladati kroz plakanje. Moe dominirati itavom
kuom samo pomou plakanja. Ono ui da plae. ene nastavljaju s tim ak i kada vie nisu
deca. One su nauile tajnu, nastavljaju to. A treba da nastavljaju s tim jer ostaju bespomone.
To je politika moi.
Ono zna trik, i moe stvoriti smetnju. Moe kreirati takvu smetnju da morate prihvatiti
nagodbu s njim. I svakog trenutka ono duboko osea da jedina stvar koju treba jeste snaga,
vie moi. Ono e uiti, ii e u kolu, ono e rasti, ono e voleti, ali u pozadini svega -
31
Naa sutina ili Sopstvo je svest koja omoguava samu Celinu, Apsolut. ta bi drugo moglo da bude? Sama
definicija Apsoluta jeste da je on sve, da je nedeljiv, da postoji po holografskom modelu, tako da svaki prividni
deo Apsoluta sadri njegovu Celinu, da je sve to postoji na bilo kakav nain zapravo sam Apsolut. Tako je to i
nae Sopstvo. Samo je refleksija svesti o tome razliita, negde je gua i izraava se kroz grubi oblik, a negde
finija i ogleda se kao delanje i informacija, a najistija je kao samospoznaja ili ista svest o Sebi. Probuen ovek
je svesni subjekt Celine. U njemu se Celina najjasnije ogleda i spoznaje kao ona sama i kao sutina ovekova,
njegova samosvest. U tome je odgovor kako elje nestaju kada ovek spozna sebe. Dok smo u iluziji da smo
samo jedna otuena i posebna individua, onda smo nepotpuni i elimo (jo) neto drugo. Celina ne moe da eli
nita drugo jer ne postoji nita drugo, ona je cela, potpuna, ona ve jeste sve to biva i to moe da bude.
103
njegovog obrazovanja, ljubavi, igre - ono e nalaziti kako da dobije vie snage. Kroz
obrazovanje ono e eleti da dominira, kako da bude prvo u razredu tako da moe dominirati,
kako da dobije vie novca tako da moe dominirati, kako da napreduje u irenju uticaja i
teritorije dominacije. itav ivot e mu biti posveen moi.
Mnogo ivota je jednostavno protraeno. ak i ako dobijete snagu, ta ete raditi?
Jednostavne detinjaste elje su ispunjene. Dakle, kada postanete Napoleon ili Hitler, iznenada
postajete svesni da je ceo napor bio beskoristan, uzaludan. Samo je detinjasta elja bila
ispunjena, to je sve. Sada ta da se ini? ta da se ini sa tom snagom? Ako je elja ispunjena
vi ste frustrirani. Ako elja nije ispunjena vi ste frustrirani, a ona apsolutno ne moe biti
ispunjena, jer niko ne moe biti tako moan da moe oseati, Sada je dovoljno - niko! Svet
je tako kompleksan da se ak i Hitler osea nemonim u nekim momentima, ak i Napoleon
e se oseati slabim u nekim trenucima. Niko ne moe da osea apsolutnu snagu, i nita ne
moe da vas zadovolji.
Ali kada neko upozna svoje Sopstvo, on dolazi do izvora apsolutne snage. Onda elja
za snagom nestaje jer znate da ste ve kralj, a samo ste mislili da ste prosjak. Vi ste se borili
da postanete vei prosjak, moniji prosjak, a ve ste bili kralj. Iznenada ste shvatili da vam ne
nedostaje nita. Niste bespomoni. Vi ste izvor svih energija, vi ste sam izvor ivota. To
oseanje nemoi u detinjstvu kreirano je od drugih. I to je zaaran krug koji su oni stvorili u
vama jer su to stvorili u njima njihovi roditelji, i tako dalje i tako dalje.
Vai roditelji su stvorili oseanje u vama da ste nemoni. Zato? Jer su se samo kroz
to oni mogli oseati snanim. Moda mislite da veoma volite decu. Izgleda da to nije sluaj.
Vi volite mo, a kada dobijete decu, kada postanete majke i oevi, vi ste moniji. Moda vas
niko ne slua; moda niste nita u svetu, ali ste barem u granicama svoje kue jaki. Moete
bar da maltretirate malu decu.
Pogledajte oeve i majke: oni mue! Oni maltretiraju izraavajui ljubav tako da im
ak ne moete rei: "Vi muite." Oni mue 'za njihovo vlastito dobro, radi dobra same dece!
Pomau im da rastu. Oni se oseaju jaki. Psiholozi kau da mnogi ljudi biraju uiteljski poziv
samo da bi bili uticajni, jer sa tridesetoro dece na raspolaganju, vi se oseate ba kao kralj.
Govorilo se da je Aurangajeba zatvorio njegov sin. Kada je bio uhapen, on je napisao
pismo u kome je rekao: "Samo jedna elja, ako je moe ispuniti, bie dobro, i ja u biti
srean. Samo mi poalji tridesetoro dece tako da ih mogu poduavati u mom zatvoru."
Kae se da je sin rekao: "Moj otac je uvek ostao kralj, i on ne moe izgubiti svoje
kraljevstvo. Tako da je ak i u zatvoru njemu trebalo tridesetoro dece da bi ih poduavao."
Gledajte! Idite u kolu! Uitelj sedi na svojoj stolici - i apsolutna mo, gospodar je
svega to se tamo dogaa. Ljudi ele decu ne zbog ljubavi, jer da ih vole zaista, svet bi bio
drugaiji. Ako volite svoje dete, svet bi bio potpuno drugaiji. Neete mu pomagati da bude
bespomono, da se osea bespomono, daete mu tako mnogo ljubavi da e oseati da je jako.
Ako mu date ljubav, onda ono nikada nee traiti mo. Ono nee postati politiki lider; ono
nee ii na izbore. Ono nee pokuavati da gomila novac i da poludi za njim, jer ono zna da je
to beskorisno - ono je ve mono; ljubav je dovoljna.
Ako niko ne daje ljubav, zato ono stvara zamene. Sve vae elje, bilo za uticajem,
novcem, ugledom, pokazuju da ste neemu ueni u vaem detinjstvu, neto je bilo uslovljeno
u vaem bio-kompjuteru i vi sledite to uslovljavanje bez gledanja unutra, jer bilo ta da traite
to ve jeste tu.
Patanjalijev sav napor je da postavi va bio-kompjuter u tiinu tako da se ne uplie.
To je meditacija. To je postavljanje vaeg bio-kompjutera nekoliko trenutaka u tiinu, u stanje
bez vibracija, tako da moete pogledati unutra i uti svoju najdublju prirodu. Samo brz
pogled, letimino sagledavanje e vas promeniti, jer onda ovaj bio-kompjuter ne moe da vas
obmane. Ovaj bio-kompjuter stalno govori: Uradi ovo, uradi ono! On nastavlja neprekidno
da vas manipulie da morate imati vie snage; inae niste niko.
Ako gledate unutra, nije potrebno da budete neko; nije potrebno da budete vana
linost. Vi ste ve prihvaeni kakvi jeste. itava egzistencija vas prihvata, srena je to se tie
vas. Vi ste cvetanje - individualno cvetanje, razliito od svakog drugog, jedinstveno, i Bog
vam eli dobrodolicu; inae ne biste bili ovde. Vi ste ovde samo zato to ste prihvaeni. Vi
104
ste ovde samo zato jer vas Bog voli, univerzum vas voli i potrebni ste egzistenciji. Vi ste
neophodni.
Jednom kada znate svoju unutarnju prirodu, koju Patanjali zove purua - purua
znai unutranji stanovnik... Telo je kao kua. Unutranji stanovnik, unutarnja svest, jeste
purua. Jednom kada znate ovu unutarnju svest, nita nije potrebno. Vi ste dovoljni, vie nego
dovoljni. Vi ste savreni kakvi jeste. Potpuno ste prihvaeni, dobrodoli. Egzistencija postaje
blagoslov. elje nestaju; one su bile deo neznanja Sebe. Sa znanjem Sebe, one nestaju,
izvetre.
Abhyasa, stalna unutarnja praksa, svesni napor da se bude sve vie budan, da se
bude sve vie gospodar sebe, da se bude sve manje i manje pod kontrolom navika,
mehaninosti, robotu slinim mehanizmima - i vairagya, beeljnost: ovo dvoje kada se
postignu ovek postaje jogin; kada se ovo dvoje dostignu ovek je postigao cilj.
Ponoviu: samo nemojte stvarati borbu. Dozvolite da se sve ovo deava, da bude sve
vie spontano. Ne borite se sa negativnim. Bolje kreirajte pozitivno. Ne borite se sa seksom,
sa hranom, ni sa im. Bolje, naite ono to vam daje vie sree, odakle ona dolazi - kreite se
u tom pravcu. elje tako postepeno nestaju.
I drugo: budite sve vie i vie svesni. ta god da se deava, budite sve vie svesni.
Ostanite u tom trenutku, prihvatite taj trenutak. Ne traite neto drugo. Onda neete stvarati
patnju. Ako postoji bol, neka bude tu. Ostanite u tome i tecite u tome. Jedini uslov je, ostanite
budni. Znalaki, paljivo, uite u to, tecite u tome. Ne opirite se!
Kada bol iezne, elja za uivanjem takoe iezava. Kada niste u bolu, vi ne traite
zadovoljenje. Kada nema jada, preputanje zadovoljstvima postaje bez znaaja. I sve vie i
vie nastavljate da padate u unutarnji ambis. A to je tako blaeno, to je tako duboka ekstaza,
da ak i letiminim sagledavanjem toga ceo svet postaje beznaajan. Onda sve to vam ovaj
svet moe dati postaje beskorisno.
Ni to ne sme postati borbeno dranje - ne treba da postanete ratnik, treba da postanete
meditant. Ako ste meditativni, spontano e vam se stvari dogaati koje e vas preobraziti i
promeniti. Zaponite borbu i zapoeli ste guenje. A uguivanje e vas voditi do sve vee i
vee patnje. Tako se moete obmanuti.
Ima mnogo ljudi koji ne obmanjuju samo druge, nego stalno obmanjuju sebe. Oni
misle da nisu u patnji; stalno govore da nisu u nevolji. Ali itava njihova egzistencija je jadna.
Kada kau da nisu u bedi, njihova lica, njihove oi, njihovo srce, sve je u bedi.
Ispriau vam jednu anegdotu, a onda u zavriti. uo sam da se jednom dogodilo da
su dvanaest dama stigle u istilite. Aneo koji ih je vodio upitao je: "Da li je neka od vas bila
neverna svom muu dok ste bile na zemlji? Ako je neka bila neverna svom muu, ona treba
da podigne ruku." Srameljivo, oklevajui, ubrzo su jedanaest dama podigle svoje ruke.
Aneo je uzeo telefon i pozvao: "Halo! Da li je to pakao? Imate li tamo mesta za dvanaest
nevernih ena? - jedna od njih je gluva k'o kamen!"
Nije potrebno ni da to kaete ili ne. Vae lice, samo vae bie, pokazuje sve. Moete
rei da niste jadni, ali nain na koji to kaete, nain na koji jeste, pokazuje da ste jadni. Ne
moete obmanjivati, u tome nema svrhe jer niko ne moe obmanuti nikoga drugog, moete
obmanuti samo sebe.
Zapamtite, ako ste jadni, vi ste stvorili sve to. Pustite da prodre duboko u vae srce to
da ste stvorili svoje patnje jer e to postati formula, klju. Ako ste vi stvorili svoje patnje,
samo onda vi moete i da ih unitite. Ako ih je stvorio neko drugi, onda ste nemoni. Vi ste
stvorili svoju patnju, zato moete da je unitite. Vi ste je stvorili kroz pogrene navike,
pogrena gledita, preputanjima, kroz elje.
Odbacite te obrasce! Gledajte novim, istim pogledom! A sam ovaj ivot je najvea
radost koja je mogua ljudskoj svesti.
105
Poglavlje 10
UZROK VAE PATNJE
4. januar 1974.
Prvo pitanje:
Kako to da opisujete ivot koji je zaista na, a koji ste vi transcendirali, tako
ispravno i u svakom detalju, dok mi ostajemo tako neuki o tome? Zar nije to paradoksalno?
To izgleda paradoksalno, ali nije, jer moete razumeti samo kada ste transcendirali.
Dok ste u odreenom stanju uma, ne moete razumeti to stanje uma; suvie ste upleteni u to,
suvie ste identifikovani s tim. Za razumevanje je potreban prostor, rastojanje je potrebno, a tu
nema rastojanja. Kada transcendirate stanje uma, samo tada ete postati sposobni da razumete
to jer tada postoji distanca. Stojite podalje, odvojeno. Moete gledati objektivno,
neidentifikovani. Sada postoji perspektiva.
Dok ste u ljubavi, ne moete razumeti ljubav. Moete je oseati, ali je ne moete
razumeti. Suvie ste u tome. Za razumevanje, izdvojenost, nevezana izdvojenost je potrebna.
Za razumevanje treba da budete posmatra. Dok ste u ljubavi, posmatra se gubi. Vi ste
postali inilac, vi ste ljubavnik. Ne moete biti svedok toga. Samo kada transcendirate ljubav,
kada ste prosvetljeni i otili ste iznad ljubavi, biete sposobni da razumete to.
Dete ne moe da razume ta je detinjstvo. Kada se detinjstvo izgubi, moete da gledate
natrag i da razumete. Mladost ne moe razumeti ta je mladost. Samo kada postanete stari i
sposobni da gledate unatrag, izdaleka, na distanci, onda ete biti sposobni da razumete to. ta
god je shvaeno, shvaeno je samo pomou nadilaenja. Nadilaenje, transcendencija, je
osnova sveg razumevanja. Zbog toga to se deava svakog dana - moete dati savete, dobar
savet, nekome drugom ko je u nevolji; ako ste vi u nekoj nevolji, ne moete dati tako dobar
savet samome sebi.
Kad je neko drugi u nevolji, vi imate prostor da gledate, prouavate; moete svedoiti.
Moete dati dobar savet. Kada ste u istoj nevolji, neete biti tako sposobni. Moete biti
sposobni samo ako moete ak i onda biti izdvojeni, objektivni. Ako ak i onda moete
gledati na problem kao da niste u problemu, spolja, stojei na brdu i gledajui dole.
Svaki problem moe biti reen ako ste makar za jedan trenutak izvan toga i moete
gledati na to kao svedok. Svedoenje reava sve. Inae, ako ste duboko u nekom stanju, teko
je da se bude svedok. Suvie ste identifikovani. Dok ste u ljutnji, vi postajete ljutnja. Niko nije
preostao pozadi ko moe da vidi, promatra, prouava, da odlui. Niko nije ostao iza. Dok ste u
seksu, vi ste pobueni potpuno. Tada nema centra koji nije time obuhvaen.
U Upaniadama je reeno da osoba koja posmatra sebe jeste kao drvo na kome dve
ptice sede - jedna ptica samo skae, uiva, jede, peva, a druga ptica samo sedi na vrhu drveta
gledajui u prvu pticu.
Ako moete imati svedoee sopstvo na vrhu koje nastavlja da posmatra dramu dole
gde ste vi inilac, gde vi uestvujete, igrate, skaete, pevate, govorite i mislite i postajete
upleteni; ako neko duboko u vama moe stalno da posmatra ovu dramu, ako moete biti u
takvom stanju gde takoe igrate kao glumac na pozornici i istovremeno sedite u gledalitu i
posmatrate to; ako moete biti oboje: glumac i gledalac - svedoenje je stiglo unutra.
Svedoenje e vas uiniti sposobnim za saznanje, razumevanje, mudrost.
Tako to izgleda paradoksalno. Ako odete kod Bude, on moe ulaziti duboko u detalje
vaih problema, ne zato to je on u problemu, nego zato jer nije u problemu. On moe prodreti
u vas. Moe staviti sebe u vau situaciju, a da i dalje ostane svedok.
Tako oni koji su u svetu ne mogu razumeti svet. Oni koji su otili izvan njega, samo
oni ga razumeju. Dakle, ta god da elite razumeti, idite izvan toga. Ovo izgleda
paradoksalno. ta god elite znati, idite izvan toga - samo e se tada znanje dogoditi. Kreui
106
se unutar bilo ega moete sakupiti mnogo informacija, ali neete postati mudar ovek.
Moete praktikovati to svakog trenutka. Moete biti oboje: i glumac i gledalac. Kada
ste ljuti moete menjati um. Ovo je duboka umetnost, ali ako pokuate biete u stanju. Moete
menjati.
U jednom trenutku moete biti ljuti. Onda se izdvojte, gledajte u ljutnju, na vaem
vlastitom licu u ogledalu. Gledajte ta radite, gledajte ta se dogaa oko vas, gledajte ta ste
uradili drugima, kako oni reaguju. Pogledajte za trenutak, a onda opet budite ljuti, uite u
ljutnju. Onda opet postanite posmatra. Ovo se moe uraditi, ali za to je potrebna vrlo duboka
praksa.
Probajte to. Dok jedete, za trenutak budite onaj koji jede. Uivajte, postanite hrana,
postanite onaj koji jede - zaboravite da postoji bilo ko, ko moe posmatrati to. Kada ste se
uneli u to dovoljno, onda za jedan jedini trenutak se udaljite. Nastavite da jedete, ali ponite
da posmatrate to - hranu, sebe, a vi stojite iznad i posmatrate to.
Ubrzo ete postati efikasni, i moete premestiti mehanizam uma od poinioca do
gledaoca, od uesnika do posmatraa. A kada vam se to otkrije, onda ete videti da kroz
identifikovano uestvovanje nita nije mogue znati, samo kroz objektivno posmatranje stvari
postaju otkrivene i znane. Zbog toga oni koji su ostavili svet, postali su vodii. Oni koji su
otili s one strane, oni su postali majstori.
Frojd je obino govorio svojim uenicima... To je vrlo teko, jer Frojdovi uenici,
psihoanalitiari, nisu bili ljudi koji su transcendirali. Oni su iveli u svetu. Oni su samo
strunjaci. Ali ak je i Frojd predlagao njima da dok sluaju pacijenta, nekoga ko je bolestan,
mentalno bolestan: "Ostanite nepristrasni, izdvojeni. Nemojte se emocionalno uplitati. Ako se
upletete, onda je va savet beskoristan. Samo ostanite posmatrai."
ak i to izgleda vrlo okrutno. Neko jaue, plae, a vi to moete oseati jer ste ljudska
bia. Ali Frojd kae, ako radite kao psihijatar, kao psihoanalitiar, ostanite neupleteni.
Gledajte osobu kao da je ona samo problem. Ne gledajte na njega kao da je ljudsko bie. Ako
gledate na njega kao na ljudsko bie, vi ste odmah upleteni, vi ste postali uesnik, onda ne
moete savetovati. Onda sve to kaete bie pristrasno. Onda niste izvan toga.
To je teko, vrlo teko, stoga su frojdovci to inili na mnogo naina. Frojdovski
psihoanalitiar se nee suoiti sa pacijentom direktno, jer kada se suoite licem u lice teko je
ostati neupleten. Ako osobu pogledate u oi, vi ulazite u nju. Stoga frojdovski psihoanalitiari
sede iza, dok pacijent lei na divanu.
To je takoe vrlo vano, jer Frojd je shvatio da ako osoba lei, a vi sedite ili stojite, ne
gledajui u nju, manja je mogunost da budete upleteni. Zato? Osoba koja lei postaje
problem, kao na hirurgovom stolu. Moete da ga secirate. Obino, ovo se nikada ne deava.
Ako odete da sretnete osobu, nee vam govoriti leei dok vi sedite, dok nije pacijent, dok
nije u bolnici.
Stoga je Frojd insistirao da njegovi pacijenti treba da lee na kauu. Tako
psihoanalitiar stalno osea da je osoba pacijent, bolesnik. Njemu mora da se pomogne. On
trenutno nije osoba ve problem, a vi ne treba da se upliete s njim. On ne treba da se suoava
licem u lice sa osobom, ne treba da istupi pred pacijenta - samo skriven iza, on e ga sluati.
Frojd je rekao ne dodirujte pacijenta, jer ako ga dodirnete, ako uzmete pacijentovu ruku u
svoju ruku, postoji mogunost da budete upleteni.
Ove predostronosti treba preduzeti jer psihoanalitiari nisu prosvetljene osobe. Inae
ako odete kod Bude, nije potrebno da leite, nije potrebno da se skrivate iza zavese. To Budi
nije potrebno da bi ostao svestan kako ne bi postao upleten; on ne moe biti upleten. Koji god
da je sluaj, on ostaje neupleten.
On moe oseati samilost prema vama, ali on ne moe biti saoseajan, zapamtite ovo.
Pokuajte da razumete razliku izmeu saoseanja i samilosti. Samilost je iz vieg izvora. Buda
moe ostati samilostan prema vama. On vas razume - da ste u tekoi - ali on ne moe da
saosea zajedno sa vama jer zna da ste u tekoi zbog svoje nerazumnosti, zbog vae gluposti
ste u tekoi.
On ima samilost, pokuae na svaki nain da vam pomogne da izaete iz svoje
gluposti. Ali vaa glupost nije neto sa ime e on saoseati. Dakle, na neki nain on e biti
107
vrlo srdaan, a na neki nain e biti vrlo ravnoduan. Bie srdaan to se tie samilosti, a bie
apsolutno ravnoduan to se tie saoseanja.
Obino, ako odete kod Bude osetiete da je on ravnoduan - jer vi ne znate ta je
samilost i ne znate toplinu samilosti. Samo ste upoznali toplinu saoseanja, a on nije
saoseajan. On izgleda nemilosrdan, hladan. Ako jecate i plaete, on nee jecati i plakati s
vama. Ako bi on plakao, onda ne bi postojala mogunost da vam od njega doe pomo. On bi
bio u istom poloaju. On ne moe da plae, a vi ete se oseati povreeni: "Ja jadikujem i
plaem, a on ostaje kao statua, kao da je bez srca." On ne moe saoseati s vama. Saoseanje
je iz istog uma prema istom umu. Samilost je iz vieg izvora.
On moe da vas gleda. Vi ste providni za njega, potpuno goli, i on zna zato vi patite.
Vi ste uzrok, i on e pokuati da vam objasni uzrok. Ako moete da ga sluate, sam in
sluanja e vam pomoi mnogo.
To izgleda paradoksalno, ali nije. Buda je takoe iveo kao vi. Ako ne u ovom ivotu,
onda u nekim prethodnim ivotima. On je proao kroz iste nevolje. Bio je glup kao vi, patio je
kao vi, upinjao se kao vi. Tokom mnogo, mnogo ivota on je bio na istoj stazi. On zna sve
muke, sva upinjanja, sukobe, patnje. On je svestan, vie svestan nego vi, jer sada su svi proli
ivoti pred njegovim oima - ne samo njegov, nego vai takoe. On je proiveo sve probleme
koje svako ljudsko bie moe da doivi, stoga on zna. Ali on ih je nadiao, transcendirao, tako
sada zna koji su uzroci, i takoe zna kako oni mogu biti prevazieni.
On e pomoi na svaki nain da razumete da ste vi uzrok svojih patnji. Ovo je vrlo
teko. Najtea je stvar razumeti da Ja sam uzrok mojih patnji. Ovo pogaa duboko; ovek se
osea povreenim. Kad neko kae da je neko drugi uzrok, vi oseate da je u redu. Ta osoba
izgleda saoseajna. Ako on kae: "Vi ste paenik, rtva, a drugi vas eksploatiu, drugi nanose
tetu, drugi su nasilni," vi se oseate dobro. Ali ova dobrota nee dugo trajati. To je trenutna
uteha, a opasna, sa velikom cenom, jer pomae va uzrok patnje.
Stoga, oni koji izgledaju saoseajni prema vama su vai pravi neprijatelji, jer njihova
naklonost pomae vaem uzroku da bude ojaan. Pravi izvor patnje je ojaan. Vi oseate da
ste u redu a ceo svet je pogrean - patnja dolazi iz neega drugog.
Ako odete kod Bude, kod jedne prosvetljene osobe, on je prinuen da bude tvrd, jer e
vas prisiliti da shvatite injenicu da ste vi uzrok. Jednom kada ponete oseati da ste vi uzrok
svog pakla, transformacija je ve poela. Onog trenutka kada osetite ovo, pola posla je ve
uraeno. Ve ste na stazi; ve ste se pokrenuli. Velika promena je stigla kroz vas.
Pola patnji e iznenada nestati jednom kada razumete da ste vi uzrok, jer onda ne
moete saraivati sa njim. Onda neete biti tako neuki da pomaete jaanje uzroka koji
stvaraju patnje. Vaa saradnja e se prekinuti. Jadi e se jo nastaviti za kratko samo zbog
navike.
Jednom je Mula Nasrudin bio prisiljen da doe na sud jer su ga nali opet pijanog na
ulici. Sudija za prekraje je rekao: "Nasrudine, seam se da sam vas video tako mnogo puta
radi istog prekraja. Imate li neko objanjenje za vae uobiajeno pijanstvo? Nasrudin je
rekao: "Naravno, imam objanjenje za moje uobiajeno pijanstvo. Ovo je moje objanjenje:
uobiajena e."
ak i ako postanete budni, uobiajeni obrazac e vas prisiliti za kratko da se kreete u
istom pravcu. Ali to ne moe trajati za dugo; energije vie nema. To se moe nastaviti kao
mrtav obrazac, ali ubrzo to e uvenuti. To je potrebno svakog dana hraniti, to je potrebno
svakog dana ojaavati. Vaa saradnja je neprekidno potrebna.
Jednom kada postanete svesni da ste vi uzrok vaih patnji, saradnja otpada. Dakle, sve
to vam ja govorim jeste da vas uini spremnim za jednu injenicu - da gde god da ste, ta god
da ste, vi ste uzrok. Nemojte postati pesimistini oko toga, u ovome ima nade. Ako je neko
drugi uzrok, onda nita ne moe da se uini.
Zato Mahavira negira postojanje Boga. Mahavaira kae da nema Boga jer ako postoji
Bog, onda nita ne moe biti uinjeno. Onda je on uzrok svega, onda ta mi moemo da
uinimo? Onda smo nemoni. On je svorio svet, on je stvorio i nas. Ako je on tvorac, onda
108
samo on moe da ponitava. Ako smo mi u patnji, onda je on odgovoran i mi ne moemo
nita da uinimo.
Tako Mahavira kae da ako ima Boga onda je ovek bespomoan. On kae: "Ja ne
verujem u Boga." Razlog nije filozofski, razlog je veoma psiholoki. Razlog je takav da vi ne
moete uiniti nikoga odgovornim za sebe. Bilo da Bog postoji ili ne, to nije pitanje.
Mahavira kae: "elim da razumete da ste vi uzrok ta god da ste." A to daje veliku
nadu. Ako ste vi uzrok, vi moete to promeniti. Ako vi stvarate pakao, vi moete stvoriti raj.
Vi ste gospodar.
Stoga ne oseajte beznadenost. to vie inite druge odgovornim za va ivot, vie
ste rob. Ako kaete: "Moja ena me ini ljutim" onda ste vi rob. Ako kaete da vam va mu
stvara nevolju, onda ste rob. ak i ako vam va mu zaista stvara nevolju, vi ste odabrali tog
mua. Vi ste eleli tu nevolju, tu vrstu nevolje - to je va izbor. Ako vaa ena stvara pakao, vi
ste izabrali tu enu.
Neko je pitao Mulu Nasrudina: "Kako si upoznao svoju enu? Ko te je predstavio?"
On je rekao: "To se jednostavno dogodilo. Ne mogu kriviti nikoga."
Niko ne moe kriviti nikoga. A to nije samo deavanje, to je izbor. Poseban tip
mukarca bira poseban tip ene. No nije sluajno. A on je bira iz posebnih razloga. Ako ta
ena umre, on e ponovo izabrati isti tip ene. Ako se razvede od te ene, opet e se oeniti
istim tipom ene.
Moete nastaviti da menjate ene, ali dok se sam ovek ne promeni nee biti stvarne
promene - samo imena se menjaju - jer taj ovek bira. On voli odreeno lice, on voli poseban
nos, on voli odreene oi, on voli specifino ponaanje.
A to je kompleksna stvar. Ako volite poseban nos - jer nos nije samo nos. On nosi
ljutnju, on nosi ego, on nosi tiinu, on nosi mir, on nosi mnogo stvari - ako elite naroit nos,
vi moda volite osobu koja vas moe prisiliti da budete ljuti. Egoistina osoba ima drugaiji
tip nosa. Ona moe biti lepa. Ona izgleda lepo samo zato to ste vi u potrazi za nekim ko
moe stvoriti pakao za vas. Pre ili kasnije stvari e uslediti. Moda neete biti sposobni da ih
poveete. ivot je kompleksan, a vi ste tako mnogo upleteni u njemu da ne moete povezati
stvari. Biete sposobni da ih vidite samo kada ih nadiete.
To je upravo slino kao da letite u avionu iznad Bombaja. itav Bombaj se pojavljuje,
itav obrazac. Ako ivite u Bombaju i kreete se ulicama, ne moete videti ceo obrazac. Ceo
Bombaj ne moe videti onaj ko ivi u Bombaju. To moe videti samo onaj ko leti iznad. Onda
se ceo model pojavljuje. Onda se stvari pokazuju u svome obrascu. Transcendencija oznaava
odlaenje izvan ljudskih problema. Onda moete ui i videti.
Mnogo godina sam posmatrao mnoge osobe. ta god da one rade, one nisu svesne ta
rade. Ljudi postaju svesni samo kada dou rezultati. Nastavljaju da bacaju seme u zemlju;
nisu toga svesni. Tek kada dou do etve tada postaju svesni. Ne mogu da poveu da su izvor
problema i da su eteoci.
Jednom kada razumete da ste vi uzrok, pokrenuli ste se na stazi. Sada mnoge stvari
postaju mogue. Sada moete uiniti neto oko problema koji je va ivot. Moete ga
promeniti. Samo promenom sebe vi ga moete promeniti.
Jedna ena je dola kod mene - pripada vrlo bogatoj familiji, vrlo dobroj porodici,
kulturnoj, profinjenoj, obrazovanoj. Pitala me je: "Ako ponem da meditiram, da li e to na
bilo koji nain ometati moj odnos sa suprugom?" Sama je rekla, pre nego to sam odgovorio:
"Mislim da to ne bi trebalo da bude smetnja jer ako postanem bolja, mirnija i zaljubljenija -
kako to moe naruiti na odnos?"
Meutim, ja sam joj rekao: "Greite. Odnos e bi naruen. Bilo da postanete dobri ili
loi, to je nevano. Vi se menjate, jedan partner se menja - odnos e biti poremeen. A ovo e
postati udo: ako vi postanete loi, odnos nee biti ometen tako mnogo. Ali ako postanete
dobri i bolji, odnos e biti poljuljan, jer kada jedan partner pada dole i postaje lo, drugi se
osea bolje u poreenju sa njim. To nije povreda ega. Pre je to zadovoljavanje ega."
Dakle, ena se osea dobro ako mu pone da pije, jer sada ona postaje moralni
propovednik. Sada ona dominira nad njim vie. Sada kad god on ue u kuu on ulazi kao
kriminalac. Samo zato to on pije, sve to radi postaje pogreno. Toliko je dovoljno, jer ena
109
moe uvek da iznese taj argument, bilo gde. Tako, sve je osueno.
Meutim ako mu ili ena postanu meditativni, onda e biti jo ozbiljnijih problema
jer ego drugog e biti povreen - jedan postaje superiorniji, a drugi e pokuati na svaki nain
da ne dozvoli da se to dogodi. On e stvarati sve mogue nevolje. ak i ako se to dogodi, on
e pokuati da ne veruje u to, da se to dogodilo. On e kazati da se to jo nije dogodilo.
Nastavie da govori: "Ti meditira godinama i nita se nije dogodilo. Kakve koristi od toga?
Beskorisno. Ti se jo uvek ljuti, jo uvek ini ovo i ono, ostaje isti." Drugi e pokuati da
ubedi da se nita ne dogaa. To mu je uteha.
Ako se zaista neto dogodilo, ako se mu ili ena zaista promene, onda se ovaj odnos
ne moe nastaviti. To je nemogue dok drugi nije takoe spreman na promenu. A da se
postane spreman na promenu sebe vrlo je teko jer to povreuje ego. To znai ta god da ste,
vi ste pogreni. Samo je tada potreba za promenom prisutna.
Dakle, niko nikada ne misli da on mora da se menja: "Ceo svet mora da se menja, ne
ja. Ja sam u pravu, apsolutno ispravan, a itav svet je pogrean jer nije podoban meni." Sav
napor svih Buda je vrlo jednostavan: nastoji da vas uini svesnim da ta god da ste, vi ste
uzrok.
Drugo pitanje:
Zato tako mnogo osoba na stazi joge usvajaju stanovite borbe, upinjanja, potpunog
zanimanja za pridravanje strogih pravila, i ratnikih puteva? Da li je to nuno da bi se bio
pravi jogin?
To je apsolutno nepotrebno - ne samo nepotrebno, to stvara sve vrste prepreka na stazi
joge. Put borbe je najvea mogua prepreka jer nema nikoga protiv koga biste se borili. Ako
ponete da se borite, vi delite sebe.
A to je najvea bolest: da se bude podeljen, da se postane izofrenian. itava borba je
beskorisna, ona nikuda nee odvesti. Niko ne moe da pobedi. S obe strane ste vi. Dakle
uglavnom se moete igrati; moete igrati igru skrivanja i traenja. Ponekad deo A pobeuje,
ponekad deo B. Na taj nain moete se kretati. Ponekad ono to nazivate dobrim pobeuje.
Ali borei se sa zlom, pobeujui zlo, dobar deo postaje iscrpljen, a zli deo sakuplja energiju.
Tako pre ili kasnije zli deo e izai gore, i to se moe odvijati beskonano.
Ali zbog ega se ovaj put borbe deava? Zato veina ljudi zapoinje s borbom? Onog
trenutka kada pomisle o preobraaju, zapoinju da se bore. Zato? Zato to znate samo metod
pobeivanja, a to je borba.
U svetu spolja, u spoljanjem svetu, postoji samo jedan nain da se bude pobedonosan,
a to je borba - borba i unitenje drugog. To je jedini nain u spoljanjem svetu da se bude
pobedonosan. A vi ste iveli u ovom spoljanjem svetu milionima i milionima godina i borili
ste se - ponekad bivajui poraeni ako se ne borite dobro, ponekad postajui pobedonosni ako
se borite dobro. Dakle, to je postao unutra ugraen program "Bori se estoko." Postoji samo
jedan nain da se bude pobedonosan, a to je ljuta borba.
Kada napredujete unutra, vi sprovodite isti program jer ste upoznati samo sa njim. U
unutarnjem svetu, upravo je obrnut sluaj: ako se borite - biete pobeeni, jer nema nikog da
se s njim borite. U unutarnjem svetu, preputanje je put da se bude pobedonosan, predanost je
put da se bude pobedonosan, dozvoljavajui unutranjoj prirodi da tee, ne boriti se, jeste put
da se bude pobedonosan. Doputanje reci da tee, ne gurajui je, jeste put kada je u pitanju
unutarnji svet. Ovo je upravo obrnuto. Ali vi ste upoznati samo sa spoljanjim svetom, tako da
se ovo dogaa samo u poetku. Ko god krene unutra, on e nositi ista oruja, isto dranje, istu
borbu, istu odbranu.
Makijaveli je bio za spoljanji svet; Lao Ce i Buda su za unutarnji svet. I oni ue
razliite stvari. Makijaveli kae da je napad najbolja odbrana: "Ne ekajte da drugi napadne,
jer onda ste ve na gubitku. Ve ste izgubili, jer drugi je zapoeo. On je ve dobio, stoga je
uvek bolje zapoeti. Nemojte ekati da se branite, uvek budite napada. Pre nego to neko
napadne vas, vi napadnite njega i borite se onoliko veto koliko je mogue, s onoliko
nepotenja koliko je mogue. Budite nepoteni, budite lukavi i budite agresivni." To je nain
110
koji Makijaveli predlae. I Makijaveli je jedan estit ovek; zbog toga on predlae tano sve
to je potrebno.
Ali ako pitate Lao Cea, Patanjalija ili Budu, oni govore o razliitom tipu pobede - o
unutarnjoj pobedi. Tamo, podmuklost, nee delovati, obmanjivanje nee delovati, borba nee
delovati, agresija nee delovati jer koga ete obmanjivati? Koga ete pobediti? Vi ste sami tu.
U spoljanjem svetu nikada niste sami. Drugi su prisutni, oni su neprijatelji. U unutarnjem
svetu vi ste tu sami. Ne postoji drugi. Ovo je totalno nova situacija za vas. Vi ete nositi stara
oruja, ali ova stara oruja e postati uzrok vaeg poraza. Kada promenite svet od spolja ka
unutra, ostavite sve to ste nauili spolja. To nee biti od pomoi.
Neko je pitao Ramanu Maharija: "ta treba da nauim da bih postao smiren, da
spoznam sebe samog?" Pria se da je Ramana Mahari rekao: "Za dosezanje unutarnjeg
Sopstva ne treba da uite nita. Potrebno vam je oduavanje, uenje nee pomoi. To vam
pomae da napredujete spolja. Zaboravljanje svega nauenog e pomoi."
Sve to ste nauili, zaboravite to, zanemarite to, odbacite to. Kreite se unutra nevino,
bezazleno - bez lukavosti i vetina, ve s detinjastim poverenjem i nevinou; ne razmiljajui
u terminima da e vas neko napasti. Nema nikoga, tako ne oseajte se nesigurno i ne
sprovodite nikakve pripreme za odbranu. Ostanite ranjivi, prijemljivi, otvoreni. To je ono to
shraddha, poverenje, znai.
Sumnja je nuna spolja jer drugi je prisutan. On moda misli da vas obmane, stoga
treba da sumnjate i da budete skeptini. Unutra, nikakva sumnja, nikakav skepticizam nije
potreban. Nikog nema tamo da vas vara. Moete ostati tamo onakvi kakvi jeste.
Zbog toga svako ima dranje slino ratniku, ali ono nije nuno. To je smetnja, najvea
prepreka. Odbacite to van. Moete nainiti to glavnom stvari koja treba da se zapamti, da sve
to je nuno spolja unutra e postati smetnja. Bilo ta, kaem, bezuslovno. A ba obrnuto
treba da se proba.
Ako sumnja pomae spolja u naunim istraivanjima, onda e vera pomoi unutra u
religijskim istraivanjima. Ako agresivnost pomae spolja u svetu moi, prestia, drugih,
onda e neagresivnost pomoi unutra. Ako lukav, proraunati um pomae spolja, onda nevin,
neproraunat, bezazlen um e pomoi unutra.
Zapamtite ovo: ta god da pomae spolja, upravo obrnuto e pomagati unutra. Zato
itajte Makijavelijevo delo Vladalac (Il Principe). To je put spoljanje pobede. I samo kada
obrnete Makijavelijevog Vladara, moete stii unutra. Samo preokrenite Makijavelijevo
gledite, i on postaje Lao Ce - kao u shirshasanu, stoju na glavi. Makijaveli stojei na svojoj
glavi postaje Patanjali.
Dakle, itajte delo Vladalac; ono je divno - najjasnije izlaganje o spoljanjoj pobedi, a
onda itajte Lao Ceov Tao Te ing ili Patanjalijeve Joga sutre ili Budinu Dhammapadu ili
Isusovu Propoved na gori. Oni su samo protivreni, samo obrnuti, samo suprotni.
Isus kae: "Blagosloveni su oni koji su krotki, jer e naslediti zemlju" - krotki, nevini,
popustljivi, a ne jaki ni u kom smislu. "Blagosloveni su smerni u duhu, jer e ui u carstvo
boje." Isus to ini jasnim: "smerni u duhu". Oni nemaju nita na ta bi polagali pravo. Oni ne
mogu rei: "Ja sam dobio ovo." Oni ne poseduju nita - znanje, bogatstvo, mo, presti. Oni
ne poseduju nita, oni su skromni i smerni. Oni ne mogu polagati pravo: "To je moje."
Mi stalno zahtevamo: "To je moje, to je moje. Na to vie toga polaem pravo, to vie
oseam da 'ja jesam." U spoljanjem svetu, to je vea teritorija vaeg uma, va ego je vei. U
unutarnjem svetu, to je manja teritorija uma, vi ste vei. A kada teritorija iezne kompletno i
vi ste postali nula, onda - onda ste najvei. Onda ste pobedonosni. Onda se pobeda dogodila.
Ratniko dranje - naporna borba, previe velika zainteresovanost za pravila, ureenja,
proraunatost, planiranje - takav um je prenesen unutra jer ste nauili to i ne znate nita drugo.
Otuda, potreba za uiteljem. Inae, nastaviete da pokuavate svojim putevima koji su tamo
potpuno apsurdni.
Otuda, nuna je inicijacija. Inicijacija oznaava nekoga ko moe da vam pokae put
gde vi nikada niste putovali, nekoga ko moe da vam da letimino sagledavanje sveta kroz
njega, dimenziju koja je vama potpuno nepoznata. Vi ste gotovo slepi za to. Ne moete videti
to jer oi mogu videti samo ono to su one nauile da vide.
111
Ako doete ovde i ako ste kroja, onda ne gledate lica, gledate odela. Lica vam ne
znae mnogo; samo gledajui u odelo vi znate koji je to tip oveka. Vi znate jezik.
Ako ste obuar, nije vam potrebno da gledate u odelo; cipele e biti dovoljne. Obuar
moe samo da posmatra na ulici, i znae ko prolazi, da li je osoba veliki lider - samo gledajui
u cipele - da li je ona jedan umetnik, boem, hipik, bogat ovek, da li je kulturan, obrazovan,
neobrazovan, seljak - samo posmatranje cipela daje sve pokazatelje ko je ona. On zna jezik.
Da li ovek pobeuje u ivotu, cipela ima razliit sjaj. Ako je pobeen u ivotu, cipela je
poraena. Onda je cipela tuna, ne mari se za nju. Obuar zna to. Nije mu potrebno da gleda u
vae lice. Cipela e rei sve to on eli da zna.
Mi uimo sve i onda postajemo fiksirani u tome. Onda je to ono to vidimo. Vi ste
nauili neto, i potroili ste mnogo ivota uei to. Sada je to duboko ukorenjeno, utisnuto. To
je postalo deo vaih modanih elija. Dakle kada se kreete unutra tamo je jednostavno tama,
nita, ne moete videti nita. itav svet koji znate iezao je.
To je ba kao kada znate jedan jezik i iznenada ste poslati u zemlju gde niko ne
razume va jezik i vi ne moete razumeti niiji jezik. Ljudi razgovaraju i askaju, a vi oseate
jednostavno da su oni ludi. Izgleda kao da izgovaraju besmislice, a to izgleda vrlo buno jer
ne moete razumeti. Izgleda vam da oni govore preglasno. Ako ih moete razumeti, onda se
cela stvar menja; vi postajete deo toga. Onda to nije mrmljanje; to postaje razumljivo.
Kada uete unutra vi znate jezik spoljanjeg. Unutra postoji tama. Vae oi ne mogu
videti, vae ui ne mogu uti, vae ruke ne mogu oseati. Neko je potreban, neko da vas uputi,
da uzme vau ruku u svoju ruku i pokrene vas na ovoj nepoznatoj stazi dok ne postanete
upoznati, dok ne zaponete da oseate, dok ne postanete svesni neke svetlosti, nekog
znaenja, nekog smisla oko vas.
Jednom kada imate prvu inicijaciju, stvari e poeti da se deavaju. Inae prva
inicijacija je teka stvar, jer je to potpuni preokret. Iznenada va svet znaenja iezava. Vi ste
u nepoznatom svetu. Ne razumete nita - gde da se kreete, ta da radite i ta da nainite od
tog haosa. Majstor samo predstavlja nekoga ko zna. A ovaj haos, unutarnji haos, za njega nije
haos, za njega je to red, kosmos, i on vas moe voditi u njega.
Inicijacija oznaava gledanje kroz unutranji svet kroz oi nekog drugog. Bez
poverenja to je nemogue jer vi neete dozvoliti da vaa ruka bude uzeta od nekoga da vas
vodi u nepoznato. A on vam ne moe dati nikakvu garanciju. Nikakva garancija ne bi bila ni
od kakve koristi. ta god da on kae, vi morate uzeti to na poverenje.
U drevnom vremenu kada je Patanjali pisao ove sutre, poverenje je bilo vrlo lako, jer
u spoljanjem svetu takoe, naroito na Istoku i specijalno u Indiji, oni su stvorili spoljanji
obrazac inicijacije. Na primer, zanati, profesije, pripadali su porodicama kroz naslee. Otac bi
inicirao dete u zanimanje, a dete je prirodno verovalo svom ocu. Otac bi odveo dete na farmu
ako je ratar i farmer, i uputio ga u njegovu poljoprivredu. Koji god posao da je radio, on bi
uveo dete.
U spoljanjem svetu takoe, postojala je inicijacija na Istoku. U sve je trebalo da se
bude iniciran - neko koji zna bi vas uveo. Ovo je pomagalo vrlo mnogo jer ste bili upoznati sa
inicijacijom s nekim ko bi vas vodio. Dakle, kada doe vreme za inicijaciju, vi ste mogli
verovati.
A poverenje, shraddha, vera, bila je laka u svetu koji nije bio tehnoloki.
Tehnolokom svetu treba otroumnost, lukavost, kalkulacija, matematika, promuurnost - ne
nevinost. U tehnolokom svetu, ako ste nevini izgledaete smeno; ako izgledate otroumno,
izgledaete mudri, inteligentni. Nai univerziteti ne ine nita do ovo: ine vas domiljatim,
lukavim, proraunatim. Vie proraunatosti, vie lukavosti, i uspeniji ete biti u svetu.
Sasvim obrnut je bio sluaj sa Istokom u prolosti. Ako ste bili lukavi za vas ne bi bilo
mogue da uspete ak ni u spoljanjem svetu. Samo nevinost je bila prihvatana. Tehnika nije
uvaavana previe, ali unutranji kvalitet je vrednovan previe.
Ako je osoba lukava i pravi bolje cipele, niko ne bi iao kod nje na Istoku u prolosti.
Odlazili bi kod osobe koja je nevina. Ona moda ne bi pravila bolje cipele, ali oni bi odlazili
kod osobe koja je bezazlena jer cipela nije ba bilo ta, ona nosi kvalitet osobe koja ju je
napravila. Dakle ako bi postojao lukav i domiljat tehniar, niko ne bi iao kod njega. On bi
112
trpeo, ne bi bio uspean. Ali ako bi bio ovek kvaliteta, karaktera, bezazlenosti, ljudi bi ili
kod njega. ak i ako su loije, ljudi bi vie cenili njegove stvari.
Kabir je bio tka i ostao je tka. ak i kada je postigao prosvetljenje, nastavio je da
tka. On je bio tako ekstatian, da njegovo tkanje nije moglo biti mnogo dobro. On je pevao,
plesao i tkao! Bilo je mnogo greaka i mnogo neispravnosti, ali njegove stvari su bile cenjene,
izuzetno cenjene.
Mnogi ljudi bi samo ekali kada e Kabir doneti neto - to nije bila samo stvar, artikal,
to je bilo od Kabira! Sama stvar je u sebi imala unutarnji kvalitet, dola je iz Kabirovih ruku.
Kabir je dodirnuo. Kabir je plesao oko nje dok je tkao. I neprekidno se seao boanskog, tako
je stvar - tkanina, odea ili bilo ta - postala duhovna, sveta. To je davalo kvalitet stvarima.
Tehnika strana je sporedna; ljudska strana je bila primarna.
Tako ak i u spoljanjem svetu na Istoku, oni su sproveli obrazac tako da kada se
okrenete unutra neete biti totalno neupoznati sa unutarnjim svetom; neto ete znati, neka
uputstva, neka svetla u vaoj ruci. Neete se kretati u totalnoj tami.
I ovo poverenje u spoljanje odnose bilo je svuda. Mu nije mogao verovati da
njegova ena moe biti neverna. To je bilo gotovo nemogue. A ako mu umre, ena bi umrla
s njim jer ivot je bio takav zajedniki fenomen. Tada je bilo besmisleno iveti bez nekoga s
kojim je ivot postao tako zajednika stvar.
To je kasnije postalo runo, ali u poetku je to bila jedna od najlepih stvari koja se
ikada dogaala na zemlji. Vi ste voleli nekoga i on je nestao - eleete da nestanete s njim. Da
se bude bez njega bilo bi gore nego smrt. Smrt je bolja i vredna izbora - takvo je bilo
poverenje u spoljanje stvari takoe. Odnos ene i mukarca je spoljanja stvar. Celo drutvo
se kretalo oko poverenja, vere, istinskog deljenja, onda je to bilo korisno. Kada jednom doe
vreme da se krene unutra, sve ove stvari bi pomogle da se bude iniciran lako - da se veruje
nekome, da se preda.
Borba, upinjanje, agresivnost su prepreke. Ne sprovodite ih. Kada se kreete prema
unutra, ostavite ih pred vratima. Ako ih nosite, propustiete unutarnji hram; nikada ga neete
dostii. S ovim stvarima ne moete da se kreete prema unutra.
Tree pitanje:
Nije li vairagya, nevezivanje ili beeljnost, dovoljna sama po sebi da oslobodi oveka
od svetovnog robovanja? Kakva je onda korist od jogijske discipline, od abhyase?
Vairagya je dovoljna, beeljnost je dovoljna. Onda nikakva disciplina nije potrebna.
Ali gde je ta beeljnost? Ona nije tu. Zato je potrebna pomo discipline. Disciplina je
potrebna samo zato jer ta beeljnost nije u svojoj celosti unutar vas. Ako je beeljnost tu, onda
ne postoji pitanje praktikovanja iega; nikakva disciplina nije potrebna. Vi neete doi da
sluate mene; neete ii da itate Patanjalijeve sutre. Ako je beeljnost potpuna, Patanjali je
beskoristan. Zato gubiti vae vreme sa Patanjalijevim sutrama? Ja sam beskoristan, zato da
dolazite kod mene?
Vi ste u potrazi za disciplinom. Vi se kreete u potrazi za nekom disciplinom koja vas
moe preobraziti. Vi ste uenik ("disciple"), a "disciple" oznaava osobu koja je u potrazi za
disciplinom. Nemojte obmanjivati sebe. ak i ako odete kod Krinamurtija, vi ste u traganju
za disciplinom - jer onaj ko nema tu potrebu nee ii. ak i ako Krinamurti kae da niko ne
treba da bude uenik i nikakva disciplina nije potrebna, zato ste vi tu? I te njegove rei e
postati vaa disciplina, stvoriete obrazac, i poeete da sledite taj obrazac.
Beeljnost ne postoji, zato ste u patnji. A niko ne eli da pati, i svako eli da
transcendira patnju. Kako da je transcendira? To je ono to e disciplina pomoi da uinite.
Disciplina samo znai: uiniti vas spremnim za skok, za skok u beeljnost. Disciplina
oznaava trening.
Vi jo niste spremni, imate vrlo grub mehanizam. Vae telo, va um, oni su grubi. Oni
ne mogu primiti suptilno. Niste usaglaeni. Da biste primili suptilno, morate biti usklaeni.
Vaa grubost mora da iezne. Zapamtite ovo - da biste primili suptilno moraete da postanete
suptilni. Takvi kakvi ste, boansko moe biti oko vas, ali vi ne moete biti u dodiru s njim.
113
To je isto kao radio. Lei dole u sobi, ali ne funkcionie. Neke ice su pogreno
povezane, ili su neke ice pokidane, ili nedostaje neki prekida. Radio postoji, radio talasi
neprekidno prolaze, ali radio nije podeen i nije sposoban da prima talase.
Vi ste ba kao radio, niste u stanju u kome moete da funkcioniete. Mnoge stvari
nedostaju, mnoge svari su pogreno spojene. "Disciplina" znai da vi uinite va radio
funkcionalnim, sposobnim da prima, podeenim. Boanski talasi su svuda oko vas. Jednom
kada ste usaglaeni oni poinju da se ispoljavaju. A oni mogu da se ispolje samo kroz vas, i
dok ne postanu ispoljeni kroz vas, ne moete ih znati. Oni mogu postati ispoljeni kroz mene,
oni mogu postati ispoljeni kroz Krinamurtija, ili nekog drugog, ali oni ne mogu postati vaa
transformacija.
Vi ne moete znati ta se stvarno deava u Krinamurtiju, u Gurijevu - ta se deava
iznutra, koja vrsta usaglaavanja se dogaa, kako je njihov mehanizam postao tako suptilan da
prima suptilne poruke iz univerzuma, kako egzistencija zapoinje da manifestuje sebe kroz
njih.
Disciplina oznaava promenu vaeg mehanizma, da ga podesi, da ga naini podesnim
instrumentom da bude izrazito prijemiv. Ponekad bez discipline, takoe, ovo moe sluajno
da se dogodi. Radio moe pasti sa stola. Samo padom, sluajno, neke ice mogu da se poveu
ili prekinu. Samo udarcem radio moe biti povezan sa stanicom. Onda e zapoeti da
objavljuje neto, ali to e biti haos.
To se deavalo mnogo puta. Ponekad kroz sluajnost ljudi bi doli do saznanja
boanskog i osetili boansko. I onda oni polude jer nisu disciplinovani da prime tako moan
fenomen. Oni nisu spremni. Oni su tako mali, a tako veliki okean ih preplavi. Ovo se
deavalo. U sufi sistemu oni nazivaju takve osobe lude za bogom - masti, tako ih oni zovu.
32
Mnogi ljudi ponekad bez discipline - kroz neki sluaj, kroz nekog majstora, kroz
milost nekog uitelja ili samo kroz prisustvo nekog uitelja - postaju usaglaeni. itav njihov
mehanizam nije spreman, ali deo zapoinje da funkcionie. Onda oni ispadaju iz drutvenog
poretka. Onda ete oseati da su ludi, jer e zapoeti da rade i govore stvari koje izgledaju
nepovezane. I oni takoe oseaju da se neto u njima pokrenulo nepovezano, ali ne mogu
uiniti nita. Neto je zapoelo u njima; ne mogu to da zaustave. Oni oseaju odreenu sreu.
Zbog toga su nazvani masti, sreni ljudi. Ali oni nisu slini Budi, oni nisu prosvetljeni. Kae
se za maste, za ove srene ljude koji su poludeli, da je vrlo veliki uitelj potreban jer oni sada
ne mogu uiniti nita sa sobom. Oni su samo u konfuziji - sreni su u njoj, ali su u neredu.
Oni ne mogu sami initi nita.
U drevnim danima, veliki sufi majstori su se kretali po zemlji. Kad god bi uli za
nekog masta, otili bi kod njega da mu pomognu da se usaglasi.
U ovom veku samo Meher Baba je obavljao taj posao - veliki posao svoje vrste, redak
posao. Neprekidno, tokom mnogo godina, on je putovao svuda po Indiji, a mesta koja je
poseivao bile su ludnice, jer u ludnicama ive mnogi masti. Inae vi ne moete napraviti
nikakvu razliku ko je lud, a ko je mast; oboje su ludi. Ko je stvarno lud, a ko je lud upravo
zbog boanskog uticaja - jer neko usaglaavanje se dogodilo kroz neki sluaj! Vi ne moete
uoiti nikakvu razliku.
Mnogi masti su ovde. Meher Baba bi putovao i iveo bi u ludnicama, i on je pomagao
i sluio maste, lude ljude. Mnogi od njih su izali iz svoje ludosti i zapoeli svoje putovanje
prema prosvetljenju.
Na Zapadu mnogi ljudi su u ludnicama, utoitima za lude, mnogi kojima ne treba
nikakva psihijatrijska pomo jer psihijatri ih samo mogu opet uiniti normalnim.
Njima treba pomo nekoga ko je prosvetljen, ne psihijatar, jer oni nisu bolesni. Ili, ako
su bolesni, bolesni su od boanske bolesti. Vae zdravlje nije nita pred tom boleu. Ta
bolest je bolja - vredna gubljenja sveg vaeg "zdravlja". Disciplina je potrebna.
U Indiji ovaj fenomen nije bio tako znaajan kao to je bio u islamskim zemljama.
Zbog toga sufiji imaju specijalne metode da pomognu ovim mast ljudima, ljudima ludim za
Bogom.
32
I u drugim tradicijama se spominju, kao na primer jurodivi u hrianstvu, ludije ili boanski ludaci u
Tibetu.
114
Ali Patanjali je stvorio tako suptilan sistem da nije potreban nikakav sluaj.
Disciplina je tako nauna da ako proete kroz ovu disciplinu, vi ete dostii Budinstvo a da ne
postanete ludi na stazi. To je kompletan sistem.
Sufizam jo nije kompletan sistem. Mnoge stvari nedostaju u njemu, a one nedostaju
usled svojeglavog dranja muslimana. Oni ne dozvoljavaju tome da se razvije do svoje
najvie vrednosti i vrhunca. A sufi sistem mora da sledi obrazac islamske religije. Zbog
strukture islamske religije, sufi sistem nije mogao otii izvan nje.
33
Patanjali ne sledi nijednu religiju, on sledi samo istinu. On ne pravi nikakav
kompromis sa hinduizmom, islamizmom ili bilo kojim izmom. On sledi naunu istinu. Sufiji
su morali da naine kompromis sa islamom, morali su to. Zato to je bilo nekih sufija koji su
pokuali da ne naine nikakav kompromis; na primer, Bajazid iz Bisthama, ili Al-Hillaj
Mansur, oni nisu nainili nikakav kompromis i zaklani su, oni su bili ubijeni.
Tako su sufisti poeli da se skrivaju. Nainili su svoju nauku sasvim tajnom, i
dopustili su da samo delovi budu poznati, samo oni delovi koji su podesni za islam i njegov
obrazac. Svi drugi delovi bili su skriveni.
34
Tako da ceo sistem nije poznat; on nije dostupan.
Tako su mnogi ljudi kroz dostupne delove postali ludi.
Patanjalijev sistem je kompletan, a disciplina je potrebna. Pre nego to se krene u
nepoznati svet unutranjosti, ozbiljna disciplina je potrebna tako da se nikakav nesrean sluaj
ne dogodi. Ako se kreete bez discipline, mnoge stvari su mogue.
Vairagya je dovoljna, ali ta "dovoljna" vairagya nije prisutna u vaem srcu. Ako
postoji, onda nema pitanja. Onda zatvorite Patanjalijevu knjigu i ostavite je. Apsolutno je
nepotrebna. Ali ta "dovoljna" vairagya ne postoji. Bolje je kretati se na stazi discipline, korak
po korak, tako da ne postanete rtva neke nesree. Udesi... mogunost postoji.
Mnogi sistemi deluju u svetu, ali ne postoji tako savren sistem kao Patanjalijev, jer
nijedna zemlja nije radila toliko dugo. Patanjali nije zaetnik ovog sistema, on je samo
zapisniar. Pre Patanjalija, hiljadama godina, sistem je bio razvijan. Mnogi ljudi su radili na
tome. Patanjaliju je data sama sutina hiljadugodinjeg rada.
Ali on je nainio to na takav nain da se moete kretati sigurno. Samo zato to kreete
unutra, nemojte misliti da se kreete u sigurnom svetu. To moe biti nesigurno. To je takoe
opasno; moete biti izgubljeni u tome. Ako se izgubite u tome, vi ete poludeti. Zbog toga
uitelji kao Krinamurti koji insistiraju da nikakav uitelj nije potreban, jesu opasni, jer ljudi
koji su neinicirani mogu zauzeti svoje gledite i mogu zapoeti da rade sami po svome.
Zapamtite, ak i ako va runi asovnik ne radi tano, vi imate tenju i radoznalost -
jer ona dolazi od majmuna - da ga otvorite i uradite neto. Teko je odupreti se tome. Ne
moete verovati da ne znate nita o tome. Iako to posedujete. Samo ako ste vlasnik sata, to ne
znai da znate bilo ta o satu. Ne otvarajte ga! Bolje je dati ga pravoj osobi koja poznaje te
stvari. asovnik je jednostavan mehanizam; um je tako kompleksan mehanizam. Nikada ga
ne otvarajte sami jer ta god da uradite bie pogreno.
Ponekad se dogaa da se va asovnik pokvari - vi ga samo prodrmate i poinje da
radi. Meutim to nije nauka. Ponekad se deava da vi neto uradite, i samo sreom, sluajno,
oseate da se neto dogaa. Ali vi niste postali majstor. Ako se to dogodilo jednom, ne
pokuavajte to ponovo, jer ako sledei put protresete svoj sat on e moda stati. To nije nauka.
Ne pokreite se nasumino. Disciplina je jedina zatita. Ne kreite se nasumino!
Kreite se sa uiteljem koji zna ta radi, a on zna ako neto krene pogreno da to vrati na pravi
put, koji je svestan vae prolosti i koji je takoe svestan vae budunosti, i koji moe spojiti
zajedno vau prolost i budunost.
Otuda tako veliko naglaavanje uitelja u indijskoj tradiciji. A oni su znali, ustanovili
da ne postoji mehanizam tako kompleksan kao ljudski um, nema kompjutera tako sloenog
kao ljudski um.
ovek nije mogao jo da razvije nita slino ljudskom umu - i ja mislim da se nikada
33
Sufizam je mnogo stariji sistem duhovnog probuenja nego islamska religija. Kada je islam nastao, on je
nasilno unitavao drevne sufijske kole i ubijao uitelje, a oni koji su preostali bili su asimilovani u islam. Sva
duhovnost koja danas postoji u islamu potie od uticaja sufizma deformisanog islamskim uenjem.
34
Neto od tajnih delova znanja sufija preneli su savremenom oveku Gurijev i Meher Baba kroz svoja dela.
115
nee razviti, jer ko e to razviti? Ako ljudski um moe razvijati neto, to e uvek biti nie i
manje nego to je um koji ga je stvorio. Barem jedna stvar je sigurna: da sve to ljudski um
stvori, ta stvorena stvar ne moe kreirati ljudski um. Tako da ljudski um ostaje najsuperiorniji,
najsavreniji sloeni mehanizam.
Ne inite nita samo radi radoznalosti, ili zato to drugi to rade. Postanite inicirani, i
kreite se s nekim koji zna valjano stazu. Inae ludilo moe da bude rezultat. A to se deavalo
ranije; to se deava mnogim ljudima upravo sada.
Patanjali ne veruje u sluajnosti. On veruje u nauni red. Tako je on dao jedan-po-
jedan korak. Ovo dvoje je on nainio svojom bazom - vairagya, beeljnost i abhyasa,
konstantna, svesna veba. Abhyasa je sredstvo, a vairagya je cilj. Beeljnost je cilj, a
konstantna, svesna unutarnja praksa je sredstvo.
Ali cilj zapoinje od samog poetka i ishod je skriven u poetku. Drvo je skriveno u
semenu, tako da poetak sadri u sebi kraj, odnosno cilj. Zbog toga on kae da je beeljnost
potrebna u poetku takoe. Poetak sadri ishod u sebi, i ishod takoe ima svoj poetak.
Tako kada ak i kada majstor postane usavren, potpun, on nastavlja da veba. Ovo e
vama izgledati apsurdno. Vi treba da vebate jer ste na poetku i cilj treba da bude postignut,
ali kada je cilj postignut ak i tada se veba nastavlja. To postaje sada spontano, ali se
nastavlja. To se nikada ne zaustavlja. Ne moe, jer cilj i poetak nisu dve stvari. Ako je drvo u
semenu, onda na drvetu e ponovo doi seme.
Neko je pitao Budu - jedan od njegovih uenika, Purnakajapa - pitao je: "Mi vidimo,
bhante, da vi jo sledite odreenu disciplinu."
Buda jo sledi izvesnu disciplinu. On se kree na odreen nain, on sedi na odreen
nain, on ostaje budan, on jede odreene stvari, on se ponaa na odreen nain, sve izgleda da
je disciplinovano.
Stoga Purnakajapa kae: "Vi ste postali prosvetljeni, ali mi vidimo da vi jo imate
odreenu disciplinu." Buda je odgovorio: "To je postalo tako ukorenjeno da sada ne sledim ja
to, to sledi mene. To je postalo senka. Ne treba da mislim o tome. To je tu, uvek tu. To je
postalo senka."
Kraj prve knjige
116
Osho
JOGA: ALFA I OMEGA
Knjiga druga
Poglavlje 1
ZNAENJE SAMADHIJA
Izlaganje 1. januara 1975. u Buddha dvorani.
I, 17: vitarkavicarananadasmitarupanugamatsamprajnatah.
Kada proizlazi iz Razlikovanja, Razgonetnutosti, Uitka ili Oseanja
samodovoljnosti [usredsreenost, (samadhi)] je [jo uvek po karakteru]
opojmljavajua (samprajnata).
I, 18: viramapratyayabhyasapurvah samskaraeo 'nyah.
Nakon to se vebanjem dostigne stanje zaustavljenosti [bilo kakvih] poticaja
[spolja] (viramapratyaya) [i samo] ranije oformljene predisponiranosti (samskara) ostaju
[ta usredsreenost predstavlja onu] drugu [vrstu koja nije spoznavajua
(asamprajnata)].
I, 19: bhavapratyayo videhaprakrtilayanam.
Roenjem je dat [asamprajnatasamadhi] onih neinkarniranih (videha) i onih
[ije su se pojedinane forme] u pramateriji (prakrti) apsorbovale.
I, 20: raddhaviryasmrtisamadhiprajnapurvaka itaream.
Inae [da bi se na drugi nain stiglo do asamprajnatasamadhija potrebno je da]
prethodi [itav niz posredujuih uslova:] predanost, energinost, pribranost,
koncentrisanost i mo jasnog razaznavanja.
Patanjali je najvei naunik unutarnjeg. Njegov pristup je pristup naunog uma; on
nije pesnik. I zato je on vrlo redak, jer oni koji ulaze u unutarnji svet skoro uvek su pesnici, a
oni koji ulaze u spoljanji svet skoro su uvek naunici.
Patanjali je redak cvet. On ima nauni um, ali njegovo putovanje je unutarnje. Zbog
toga je postao prva i poslednja re: on je alfa i omega. Za pet hiljada godina niko nije mogao
da ga nadmai. Izgleda da je on nenadmaan. On e ostati poslednja re - jer sama ta
kombinacija je nemogua; da se ima nauno dranje i da se ue u unutarnje, skoro je
nemogue. On govori kao matematiar, kao logiar. On govori kao Aristotel, a on je i
Heraklit.
Pokuajte da razumete svaku njegovu re. To e biti teko jer njegovi izrazi e biti iz
logikog rasuivanja, ali njegovo ukazivanje je prema ljubavi, prema ekstazi, prema
Boanskom. Njegovi struni izrazi su od oveka koji radi u naunoj laboratoriji, ali njegova
laboratorija je u unutarnjem biu. Stoga ne budite zavedeni njegovom terminologijom, i
sauvajte oseanje da je on matematiar najvie poezije. On je paradoksalan, ali nikada ne
koristi paradoksalan jezik. On to ne moe. Dri se vrlo vrste logine pozadine ili osnove.
Analizira, secira, ali njegova namera je sinteza. On analizira samo da bi nainio sintezu.
117
Dakle, uvek imajte na umu cilj - ne budite zavedeni putem - dostignite krajnji cilj kroz
nauni pristup. Zato je Patanjali impresionirao tako mnogo zapadni um. Patanjali je uvek
bio uticajan. Gde god je njegovo ime stiglo, on je vrio uticaj jer ga lako moete razumeti; ali
nije dovoljno razumeti ga. Razumeti njega isto je tako lako kao razumeti Ajntajna. On govori
intelektu, ali njegova tenja, njegova meta je srce. Ovo treba da zapamtite.
Kretaemo se po opasnom terenu. Ako zaboravite da je on takoe i pesnik, biete
zavedeni. Onda postajete previe vezani uz njegovu terminologiju, jezik, rasuivanje, i
zaboravljate njegov cilj. On trai od vas da odete izvan miljenja, rasuivanja, ali kroz
rasuivanje. To je mogunost. Moete iscrpeti miljenje tako potpuno da ga transcendirate.
Idite kroz rasuivanje, ne izbegavajte ga. Koristite razum kao korak da odete izvan njega.
Sluajte sada njegove rei. Svaka re treba da bude analizirana.
Sampranata samadhi je samadhi koji je praen rasuivanjem, razmiljanjem,
blaenstvom i oseajem istog bivanja.
On deli samadhi, ono najvie, u dva koraka. Ono konano ne moe biti podeljeno. To
je nedeljivo i zapravo, nema koraka. Meutim, da bi pomogao umu, tragaocu, on to deli za
poetak u dva dela. Prvi korak naziva sampranata samadhi - samadhi u kome je um sauvan
u svojoj istoti.
Prvi korak: um mora da bude profinjen i proien. Vi ga jednostavno ne moete
ostaviti, Patanjali kae - nemogue ga je odbaciti jer neistoe imaju tendenciju da
prijanjaju. Moete ga ostaviti samo kada je um apsolutno ist - tako profinjen, tako suptilan,
da nema tendenciju da se lepi.
On ne kae "Odbaci um", kao to kae Zen uitelj. On kae da je to nemogue;
govorite besmislicu. Vi kaete istinu, ali to sada nije mogue jer neist um ima breme. On
pada kao kamen. A neist um ima elje, milione elja, neispunjenih, ezne da budu ispunjene,
trai da budu ispunjene, milioni nedovrenih misli su u njemu. Kako to moete odbaciti?
Nepotpuno uvek pokuava da bude upotpunjeno.
Zapamtite, kae Patanjali, moete ostaviti stvar samo kada je dovrena. Jeste li
zapazili? Ako ste slikar i slikate, dok se slikanje ne dovri, vi ga ne moete zaboraviti. Ono se
produava, spopada vas. Ne moete spavati dobro; ono je tu. U umu ono struji skriveno ispod
povrine. Ono se kree, trai da bude dovreno. Jednom kada se dovri, tada je gotovo. Ne
moete na to zaboraviti. Um ima tenju ka dovravanju. Um je perfekcionista, tako da sve to
je nedovreno jeste napetost za um. Patanjali kae da ne moete ostaviti razmiljanje dok
ono ne postane tako savreno da nema vie nita da se ini s njim. Tada ga jednostavno
moete ostaviti i zaboraviti.
Ovo je sasvim dijametralno suprotan put od Zena, od Heraklita. Prvi samadhi, koji je
samadhi samo zbog imena, jeste sampranata - samadhi sa fino proienim umom. Drugi
samadhi je asampajnata - samahi bez uma. Ali Patanjali kae da kada um iezne, onda,
takoe nema misli, onda se isto tako, suptilno seme iz prolosti zadrava u nesvesnom.
Svesni um je podeljen na dva dela. Prvi, sampranata - um sa proienim stanjem,
upravo kao proieni maslac. On ima svoju sopstvenu lepotu, ali je tu. A koliko god lep, um
je odvratan. Ma koliko ist i smiren, sam fenomen uma je neist. Vi ne moete proistiti
otrov. On ostaje otrov. Nasuprot tome, to ga vie proiavate, postaje mnogo otrovniji. On
moe izgledati vrlo, vrlo lepo. Moe imati svoju vlastitu boju, prelive, ali jo je neist.
Prvo proistite; onda ostavite. Ali onda se putovanje ne zavrava, jer sve je ovo u
svesnom umu. ta ete initi sa nesvesnim? Upravo iza slojeva svesnog uma je irok
kontinent nesvesnog. Tamo u nesvesnom ima semena iz svih vaih prolih ivota.
35
Stoga Patanjali deli nesvesno na dva dela. On kae sabija (sabia), samadhi kada je
nesvesno tu, a samo je svesni um odbaen, to je samadhi sa semenom - sabija. A kada je ovo
35
Semenja iz prolih ivota jesu vasane, podsvesni utisci sauvani iz svih ivota. Na osnovu njih imamo
pamenje i identitet due u telu, ali one nas i vezuju za ono od ega treba da se oslobodimo, za prolost i iluziju
telesnog opstanka. Kae se da to seme treba da bude spaljeno (ispeeno) na vatri svesti. Inae e klijati u nove
utiske i vezanosti koje e izazivati nova preporaanja.
118
seme takoe spaljeno, onda postiete savreni - nirbija (nirbia) samadhi; samadhi bez
semena.
Dakle svesno u dva koraka, onda nesvesno u dva koraka. A kada je nirbia samadhi,
krajnja ekstaza bez ikakvog semena unutar vas da klija, cveta i da vas vodi na dalja putovanja
u egzistenciju onda vi iezavate.
U ovim sutrama on kae:
Sampranata samadhi je samadhi koji je praen rasuivanjem, razmiljanjem,
blaenstvom i oseajem istog bivanja.
Meutim, ovo je prvi korak; mnogi su zavedeni - oni misle ovo je zadnji korak zato
to je tako ist i oseate se tako blaenim i tako srenim da mislite da sada nema vie niega
da se postigne. Ako pitate Patanjalija, on e rei satori iz Zena je samo prvi samadhi. To nije
najvee, krajnje; krajnje je jo daleko.
Rei koje on koristi ne mogu se tano prevesti jer sanskrit je najsavreniji jezik;
nijedan jezik nije ni priblian kao on. Tako da u morati da vam ih objasnim. Koriena je re
vitarka; na engleskom je prevedena kao rasuivanje. To je nezadovoljavajui prevod. Vitarka
se mora razumeti. Tarka znai logiko zakljuivanje; onda Patanjali kae da postoje tri tipa
logike. Jedan tip on naziva kutarka - miljenje orijentisano prema negativnom; uvek mislei u
terminima poricanja, osporavanja, sumnje, nihilizma.
Bilo ta da kaete, ovek koji ivi u kutarki - negativnoj logici - uvek misli kako da to
ospori, kako da kae 'ne' tome. On izgleda negativno. Uvek se ali, guna. Uvek osea da je
negde neto pogreno. Ne moete ga postaviti u pozitivno jer je takva njegova orijentacija.
Ako mu kaete da posmatra sunce, on nee gledati sunce. On e videti suneve pege, nai e
uvek tamniju stranu stvari: to je kutarka. To je kutarka - pogreno rasuivanje - ali izgleda
kao rasuivanje.
To vodi na kraju do ateizma. Onda poriete Boga, jer ako ne moete videti ono to je
dobro, svetlije strane ivota, kako moete videti Boga? Vi jednostavno poriete. Onda itava
egzistencija postaje tamna. Onda je sve pogreno, i oko sebe moete stvoriti pakao. Ako je
sve pogreno, kako moete biti sreni? A to je vaa kreacija, i moete uvek nai neto
pogreno, jer ivot se sastoji od dualnosti.
U ruinom bunu ima lepih cvetova, ali i trnja takoe. ovek kutarke e uvek ceniti
trnje, a onda e doi do saznanja da ta rua mora biti obmana; ona ne moe postojati.
Opkoljena s toliko mnogo trnja, milionima trnja, kako moe rua postojati? To je nemogue,
porie se suta mogunost. Neko obmanjuje.
Mula Nasrudin je bio vrlo, vrlo tuan. Otiao je kod svetenika i rekao "ta da radim?
Moja etva je opet unitena. Nema kie." Svetenik je odgovorio, "Ne budi tako tuan
Nasrudine. Gledaj svetliju stranu ivota. Moe biti srean jer jo ima mnogo. Uvek veruj u
Boga koji sve zbrinjava. On hrani ak i ptice u vazduhu, stoga zato si zabrinut?" Nasrudin je
rekao, "Da!" vrlo gorko, "Mojim itom! Bog hrani ptice mojim itom."
On ne moe da vidi poentu. Njegova etva je unitena od tih ptica, a Bog ih hrani "a
moja etva je unitena." Ova vrsta uma e uvek nai neto i uvek e biti napeta. Nespokojstvo
e ga uvek slediti kao senka. Ovo Patanjali zove kutarka - negativna logika, negativno
razmiljanje.
Onda postoji tarka - jednostavno rasuivanje. Jednostavno rasuivanje ne vodi nigde.
To je kretanje u krugu jer nema cilja. Moete stalno da razmiljate i razmiljate i razmiljate,
ali neete doi do nikakvog zakljuka jer rasuivanje moe doi do zakljuka samo kada od
samog poetka postoji cilj. Vi se kreete u odreenom pravcu, onda stiete negde. Ako se
kreete u svim pravcima - ponekad prema jugu, ponekad prema istoku, ponekad prema
zapadu - gubite energiju.
Razmiljanje bez cilja se naziva tarka; razmiljanje sa negativnim stavom se naziva
kutarka; razmiljanje sa pozitivnom osnovom se naziva vitarka. Vitarka oznaava pozitivno
usmereno rasuivanje. Dakle, vitarka je prvi elemenat sampranata samadhija. ovek koji
eli da dopre do unutarnjeg mira mora da bude treniran u vitarki - pozitivno usmerenom
119
rasuivanju. On uvek gleda svetliju stranu, pozitivnu. On ceni cvetove, a zaboravlja trnje -
trnje postoji, ali on se ne bavi njime. Ako volite cvee i cenite cvee, dolazi trenutak kada ne
moete verovati u trnje, jer kako je to mogue kada postoje tako lepi cvetovi, kako trnje moe
postojati? Neto mora biti varljivo.
ovek kutarke ceni trnje; onda cvetovi postaju varljivi. ovek vitarke ceni cvetove;
onda trnje postaje iluzorno. Zbog toga Patanjali kae: vitarka je prvi elemenat. Samo onda je
mogue blaenstvo. Kroz vitarku ovek dospeva u boansko. ovek svuda oko sebe kreira
svoj vlastiti raj.
O vaem gleditu se radi. ta god da naete oko sebe jeste vaa sopstvena tvorevina -
nebo ili pakao. A Patanjali kae da moete ii izvan logike i umovanja samo kroz pozitivno
miljenje. Kroz negativno nikada ne moete otii izvan, jer to vie govorite ne, vie nalazite
stvari da bi se iskazalo - ne, poricanje. Onda, uskoro, unutra postajete konstantno negativni -
mrana no, samo trnje i nikakvi cvetovi u vama ne mogu procvetati - pustinja
Kada govorite 'da', nalazite sve vie i vie stvari za koje biste rekli 'da'. Kada govorite
'da', postajete zagovornik 'da'. ivot je potvren, a vi apsorbujete kroz svoje 'da' sve to je
dobro, lepo, sve to je istinito. 'Da' postaje kapija u vama za ulazak boanskog; 'ne' postaje
zatvorena kapija. Ako je zatvorena kapija, vi ste pakao; a otvorena vrata, sve kapije otvorene,
egzistencija cveta u vama. Vi ste svei, mladi, ivahni; vi postajete cvet.
Vitarka, viara, ananda: Patanjali kae ako ste usklaeni sa vitarkom - pozitivnim
rasuivanjem - onda moete biti mislilac, nikada pre toga. Onda razmiljanje nastaje. On ima
sasvim razliito znaenje za miljenje. Vi takoe mislite da mislite. Patanjali se nee sloiti.
On kae da vi imate misli, ali ne razmiljanje. Zbog toga kaem da je njega teko prevoditi.
On kae da vi imate misli, lutajue misli sline gomili, ali ne razmiljanje. Izmeu vas
i misli ne postoji unutranji tok. One su bez korena u vama; ne postoji unutarnja organizacija.
Vae miljenje je haos, nije kosmos, ono nema unutarnju disciplinu. To je upravo kao to
vidite brojanice. Postoje zrna; njih zajedno dri nevidljivi konac koji ide kroz njih. Misli su
zrna; miljenje je konac. Vi imate zrnca - previe, zapravo vie nego to vam treba - ali ne
postoji unutranji spoj konca kroz njih. Taj unutranji konac, spoj, Patanjali je nazvao
miljenjem - viara. Vi imate misli, ali ne miljenje. Ako se to nastavi dalje i dalje, vi ete
postati ludi. Lud ovek je onaj koji ima milione misli, a nema miljenje, a sampranata
samadhi je stanje u kome nema misli, ali je miljenje savreno. Ovu razliku treba razumeti.
Vae misli, pre svega, nisu vae. Vi ste ih sakupili. Kao kada u mranoj sobi ponekad
zrak svetla prodre kroz tavanicu vi ugledate milione estica praine kako plove u zraku. Kada
pogledam u vas, vidim istu pojavu: milione estica praine. Vi ih nazivate mislima. One se
kreu u vama i van vas. Iz jedne glave one ulaze u drugu, a onda idu dalje. One imaju svoj
vlastiti ivot.
Misao je stvar; ima svoju vlastitu egzistenciju. Kada osoba umre, sve njene lude misli
odmah se oslobode i zaponu da trae okrilje negde drugde. Odmah ulaze u one koji su okolo.
One su kao mikrobi, imaju svoj vlastiti ivot. ak i kada ste ivi, stalno izbacujete svoje misli
svuda oko sebe. Kada razgovarate, onda naravno, ubacujete svoje misli u druge ljude. Ali i
kada ste tihi, i onda takoe izbacujete svoje misli svuda okolo. Prva stvar je da one nisu vae.
ovek sa pozitivnim miljenjem napustie sve misli koje nisu njegove sopstvene. One
nisu autentine; on ih nije naao kroz svoje vlastito iskustvo. On ih je akumulirao od drugih;
pozajmio. One su neiste. Bile su u mnogim rukama i glavama. ovek koji misli nee
pozajmljivati. On e eleti da ima svoje vlastite nove snane misli. Ako ste pozitivni i ako
pazite na lepotu, na istinu, na cvee, ako postanete sposobni da vidite u najtamnijoj noi da se
jutro pribliava, postaete sposobni za razmiljanje.
Onda moete stvoriti svoje vlastite misli. Misao koju ste vi stvorili zaista je potencijal;
ona ima svoju vlastitu snagu. One misli koje pozajmite gotovo su mrtve jer su one putovale -
putovale milionima godina. Njihovo ishodite je izgubljeno; izgubile su svaki kontakt sa
svojim izvorom. One su kao praina koja lebdi okolo. Moete ih uhvatiti. Ponekada ih ak
postanete svesni, ali zato to je vaa svest takva da ne moe videti kroz stvari
Ponekad, vi sedite. Iznenada postanete tuni bez ikakvog razloga. Ne moete nai
razlog. Gledate okolo; nema niega, nita se nije dogodilo. Vi ste isti, a iznenada tuga nastupi.
120
Misao je prolazila; vi ste joj se nali na putu. To je jedna sluajnost. Misao je prolazila kao
oblak - turobna, od nekoga otputena misao. To je neka nesrea. Vi ste je uhvatili. Ponekad
misao uporno ostaje. Ne znate zato nastavljate da mislite o tome. Ona izgleda apsurdna;
izgleda da je neupotrebljiva. Ali ne moete uiniti nita. Ona nastavlja da kuca na kapiju.
Kae: "Misli me". Misao eka na vratima kucajui. Ona kae: "Daj mi prostor. Ja bih elela
da uem unutra."
Svaka misao ima svoj vlastiti ivot. Ona se kree. I ima mnogo snage, a vi ste tako
nemoni jer ste tako nesvesni, tako da ste pokretani mislima. itav va ivot se sastoji od
takvih sluajeva. Sretnete ljude i itav va ivotni obrazac se menja. Ponekad ue u vas. Onda
postanete zaposednuti, i zaboravite gde ste poli. Menjate svoj smer; sledite neku misao. A to
je samo jedna sluajnost. Vi ste kao deca.
36
Patanjali kae da to nije razmiljanje. To je stanje odsustva miljenja; to nije
miljenje. Vi ste gomila, mnotvo. Nemate centar u sebi koji moe misliti. Kada se ovek
kree u disciplini vitarke, ispravnog rasuivanja, onda postaje ubrzo sposoban za razmiljanje.
Miljenje je sposobnost; misli nisu. Misli mogu biti nauene od drugih; razmiljanje nikada.
Razmiljanje treba da nauite sami.
Ovo je razlika izmeu starih indijskih kola za uenje i modernih univerziteta: na
modernim univerzitetima vi dobijate misli; a u drevnim kolama za uenje, kolama mudrosti,
oni su uili razmiljanje, ne misli.
Razmiljanje je kvalitet vaeg unutarnjeg bia. ta razmiljanje znai? To znai da
zadrite svoju svesnost, da ostanete budni i svesni, da se suoite s problemom. Problem je
prisutan; vi istupate pred njega sa svojom totalnom svesnou. Onda se javlja reenje -
odgovor. To je razmiljanje. Pitanje je postavljeno; vi imate spreman odgovor. Pre nego to
ste i razmiljali o tome, odgovor dolazi. Neko pita: "Ima li Boga?" A ak i pre nego to je on
to izgovorio vi kaete, "Da." Vi klimnete svojom drvenom glavom; kaete: "Da, postoji."
Da li je to vaa misao? Jeste li istinski mislili o problemu sada, ili nosite gotov
odgovor u svom pamenju? Neko vam ga je dao - vai roditelji, vai uitelji, vae drutvo.
Neko vam ga je dao, i nosite ga kao dragoceno blago, a ovaj odgovor je doao iz tog
pamenja.
ovek miljenja koristi svoju svest svaki put kada ima problem. Uvek iznova, on
koristi svoju svest. Susree se s problemom, a onda se u njemu javlja misao koja nije deo
pamenja. Ovo je razlika. ovek misli je ovek seanja ili pamenja; on nema sposobnost
razmiljanja. Ako mu postavite novo pitanje, on e biti izgubljen. Ne moe da odgovori. Ako
mu postavite pitanje na koje zna odgovor, odmah e odgovoriti. Ovo je razlika izmeu
pundita
37
i oveka koji zna; oveka koji moe da razmilja.
Patanjali kae da vitarka - ispravno rasuivanje, vodi do razmiljanja - viara.
Razmiljanje - viara, vodi do blaenstva. Ovo je odsjaj, naravno, i to je letimino
sagledavanje. To e proi i bie izgubljeno. Ne moete to zadrati za dugo. To je bio samo
odsjaj, kao to se za trenutak pojavi munja i vidite da je sva tama iezla. Ali tama je opet
prisutna - kao da su nestali oblaci i vi ste za sekundu ugledali mesec - pa su opet oblaci tu.
Ili, u sunanom jutru, pokraj Himalaja, za trenutak moete letimino ugledati
Gourishankar - najvii vrh. Onda naie izmaglica, zatim oblaci, i vrh se izgubi. To je satori.
Stoga nikada ne pokuavajte da prevedete satori kao samadhi. Satori je samo letimian
pogled. Mnogo ima da se radi nakon to se on postigne. Zapravo, pravi rad zapoinje posle
prvog satorija, prvog kratkog uvida, jer ste okusili beskonano. Sada pravo istinsko traganje
zapoinje. Pre toga, bilo je i ovako i onako, bez poleta, jer niste bili stvarno samouvereni,
36
Na viim frekvencijama bia, na astralnoj i mentalnoj razini, misli postoje kao svi drugi energetski entiteti.
Oni se formiraju spontano ili namerno, usmerenim ulaganjem imaginacije i mentalne energije magiara.
Magiari najvie koriste injenicu da su misli energetski entiteti koji se kreu prostorom - tako to ih stvaraju u
razne svrhe. Ti entiteti obuzimaju ljude, i samo zato to nisu svesni prirode misli, oni ih prihvataju kao svoje
misli, zato i veruju u njih, sluaju ih i sprovode u dela ak i ako su to najlui zloini. Dokaz da misli nisu nae je
i taj da imamo misli i na javi i u snu, sa vrlo malo razlike po uinku, uticaju i doslednosti. Takoe je dokaz i to
da ih najvie imamo kada smo najpasivniji - tada se od apstraktnih ideja i pojmova pretvaraju u ive fantazije i
snove, koji nisu nita drugo do trodimenzionalne misli.
37
Bramanski uenjaci i svetenici u Indiji koji su napamet nauili svete spise i rukovode obredima.
121
sigurni, ta radite, kuda idete, ta se deava.
Pre toga, to je bila vera, poverenje. Pre toga uitelj je bio potreban da vam pokae, da
vas opet i opet vraa natrag. Ali nakon to se satori dogodio, sada to vie nije vera. To je
postalo saznanje, hotimino. Sada vera nije neki napor. Sada verujete jer vam je vae vlastito
iskustvo pokazalo. Posle prvog letiminog sagledavanja pravo traganje zapoinje. Pre ste
samo ili okolo i okolo. Pravilno rasuivanje vodi do ispravnog razmiljanja, pravilno
razmiljanje vodi do stanja blaenstva, a ovo stanje blaenstva vodi do opaanja i
razumevanja istog bivanja.
Negativan um je uvek egoista. To je neisto stanje bivanja. Vi oseate ja, ali oseate
ja radi pogrenih razloga. Samo posmatrajte. Ego se hrani ili napaja na ne. Kad god kaete
ne, ego se pojavljuje. Kad god kaete 'da', ego ne moe da se javi jer egu treba borba, egu
treba izazov, egu treba da stavi sebe protiv nekoga, neega. On ne moe da postoji sam,
njemu je neophodna dualnost. Egoista je uvek u potrazi za borbom - sa nekim, sa neim, sa
nekom situacijom. On uvek pokuava da nae neto da kae ne - da bi nadvladao, da bude
pobedonosan.
Ego je nasilan, a ne je najlukavije nasilje. Kada kaete ne za obine stvari, ak i
tamo se ego javlja. Malo dete kae majci: "Mogu li ii van da se igram?" a ona odgovara
"Ne". Nita vano tu nije ukljueno, meutim kada majka kae "ne!" ona osea da je neko.
Kada odete na elezniku stanicu i zatraite kartu, a slubenik vas jednostavno i ne pogleda.
On se pravi da radi ak i ako nema posla. Time on govori: "Ne! ekaj!" On osea da je neko,
vana linost. Zbog toga, svuda na alterima uete ne. Da je retko, vrlo retko. Jedan
obian slubenik moe rei ne svakome, ko god da ste vi. On se osea uticajnim.
Ne vam daje oseaj snage - zapamtite to. Ako nije apsolutno nuno, nikada nemojte
rei ne. ak i ako je bezuslovno potrebno, kaite to na takav afirmativan nain da se ego ne
pojavi. Moete tako rei. ak i ne moe da se kae na takav nain da izgleda kao da.
Moete rei da na takav nain da izgleda kao ne. To zavisi od tona; zavisi od dranja; to
zavisi od gestikulisanja.
Zapamtite ovo: za traganje treba uvek da se seate da konstantno ivite sa aromom
da. To je ono to ini oveka od vere: on kae da. ak i kada je ne potrebno, on kae
da. On ne vidi da postoji bilo kakav antagonizam u ivotu. On potvruje. On govori da
svom telu, on kae da svom umu, on kazuje da svakome; on govori da celoj egzistenciji.
Maksimalni procvat se deava kada bezuslovno kaete odluno da. Iznenada ego pada; on
ne moe opstati. Njemu treba dra ne. Negativno stanovite kreira ego. Ako je dranje
pozitivno - ego otpada, a onda je bivanje isto.
Sanskrit ima dve rei za ja - ahamkara i asmita. Teko je to prevesti. Ahamkara
38
je
pogrean oseaj o ja koji dolazi iz izgovaranja ne. Asmita je ispravan smisao ja koji
dolazi iz izgovaranja da. Oboje su "ja". Jedno je neisto: ne je neistoa. Vi negirate,
unitavate. Ne je destruktivno, vrlo suptilna destrukcija. Nikada ga ne koristite. Izostavljajte
ga koliko je god mogue. Kad god ste budni, ne koristite ga. Pokuajte da naete zaobilazan
put. ak i kad morate da ga izgovorite, kaite na takav nain da ima izgled da. Uskoro ete
postati prilagoeni, usklaeni, i osetiete istotu kako vam dolazi kroz da.
Onda asmita; asmita je bezlini ego. Nema oseanja ja ni prema kome. Samo oseate
sebe bez postavljanja protiv ikoga. Samo oseate svoju totalnu samou, a totalna samoa je
najistije od svih stanja. Kada kaemo Ja jesam - ovo ja je ahamkara; a jesam je asmita,
samo oseanje jesam-stva bez ja u njemu, samo oseanje postojanja, biti u 'da' je lepo, 'ne' je
runo.
U asampranata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
neispoljene utiske.
Sampranata samadhi je prvi korak. Ispravno miljenje, ispravno razumevanje, stanje
blaenstva, odsjaj blaenstva, letimino sagledavanje, i oseanje jesam-stva - isto
38
Aham znai ja sam a kara znai inilac, to zajedno daje ja sam inilac, iluziju da smo posebne individue
koje neto ine svojom voljom. To je osnova ega.
122
jednostavno postojanje bez ikakvog ega u sebi - ovo vodi do asampranata samadhija. Prvi je
istota; drugi je gaenje, nestanak, jer ak i najistije je neisto poto je tu. 'Ja' je pogreno,
'jesam' je takoe pogreno - bolje je nego 'ja', ali vea je mogunost prisutna kada takoe
nestane i 'jesam' - ne samo ahamkara, ve i asmita. Vi ste neisti, onda postajete isti. Ali ako
zaponete oseati "ja sam ist", sama istoa postaje neistoa. To takoe mora da nestane.
Nestanak neistoe je sampranata. Nestanak istoe takoe, jeste asampranata.
Tada prestaju sve mentalne aktivnosti. Misli iezavaju u prvom stanju. U drugom stanju
takoe iezava razmiljanje. Trnje iezava u prvom stanju. U drugom stanju, cvetovi takoe
iezavaju. Kada 'ne' iezne u prvom stanju, ostaje 'da'. U drugom stanju 'da' takoe iezava
jer 'da' je takoe povezano sa 'ne'. Kako moete zadrati 'da' bez 'ne'? Oni su zajedno; ne
moete ih odvojiti. Ako 'ne' iezne, kako moete rei 'da'? Duboko ispod 'da' kazuje 'ne' za
'ne'. Negacija negacije - ali suptilno 'ne' postoji. Kada kaete 'da', ta radite? Vi niste rekli 'ne',
ali 'ne' je unutra. Vi ga ne iznosite napolje; ono je neispoljeno.
Vae 'da' ne moe znaiti nita ako nemate 'ne' unutar sebe. ta e to znaiti? To e
biti bez znaenja. 'Da' ima znaenje samo zbog 'ne'; 'ne' ima znaenje samo radi 'da'. Oni su
dualitet. U sampranata samadhiju, 'ne' je odbaeno: sve to je pogreno jeste odbaeno. U
asampranata samadhiju, 'da' je odbaeno. Sve to je ispravno, sve to je dobro, to je takoe
odbaeno. U sampranata samadhiju vi odbacujete avola; u asampranata samadhiju vi
ostavljate Boga takoe, jer kako Bog moe postojati bez avola? Oni su dve strane istog
novia.
Sve aktivnosti prestaju. 'Da' je takoe jedna aktivnost, a aktivnost je naprezanje. Neto
se odvija, ak i lepo, ali se jo neto deava. Posle izvesnog vremena ak i lepo postaje
odvratno. Posle odreenog razdoblja vama je takoe dosadno ak i sa cveem. Posle nekog
vremena, aktivnost, ak i vrlo suptilna i ista, stvara vam naprezanje: ona postaje neko
nespokojstvo, nemir.
U asampranata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
neispoljene utiske.
Ali ipak, to nije ostvaren cilj - jer ta e se dogoditi svim vaim utiscima koje ste
sakupili u prolosti? Mnogo, mnogo ivota ste iveli, delovali, reagovali. Uinili ste mnoge
stvari koje nije trebalo, a niste uinili mnoge stvari koje ste trebali. ta e se dogoditi s tim?
Svesni um je postao ist; svesni um je odbacio ak i aktivnost za istotom. Meutim,
nesvesno je neizmerno, a tamo vi nosite svo seme, obrasce. Oni su unutar vas.
Drvo je iezlo; vi ste sasvim isekli drvo. Ali semenke koje su pale, one lee u zemlji.
One e klijati kada njihova sezona nastupi. Vi ete imati drugi ivot, biete opet roeni.
Naravno, va kvalitet e sada biti drugaiji. Ali ete biti ponovo roeni jer ove semenke jo
nisu spaljene.
Odsekli ste ono to se ispoljavalo. Lako je odsei sve to se ispoljava; lako je posei
svo drvee. Moete ui u batu i poupati celu livadu, svu travu; moete ubiti sve. Meutim
za dve sedmice trava e porasti ponovo, jer ono to ste uinili odnosi se samo na ispoljeno.
Seme koje lei u zemlji jo niste ni dotakli. To treba da se uradi u treem stadijumu.
Asampranata samadhi je jo sabia - sa semenom. Postoje metode kako da se spali
ovo seme, kako da se stvori plamena vatra o kojoj je Heraklit govorio, kako da se stvori ova
vatra i spri nesvesno seme. Kada i ono nestane, onda je tlo apsolutno isto; nita se ne moe
pojaviti iz njega. Onda nema raanja, nema umiranja. Onda se ceo toak zaustavlja za vas, vi
ste ispali iz kruenja. Ispadanje iz drutva nee vam pomoi dok ne ispadnete iz kruenja
ivota i smrti. Onda savreno ispadate.
Buda je savreno ispao, Mahavira, Patanjali savreno su otpali. Oni nisu ispali iz
drutvene zajednice. Oni su ispali iz samog kruenja ivota i smrti. Ali to se deava samo
kada je svo seme spreno. Konani je nirbia samadhi - bez semena.
U asampranata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
neispoljene utiske.
123
Videhe i prakrti-laye postiu asampranata samadhi jer su prestali da identifikuju
sebe sa svojim telima u svojim prethodnim ivotima. Oni se ponovo raaju zato to je ostalo
seme elje.
ak i Buda je roen. U njegovom prolom ivotu on je dostigao asampranata
samadhi, ali seme je bilo tu prisutno. On je morao da doe jo jednom. ak i Mahavira je
roen - jo jednom - seme donosi i njega. Ali ovo e biti poslednji ivot. Posle asampranata
samadhija, samo jedan ivot je mogu. Ali onda e kvalitet tog ivota biti sasvim razliit, jer
taj ovek nee biti identifikovan sa telom. I taj ovek zaista nema nita da ini, jer aktivnost
uma je prestala. ta e on onda initi? Za ta je taj jedan ivot potreban? Samo da dozvoli
ovom semenu da se ispolji, a on da ostane svedok. To je ta vatra.
Jedan ovek je doao i pljunuo Budu; bio je ljut. Buda je obrisao svoje lice i pitao:
"ta jo ima da kae?" ovek nije mogao da razume. Bio je zaista ljut, usijan. Nije mogao
ni da razume ta je Buda govorio. Cela stvar je bila tako apsurdna, jer Buda nije reagovao.
ovek je bio izgubljen ne znajui ta da ini, ta da kae. Udaljio se; cele noi nije mogao da
spava. Kako moete spavati kada uvredite nekoga, a nema reakcije? Onda se vaa uvreda
vraa natrag vama. Vi ste bacili strelu, ona nije bila primljena. Ona se vraa natrag, vraa se
natrag izvoru ne nalazei utoite. On je uvredio Budu, ali uvreda nije mogla nai utoite
tamo. Dakle, gde e otii? Dolazi izvornom tvorcu.
Cele noi je bio u groznici, nije mogao verovati ta se dogodilo. Onda je poeo da se
kaje, da je pogreio - da nije uradio dobro. Sledeeg jutra, rano je otiao kod Bude i zamolio
ga za oprotaj. Buda je rekao: "Ne brini zbog toga. Mora da sam ti uradio neto pogreno u
prolosti. Sada je raun namiren. I ja neu reagovati. Inae opet i opet Zavreno je! Ja
nisam reagovao. Zato to je postojalo neko seme negde, to je moralo da se okona. Sada je
moj raun s vama namiren."
U ovom ivotu kada videha - ovek koji je shvatio da on nije telo, koji je dostigao
asampranata samadhi - dolazi u svet upravo da okona raune Ceo njegov ivot se
sastoji od okonavanja rauna; milioni ivota, mnogi uzajamni odnosi, mnoga uplitanja,
mnoga dela - sve mora da bude zatvoreno, poravnato.
Desilo se da je Buda doao u selo. Okupilo se itavo selo; eljni su bili da ga uju.
Bila je to retka prilika. ak i glavni gradovi su pozivali neprekidno Budu, a on nije dolazio. A
doao je u ovo malo selo izvan puta - bez ikakvog poziva, jer metani nikada nisu mogli
skupiti hrabrost da ga pitaju da doe u njihovo selo - samo malo selo, nekoliko koliba, i on je
doao bez poziva. Celo selo plamti od uzbuenja, a on sedi ispod drveta i ne govori.
Oni rekoe: "Koga ekate sada? Svi su ovde; celo selo je ovde. Zaponite." Buda je
rekao: "Ali moram ekati jer sam doao radi neke osobe koja nije ovde. Obeanje treba
ispuniti, raun se mora namiriti. ekam nju." Onda je dola devojka, i Buda je zapoeo. Onda,
nakon to je govorio, oni su pitali: "Jeste li ekali ovu devojku?"
Budui da je devojka pripadala nedodirljivima - najnioj kasti, niko nije ni pomislio da
je Buda ekao nju. On je rekao: "Da, ekao sam nju. Kada sam dolazio srela me je na putu i
rekla: ekaj me, jer ja idem radi nekog posla u drugi grad. Ali brzo u se vratiti. U prolim
ivotima negde sam joj obeao da u, kada postanem prosvetljen, doi i ispriati joj ta mi se
dogodilo. Taj raun je morao da se podmiri. To obeanje je visilo iznad mene, a da ga nisam
ispunio, morao bih ponovo da doem."
Videha ili prakrti-laya; obe rei su lepe. Videha znai bestelesan. Kada dostignete
asampranata samadhi telo je prisutno, ali vi postajete bestelesni. Vi vie niste telo. Telo
postaje prebivalite, vi niste identifikovani.
Dakle, ova dva izraza su lepa. Videha oznaava onoga koji zna da on nije telo - zna,
pamti - ne samo da veruje. I prakrti-laya, zato to onaj ko zna da nije telo, on nije vie ni
prakrti - priroda.
Telo pripada materijalnom. Jednom kada niste identifikovani sa materijom u vama, vi
niste identifikovani sa materijom izvan, spolja. ovek koji dostigne to, vie nije telo, poto
nije vie ispoljen - prakrti - njegova priroda se istopila. Nema vie sveta za njega; on nije
124
identifikovan. On je postao svedok sveta. Takav ovek se takoe raa jo samo jednom, jer je
morao da izravna mnoge raune; mnoga obeanja da budu ispunjena, mnoge karme da budu
otputene.
Dogodilo se da je Budin roak Devadata bio protiv njega. Pokuavao je da ga ubije na
mnogo naina. Kada je Buda sedeo ispod drveta meditirajui, on je gurnuo na njega veliku
stenu s brda. Dok je stena nailazila, svi su pobegli. Buda je ostao da sedi ispod drveta. Bilo je
opasno, stena ga je samo dotakla, oeavi se o njega. Ananda ga je pitao, "Zato niste pobegli
kada smo se mi razbeali? Bilo je dovoljno vremena."
Buda je rekao: "Za vas ima dovoljno vremena. Moje vreme je isteklo. A Devadata je
morao to da uradi. Nekada u prolosti u nekom ivotu postojala je neka karma. Mora da sam
mu naneo neku bol, neku muku, neku brigu. To je moralo da se zakljui. Ako bih pobegao,
ako bih uinio neto, opet bi nov put zapoeo."
Videha, ovek koji je postigao asampranata, ne reaguje. On jednostavno posmatra,
svedoi. I to je vatra svedoenja koja pali svo seme u nesvesnom. Dolazi trenutak kada je tlo
apsolutno isto. Ne postoji seme koje eka da proklija. Onda ne postoji potreba da se vraa
natrag. Prvo se priroda rastvara, a onda on rastvara sebe u univerzumu.
Videhe i prakrti-laye postiu asampranata samadhi jer su prestali da identifikuju
sebe sa svojim telima u svojim prethodnim ivotima. Oni se ponovo raaju zato to je ostalo
seme elje.
Ja sam ovde da ispunim neto, vi ste ovde da zatvorite, da okonate moj raun. Vi
niste ovde sluajno. Postoje milioni ljudi u svetu. Zato ste vi ovde, a ne neko drugi? Neto
mora da bude zatvoreno.
Drugi koji su dostigli asampranata samadhi, to postiu kroz veru, trud, seanje,
usredsreenost i razlikovanje.
Dakle, postoje dve mogunosti. Ako ste postigli asampranata samadhi u vaem
prolom ivotu, u ovom ivotu vi ste roeni Buda - samo je nekoliko semenki koje treba da
budu ispunjene, koje treba da budu ostavljene, spaljene uglavnom. Zbog toga ja kaem da ste
vi roeni gotovo kao Buda. Nije vam potrebno nita da inite, jednostavno morate posmatrati
sve to se dogaa.
Otuda Krinamurtijevo neprekidno insistiranje da nije potrebno da se ini nita. Za
njega je to ispravno; ali to nije ispravno za njegove sluaoce. Njegovi sluaoci treba mnogo da
urade, i oni e biti zavedeni ovom tvrdnjom. On govori o sebi. On je roen kao asampranata
Buda. Roen je kao videha; roeni je prakrti-laya.
Kupao se kada je imao samo pet godina pokraj Adyara, i jedan od najveih teozofa,
Lidbiter, ga je zapazio. Bio je sasvim drugaiji tip deteta. Ako bi neko bacio blato na njega,
on ne bi reagovao. Mnoga deca su se igrala. Ako bi ga neko gurnuo u reku, on se jednostavno
nije opirao. Da, nije se ljutio, nije se borio. Bio je sasvim razliitog kvaliteta - kvaliteta jednog
asampranata Bude.
Lidbiter je pozvao Eni Besant da posmatra to dete. On nije bio obino dete i itav
teozofski pokret se vrteo oko njega. Oni su se veoma nadali da e postati jedan avatar - da e
postati savreni majstor za ovo doba. Ali problem je bio dubok. Izabrali su pravu osobu, ali
nade su im bile pogrene - jer ovek koji je roen asampranata Buda ne moe biti aktivan
ak ni kao avatar. Jer sva aktivnost je prestala. On moe jednostavno posmatrati; moe biti
svedok. Ne moete ga uiniti mnogo aktivnim. On moe biti samo pasivan. Izabrali su pravu
osobu, ali i pored toga su pogreili.
Mnogo su se nadali. Onda se ceo pokret okretao oko Krinamurtija. Onda ga je on
napustio, rekavi: "Ne mogu initi nita jer nita nije potrebno," ceo pokret je pretrpeo potpun
neuspeh jer su se previe nadali u tog oveka, tada se cela stvar potpuno preokrenula. Ali to se
moglo predvideti.
Eni Besant, Lidbiter i drugi, bili su vrlo, vrlo fine osobe, ali zaista nisu bili svesni
125
istonih metoda. Mnogo su uili iz knjiga, spisa, ali nisu znali tano tajnu koju je Patanjali
pokazao: kada se jedan asamprana, videha, rodi, on nije aktivan. On je pasivan. Mnogo se
moe dogoditi kroz njega, ali se to moe samo dogoditi ako neko doe i preda se njemu. Zato
to je pasivan, ne moe vas prinuditi da uinite neto. On je dostupan, ali ne moe biti
agresivan. Njegov poziv je za svakoga i za sve. To je jedan otvoreni poziv, ali vam ne moe
poslati poziv pojedinano, jer ne moe biti aktivan. On je jedna otvorena kapija; ako elite, vi
moete proi. Poslednji ivot je apsolutna pasivnost, samo svedoenje. To je jedini razlog
zbog koga su asamprana Bude roene iz svog prolog ivota.
Meutim, moete postati asampranata Buda u ovom ivotu takoe. Za njih
Patanjali kae:
raddha virya smriti samadhi prajna: Drugi koji su dostigli asampranata samadhi,
to postiu kroz veru, trud, seanje, usredsreenost i razlikovanje.
Gotovo je nemogue prevesti ovo, stoga u vam radije objasniti nego prevoditi, samo
u vam dati oseaj, jer rei e vas dovesti u zabludu.
raddha nije sasvim isto to i vera. To je vie kao poverenje. Poverenje je vrlo, vrlo
razliito od vere. Vera je neto u emu ste roeni; a poverenje je neto u emu rastete.
Hinduizam je vera; biti hrianin; biti musliman jeste vera. Ali biti uenik ovde kod mene
jeste poverenje. Ja ne mogu zahtevati veru - zapamtite. Isus takoe nije zahtevao veru, jer
vera je neto u emu ste roeni. Jevreji su vernici; oni imaju veru. Zapravo, zbog toga su oni
unitili Isusa jer su mislili da ih on odvodi van njihove vere, da unitava njihovu veru.
On je traio poverenje. Poverenje je lina intimnost; to nije drutveni fenomen. Vi ga
dostiete kroz svoj vlastiti odgovor. Niko ne moe biti roen sa poverenjem; u veri svakako
da. Vera je mrtvo poverenje; poverenje je iva vera. Stoga pokuajte da razumete razliku.
raddha - poverenje - ovek mora da izraste u njemu. A to je uvek lino. Prvi uenici
Isusa su postigli poverenje. Oni su bili Jevreji, roeni Jevreji. Oni su izali iz svoje vere. To je
pobuna. Vera je praznoverje; poverenje je pobuna. Poverenje vas prvo udaljava od vae vere.
To mora biti tako, jer ako ivite usred groblja, onda morate prvo biti izvedeni iz njega. Samo
onda moete biti opet uvedeni u ivot. Isus je pokuao da vodi ljude prema radhi, prema
poverenju. To je uvek izgledalo kao unitavanje njihove vere.
Sada kada hriani dou kod mene, ista situacija se opet ponavlja. Hrianstvo je vera,
isto kao to je judaizam bio vera u Isusovo vreme. Kada hrianin doe kod mene, opet ja
moram da ga izvedem iz njegove vlastite vere i da mu pomognem da raste prema poverenju.
Religije su vere, a biti religiozan znai biti u poverenju. Biti religiozan ne znai da se bude
hrianin, hindus ili musliman jer poverenje nema ime; ono nije imenovano. To je kao ljubav.
Da li je ljubav hrianska, hindu ili muslimanska? Brak je hrianski, hindu, muslimanski. A
ljubav? Ljubav ne zna za kaste, ne zna za razlike. Ljubav ne zna hinduse, ne zna hriane.
Brak je kao vera; ljubav je kao poverenje. Morate da izrastete u njemu. To je jedna
avantura. Vera nije avantura. Vi ste roeni u tome; sa time ste saobraeni. To je bolje ako
traite utehu i udobnost; bolje je ostati u veri. Budite hindus, budite hrianin; sledite pravila.
Ali to e ostati mrtva stvar sve dok se ne odazovete svome srcu, dok ne uete u religiju na
svoju vlastitu odgovornost; ne zato to ste roeni kao hrianin. Kako se uopte moete roditi
kao hrianin?
Kako je sa roenjem spojena religija? Roenje vam ne moe dati religiju; to vam samo
moe dati drutvo, veroispovest, sekta; to vam moe dati praznoverje. Re "praznoverje"
(superstition) je vrlo, vrlo znaajna. Njeno znaenje je "prazna vera". Prefiks "super" znai
nepotrebno, suvino - vera koja je postala nepotrebna, prazna, vera koja je postala mrtva;
nekada je moda bila iva. Religija mora da bude roena uvek iznova.
Zapamtite, vi niste roeni u religiji, religija mora biti roena u vama. Onda je to
poverenje. Uvek iznova. Ne moete dati svojoj deci vau religiju. Ona e morati da trae i
nau svoju vlastitu. Svako mora da trai i nae svoju vlastitu. To je avantura - najvea
avantura. Vi se kreete u nepoznatom. Patanjali kae raddha je prva stvar, ako elite da
postignete asampranata samadhi. Za sampranata samadhi, razmiljanje je potrebno,
ispravno razumevanje. Vidite li razliku? Za sampranata samadhi, ispravno rasuivanje,
126
ispravno razmiljanje jeste osnova; za asampranata samadhi, pravo poverenje - a ne
rasuivanje.
Nerasuivanje je ljubav. A ljubav je slepa. Izgleda slepa prema rasuivanju, jer ona
skae u tamu. Razum pita: "Gde idete? Ostanite u poznatoj teritoriji. Kakva je korist da se
kreete prema novoj pojavi? Zato ne ostanete u staroj verskoj zajednici? To je prikladno,
udobno i ta god vam treba, to moete dobiti." Ali svako mora nai svoj vlastiti hram. Samo
onda je to ivo.
Vi ste ovde sa mnom. To je poverenje. Kada ja vie nisam ovde, vaa deca mogu biti
sa mnom. To e biti vera. Poverenje se deava samo sa ivim uiteljem; vera sa mrtvim
uiteljima koji vie nije tu. Prvi uenici imaju religiju. Druga, trea generacija ubrzo gubi
religiju, ona postaje sekta, vera. Onda je jednostavno sledite jer ste roeni u njoj. To je
dunost, nije ljubav. To je drutvena institucija. To pomae, ali to nije nita duboko u vama.
To vam ne donosi nita; to nije deavanje; to nije otvaranje dubine u vama. To je samo
povrina, lice. Samo idite i pogledajte u crkvama. Nedeljom ljudi odlaze, ak se i mole. Ali
ekaju kada e se to zavriti.
Mali deak je sedeo u crkvi. Doao je prvi put, ima samo etiri godine. Majka ga je
pitala: "Kako ti se svidelo?" On je odgovorio: "Muzika je dobra, ali reklame su previe duge."
To su reklame kada vi nemate poverenje. raddha je ispravno poverenje; vera je pogreno
poverenje. Ne primajte religiju od nekog drugog. Vi je ne moete pozajmiti; to je obmana.
Dobijate je bez plaanja za nju, a sve treba da se plati. Nije jeftino dospeti do asampranata
samadhija. Morate platiti punu cenu, a puna cena je vae celokupno bie.
Biti hrianin samo je etiketa; biti religiozan nije etiketa. Celo vae bie je ukljueno,
to je obavezivanje. Ljudi mi dou i kau: "Mi vas volimo. ta god vi kaete je dobro. Ali ne
elimo da preuzmemo sannyas jer ne elimo da se obavezujemo." Meutim, dok se ne
obaveete, ukljuite, ne moete da rastete, jer onda ne postoji uzajamni odnos. Izmeu vas i
mene onda ima rei, ali nema povezanosti. Onda ja mogu biti uitelj, ali nisam majstor za vas.
Onda vi moete biti uenik, ali ne i pristalica, sledbenik.
Shradha, poverenje, prva su vrata, a druga su virya. Ovo je takoe teko. Prevedeno
je kao napor. Ne, napor je jednostavno deo toga. Re virya znai mnogo stvari, ali izvorno
ona oznaava bioenergiju. Jedno od znaenja rei virya je sperma, seksualna mo. Ako zaista
elite da je prevedete tano, virya je bioenergija, vaa celovita energetska pojava - vi kao
energija. Naravno, ova energija moe biti pokrenuta kroz trud; otuda, jedno od znaenja je
'napor'.
Inae to je nedovoljno - nije tako bogato kao re virya. Virya znai da vaa itava
energija mora da bude uneta u to. Samo um nee biti dovoljan. Moete iz uma rei da, ali to
nee biti dovoljno. Vaa celokupnost, bez zadravanja iega u pozadini: to je znaenje rei
virya. A to je mogue samo kada postoji poverenje. Inae vi ete se drati neega samo toliko
koliko ste sigurni, bezbedni, jer: "Ovaj ovek moda vodi nekuda pogreno, stoga se moemo
povui svakog trenutka. Svakog trenutka moemo rei: to je dosta, dosta je; ne vie."
Zadravate deo sebe upravo da biste paljivo motrili, gde taj ovek vodi. Ljudi mi
dou i kau: "Mi emo posmatrati. Pustite nas prvo da posmatramo ta se dogaa." Oni su
vrlo bistri - domiljate budale - jer ove stvari ne mogu biti posmatrane spolja. Ono to se
deava unutarnji je fenomen. tavie, vi ne moete ni videti kome se to deava mnogo puta.
Mnogo puta samo ja mogu videti ta se deava. Vi samo docnije postajete svesni, ta se
dogodilo.
Drugi ne mogu posmatrati. Ne postoji mogunost da se to posmatra spolja. Kako
moete posmatrati spolja? Pokrete moe videti; moete videti da ljudi rade meditaciju. Ali
ono to se dogaa iznutra, to je meditacija. Ono to oni rade spolja, samo je stvaranje
situacije.
Dogodilo se: postojao je vrlo veliki sufi majstor, Jalaludin. Imao je malu kolu
izuzetnih sledbenika, neobinih, jer je bio vrlo probirljiv ovek. On ne bi odobrio pristup
nikome dok ne bude izabran. Radio je samo sa malobrojnima, ali ljudi su ponekad dolazili u
prolazu da vide ta se tamo deava. Dola je jedna grupa ljudi, bili su profesori. Oni su uvek
vrlo oprezni ljudi, vrlo lukavi, i posmatrali su. U dvoritu majstorove kue sedela je grupa od
127
pedeset ljudi, izvodei ludake pokrete neki su se smejali, neki su plakali, neki su skakali.
Profesori su posmatrali.
Rekli su: ta se deava? Ovaj ovek ih vodi prema ludosti. Oni su ve ludi, budale -
jer jednom kada poludite bie teko vratiti se natrag. A ovo je besmislica; nikada nismo ovako
neto uli. Kada ljudi meditiraju, oni sede smireno."
Meu njima se vodila velika rasprava. Grupa njih je rekla: "Zato to ne znamo ta se
deava, nije dobro donositi neki sud." Meu njima bila je i trea grupa koji su rekli: "ta god
da je to, vredno je uivanja. Voleli smo ovo da posmatramo. Lepo je. Zato ne bismo uivali u
tome? to bismo se brinuli ta oni rade. Lepa je stvar posmatrati ih."
Onda posle nekoliko meseci, ista grupa je opet dola u kolu da posmatra. ta je tada
dogaalo? Svi su bili smireni. Bilo je tu pedeset osoba, majstor je bio prisutan - sedeli su tiho,
tako smireno, kao da nije bilo nikoga, poput statua. Opet je dolo do rasprave. Bila je grupa
koja je rekla: "Oni su sada beskorisni. ta ima da se vidi? Nita! Kada smo prvi put dolazili
bilo je lepo. Uivali smo u tome. Sada su ba dosadni." Druga grupa je rekla "Mislimo da
sada meditiraju. Prvi put su jednostavno bili ludi. Ovo je prava stvar koju ine; ovako se radi
meditacija. O tome pie u spisima, opisana je na ovaj nain."
Meutim, postojala je jo trea grupa, koja je rekla: "Mi ne znamo nita o meditaciji.
Kako moemo suditi?"
Onda, posle nekoliko meseci grupa je opet dola. Sada nije bilo nikoga. Samo je
uitelj sedeo, smeei se. Svi sledbenici su nestali. Onda su oni pitali: "ta se deava? Kada
smo prvi put doli bila je luda gomila, mislili smo da je to beskorisno; da vi upravljate ludim
ljudima. Sledei put kada smo doli bilo je vrlo dobro. Ljudi su meditirali. Gde su svi otili?"
Majstor je rekao: "Posao je obavljen, sledbenici su nestali. Ja se smeim srean jer se
cela stvar dogodila. A vi ste budale, ja to znam! Ja sam takoe posmatrao - ne samo vi. Znam
koje su se rasprave vodile, i ta ste mislili prvi put i drugi put." Jalaludin je rekao: "Napor koji
ste uloili da doete ovde tri puta dovoljan je za vas da postanete meditanti. A rasprava koju
ste vodili, toliko energije je bilo dovoljno da vas uini smirenim. U istom periodu, ovi
sledbenici su iezli, a vi ste ostali na istom mestu. Uite, ne gledajte spolja" Oni su rekli:
"Da! Zbog toga mi dolazimo iznova, da posmatramo ta se dogaa. Kada smo sigurni, onda
Inae mi ne elimo da se predamo."
Lukavi ljudi nikada ne ele da budu predani, ali ima li ikakvog ivota bez poverenja?
Meutim lukavi ljudi misle da je predanost ropstvo. Ali, da li postoji sloboda bez ropstva?
Prvo morate da se kreete u nekom odnosu, u vezi, samo onda moete otii izvan toga. Prvo
treba da se kreete u dubokom poverenju, od dubine do dubine, od srca do srca, i samo onda
moete to transcendirati. Nema drugog puta. Ako se samo kreete spolja i posmatrate, nikada
neete ui u hram - hram je predavanje. I samo onda moe biti odnosa.
Majstor i sledbenik su u ljubavnom odnosu, u najvioj ljubavi koja je mogua. Dok
takav uzajamni odnos ne postoji, ne moete rasti. Patanjali kae: "Prvo je poverenje -
raddha - drugo je energija - napor." itava vaa energija treba da bude uvedena unutra,
samo njen deo nee delovati. Ako pristupite samo delimino, a drugim delom ostanete van, to
moe biti destruktivno, jer e to postati rascep u vama. To e u vama stvoriti napetost; to e
postati pre uznemirenost nego blaenstvo.
Blaenstvo je gde ste vi u svojoj celokupnosti; uznemirenost je gde ste samo jednim
delom, jer onda ste podeljeni i postoji napetost, jer dva dela idu odvojenim putevima. Tada ste
u tekoama.
Drugi koji su dostigli asampranata samadhi, to postiu kroz veru, trud, seanje,
usredsreenost i razlikovanje.
Ova re priseanje je smrti: to je pamenje - ono to Gurijev zove seanje sebe. To je
smrti. Vi se ne seate sebe. Moete se seati miliona stvari, ali vi stalno zaboravljate sebe, ta
vi jeste. Gurijev je imao tehniku. Dobio ju je od Patanjalija. Zapravo, sve tehnike su dole
od Patanjalija. On je prvi majstor tehnika. Smrti je seanje ili pamenje - svest o sebi pri
svemu to inite. Hodate i seate se u dubini: "Ja hodam, ja jesam." Ne budite izgubljeni u
hodanju. Hodanje postoji - kretanje, aktivnost - i unutarnji centar je tu, samo svestan,
posmatra, svedoi.
128
Nije potrebno to da ponavljate u umu: "Ja hodam." Ako ponavljate, to nije seanje.
Morate biti neverbalno svesni toga: "Ja hodam, ja jedem, ja govorim, ja sluam." ta god da
inite ne treba unutra "Ja" da bude zaboravljeno; ono treba da ostane. To nije samosvest. To je
svest o Sebi. Samosvest je ego, a svest o Sebi je asmita - istota, samo bivanje svesnim da "ja
jesam".
Obino vaa svesnost je usmerena prema predmetu. Vi gledate u mene: itava vaa
svesnost se kree prema meni kao strela. Ali vi ste usmereni samo prema meni. Seanje na
Sebe znai da imate duplo usmerenu strelu: jedna njena strana pokazuje prema meni, druga
strana pokazuje prema vama. Duplo usmerena strela je smrti - seanje Sebe ili svest o Sebi.
To je vrlo teko, jer lako je seati se objekta, a zaboraviti sebe samog. Suprotno je
takoe lako - seati se sebe, a zaboraviti objekat. Oboje su laki; zbog toga oni koji su na
trnici, u svetu, i oni koji su u manastiru, izvan sveta, jesu isti. Oboje su jednousmereni. Na
trgu oni gledaju u stvari, objekte. U manastiru, oni gledaju u sebe.
Smrti nije ni na trgu, ni u manastiru. Smrti je fenomen svesti o sebi kada su oboje, i
subjekat i objekat, zajedno u svesti. To je najtea stvar u svetu. Ako moete dospeti dotle
makar za jedan trenutak, jedan odvojen trenutak, imaete odmah odbljesak satorija. Odmah
ete se premestiti iz tela, negde drugde.
Pokuajte to. Ali zapamtite, ako nemate poverenje to e postati napetost. Mnogi
problemi su tu obuhvaeni. To e postati takva napetost da moete poludeti, jer to je vrlo
napeto stanje. Zbog toga teko je zapamtiti oba - objekat i subjekat, spoljanje i unutarnje. Da
se seamo oba vrlo je, vrlo teko. Ako ima poverenja, to poverenje e smanjiti napetost, jer
poverenje je ljubav. To e vas umiriti; to e biti umirujua sila oko vas. Inae napetost moe
postati tako velika, da ne biste bili sposobni da spavate. Neete moi da budete na miru
nijednog trenutka, jer e to biti konstantan problem. Biete samo neprekidno uznemireni.
Zbog toga moemo uini jedno, to je lako. Otii u manastir, zatvoriti oi, seati se
sebe, zaboraviti svet. Ali ta vi inite? Vi ste jednostavno obrnuli ceo proces, nita drugo.
Nema promene. Ili zaboravite ove manastire, hramove i ove majstore, i budite u svetu,
uivajte u svetu. To je takoe lako. Teka je stvar da se bude svestan oba. Kada ste svesni
oba, i energija je istovremeno svesna, usmerena u dijametralno suprotnim pravcima,
dimenzijama, postoji nadilaenje, transcendencija. Vi jednostavno postajete tree: postajete
svedok oba. A kada tree ue, prvo pokuajte da vidite objekat i sebe samog. Ali ako pokuate
da vidite oboje, ubrzo, uskoro, osetiete da se neto deava u vama - jer postajete tree, vi ste
izmeu dvoje, izmeu objekta i subjekta. Vi sada niste ni objekat ni subjekat.
Postignite to kroz veru, trud, seanje, usredsreenost i razlikovanje.
raddha, poverenje, i virya, apsolutna predanost, celokupna energija treba da budu
uneseni unutra, itav va potencijal treba da bude unet unutra. Ako ste stvarno tragalac za
istinom, vi ne moete traiti nita drugo. To je potpuna angaovanost. Ne moete nainiti to
sporednim poslom tako da: "Ponekad ujutru meditiram, a onda odlazim". Ne, meditacija
mora da vam postane neprekidna dvadeset etiri asa. ta god da radite, meditacija
neprekidno mora da bude prisutna u pozadini. Energija e biti potrebna; itava vaa
energija e biti potrebna.
A sada nekoliko stvari. Ako je potrebna itava vaa energija, seks automatski nestaje
jer nemate energiju za gubljenje. Brahmacharya za Patanjalija nije disciplina, to je
posledica. Vi uloite svoju itavu energiju, stoga nemate nikakvu energiju za seks. To se
deava u obinom ivotu takoe. Moete videti velikog slikara: on potpuno zaboravlja svoju
enu. Kada slika u njegovom umu ne postoji seks, jer se kree itava energija. Nemate
nikakvu suvinu energiju.
Veliki pesnik, veliki peva, veliki plesa koji se kree potpuno u svojoj predanosti,
automatski biva u celibatu. On za to nema disciplinu. Seks je suvina energija, seks je
sigurnosni ventil. Kada ste previe u sebi i ne moete uiniti nita s tim, priroda je nainila
sigurnosni ventil, moete je izbaciti. Moete je otpustiti, inae poludeete ili izgoreti -
eksplodirati. Ako pokuate da je suzbijete, onda ete takoe poludeti, jer potiskivanje nee
pomoi. Potreban je njen preobraaj, a preobraaj dolazi iz totalnog poverenja i predanosti.
Ratnik, ako je zaista ratnik, nepogreiv ratnik, bie iznad seksa. Njegova itava energija se
129
kree u drugom smeru.
Postoji vrlo lepa pria o velikom filozofu, misliocu, njegovo ime je Vaaspati... Toliko
je bio angaovanom u svom izuavanju da, kada ga je njegov otac pitao: "Dakle, ja sam sve
stariji i ne znam kada u umreti - to se moe svakog asa dogoditi - a ti si mi sin jedinac, pa
bih eleo da se oeni". On je bio toliko udubljen u svoje uenje da je samo odgovorio: "U
redu." On nije uo ta je otac rekao. Tako se oenio. Oenio se, ali je potpuno zaboravio da
ima enu, toliko je bio angaovan.
Ovo se moe dogoditi samo u Indiji; ne moe se dogoditi nigde drugde: ena ga je
toliko volela da nije elela da mu smeta. Kae se da je prolo dvanaest godina. Ona ga je
sluila kao senka, starala se na svaki nain, ali mu nije smetala, niti je ikada kazala: "Ja sam
ovde, a ta ti radi?" On je neprekidno pisao komentar - jedan od najveih koji je ikada
napisan. Pisao je komentar o Badarayaninim (Veda Vyasa) Brahma-sutrama i bio je toliko
angaovan, da ne samo da je zaboravio svoju enu, ve nije bio svestan ni ko mu donosi
hranu, ko odnosi posue, ko dolazi uvee i pali svetlo u lampi, ko priprema njegov krevet.
Prolo je dvanaest godina i nastupilo je vee kada je komentar zavren. Upravo ispred
pisanja poslednje rei, on se zavetovao, da kada komentar bude okonan on e postati
sannyasin. Onda se nee baviti umom, i sve je zavreno. Ovo je jedina karma koja treba da
bude okonana, ispunjena.
Te noi se malo opustio, jer zadnju reenicu je napisao oko ponoi, i po prvi put je
postao svestan svoje okoline. Lampa je slabo svetlela i trebalo joj je vie ulja. Lepa ruka je
nalivala ulje u nju. Pogledao je natrag da vidi ko je to. Nije mogao prepoznati lice, pa je pitao:
"Ko si ti i ta radi ovde?" ena je rekla: "Sada kada ste me pitali moram vam rei da ste me
pre dvanaest godina doveli kao svoju enu, ali ste bili toliko angaovani, tako mnogo predani
svom poslu, a ja nisam elela da vas prekidam i smetam vam."
Vaaspati je poeo da plae, poeo je da lije suze. ena je pitala: "U emu je stvar?"
On je odgovorio: "Ovo je vrlo sloeno. Izgubljen sam, komentar sam zavrio i sada sam
sannyasin. Ne mogu biti domain, ne mogu biti suprug. Zavrio sam komentar i zavetovao
sam se, nemam vie vremena, odmah u otii. Zato mi nisi ranije rekla? Mogao sam da te
volim. ta mogu uiniti za tvoje sluenje, tvoju ljubav, tvoju predanost?"
Stoga je on nazvao svoj komentar brahma-sutri, Bhamati. Bhamati je bilo ime njegove
ene. Ime je apsurdno, jer da se nazovu Badarayanine brahma-sutre i njihov komentar
bhamati, to nema veze. Meutim, on je rekao: "Sada nita drugo ne mogu da uinim.
Poslednja stvar je da napiem ime knjige, stoga mogu da je nazovem Bhamati kako bi to
zauvek bilo zapameno."
Ostavio je kuu. ena je plakala, ali ne u bolu ve u apsolutnom blaenstvu. Rekla je:
"Ovo je dovoljno. Ovaj gest, ova ljubav u vaim oima, dovoljna je. Dovoljno sam dobila; ne
oseajte se krivim. Idite! I zaboravite me potpuno. Ne bih elela da budem breme u vaem
umu. Nije potrebno da me se seate."
To je mogue, ako ste totalno angaovani seks potpuno nestaje jer seks je sigurnosni
ventil. Kada imate neiskorienu energiju, onda seks postaje duh koji vam ne da mira, stalno
je oko vas. Kada je energija potpuno iskoriena, seks nestaje. I to je stanje brahmacharya,
virya; stanje cvetanja sveg vaeg energetskog potencijala.
Trud, seanje, usredsreenost i razlikovanje:
raddha - poverenje; virya - vaa totalna bioenergija, vae potpuno predavanje i trud;
smrti - svest o sebi; i samadhi. Re samadhi oznaava stanje uma gde ne postoji tekoa. Ona
dolazi od rei samadhan - stanje uma kada se oseate apsolutno u redu, bez problema, bez
pitanja, skladno stanje uma. To nije koncentracija, nije usredsreenost. Usredsreenost je
upravo kvalitet koji nastupa u umu koji je bez problema. Teko je to prevesti.
Koncentracija je delimina, nepotpuna - ona se spontano deava. Pogledajte dete koje
je obuzeto svojom igrom, ono je koncentrisano bez ikakvog napora. Ono nije koncentrisano
na svoju igru. Koncentracija je nusproizvod. Ono je tako obuzeto igrom da se dogaa
koncentracija. Ako se smiljeno usredsredite na neto, onda postoji trud, onda ima napetosti,
onda ete biti umorni.
130
Samadhi se deava automatski, spontano, ako ste apsorbovani. Ako me sluate, to je
samadhi. Ako me sluate potpuno, nema potrebe ni za kakvom drugom meditacijom. To
postaje usredsreenost. Vi se ne usredsreujete - ako sluate odano, s puno ljubavi,
usredsreenost sledi sama.
U asampranata samadhiju, kada je poverenje potpuno, kada je napor potpun, kada je
seanje duboko, samadhi se deava. ta god da inite, vi inite sa totalnom usredsreenou -
bez ikakvog truda da vrite usredsreivanje. A ako koncentracija iziskuje napor, to je opasno.
To e biti kao bolest u vama; biete tim uniteni. Koncentracija treba da bude posledica.
Volite neku osobu, i samo bivajui s njom, biete usredsreeni. Zapamtite, nikada se ne
koncentriite na neto. Bolje sluajte dublje, sluajte potpuno, i imaete usredsreenost koja
e doi sama od sebe.
Isto je tako i sa razlikovanjem - prana. Prana nije razlikovanje; razlikovanje je opet
deo prane. Prana znai mudrost - spoznavajua svesnost koja sve razlikuje po svojoj
prirodi. Buda je rekao da kada plamen meditacije gori visoko, svetlost koja okruuje plamen
jeste prana. Kada je samadhi unutra, onda je svuda oko vas svetlost, to je aura koja vas
sledi. U svakom vaem inu vi ste mudri; ne pokuavate da budete mudri, to se jednostavno
deava jer ste totalno svesni. ta god da inite deava se da je mudro - a ne zato to
neprekidno mislite da uinite ispravnu stvar.
ovek koji neprekidno misli da ini ispravnu stvar, nee biti sposoban da uini nita -
nee biti sposoban ak ni da uini neto pogreno, jer e to postati takva napetost za njegov
um. I ta je ispravno, a ta je pogreno? Kako moete presuditi? ovek mudrosti, ovek
razumevanja, ne bira. On jednostavno osea. On jednostavno izbaci svoju svest svuda, i u tom
svetlu se kree. Gde god da se kree ispravno je.
Ispravno ne pripada stvarima; to pripada vama - oveku koji se kree. Nije Buda
namerno inio ispravne stvari - ne! ta god da je spontano inio bilo je ispravno. Razlikovanje
je nedovoljna, oskudna re. ovek razumevanja ima razlikovanje. On ne misli o tome; njemu
je to ba lako. Ako elite da izaete iz ove sobe, jednostavno proete kroz vrata. Ne pipate.
Ne idete prvo do zida i ne pokuavate da naete put. Jednostavno izaete. ak i ne razmiljate
da su to vrata.
Ali kada slep ovek mora da izae napolje on pita: "Gde su vrata?" i onda pokuava da
ih nae. On e kucati mnoga mesta svojim tapom, opipavae mislei neprekidno u umu:
"Jesu li ovo vrata ili zid? Idem li ispravno ili pogreno?" A kada doe do vrata, on misli: "Da,
sada su ovo vrata."
Sve se ovo deava jer je on slep. Morate razmiljati jer ste slepi, morate verovati u
ispravno i pogreno jer ste slepi; morate biti u disciplini i moralnosti jer ste slepi. Kada
razumevanje cveta, kada plamen razlikovanja i uoavanja postoji, jednostavno vidite sve
jasno. Kada imate unutarnju jasnou, sve je jasno; poinjete da uoavate, imate mo opaanja.
ta god da inite jednostavno je ispravno. Ne radite to zato to je tako 'ispravno', nego vi
radite to s razumevanjem prave prirode stvari, i zato je ispravno.
raddha, virya, smriti, samadhi, prana. Drugi koji dostiu asampranata samadhi
postiu to kroz poverenje, beskonanu energiju, trud, potpuno samopriseanje, neispitujui
um i plamen razumevanja.
131
Poglavlje 2
PRIVLANOST NAPORNOG
Izlaganje 2. januara 1975. u Buddha dvorani.
Prvo pitanje:
Ono to ste govorili o Heraklitu, Hristu i Zenu izgleda slino uenjima dejeg vrtia u
poreenju sa Patanjalijem. Heraklit, Hrist i Zen ine da zavrni korak izgleda blizak;
Patanjali ini da ak i prvi korak izgleda gotovo nemogu. Izgleda da su zapadnjaci, kao mi,
teko poeli da shvataju obim rada koji treba uloiti.
Lao Ce kae: "Ako se Tao-u ne bi smejali, to ne bi bio Tao." A ja bih eleo da vam
kaem: Ako me pogreno ne shvatite, vi neete biti vi. Vi ste prinueni pogreno da shvatite.
Vi niste razumeli ta sam ja govorio u Heraklitu, Hristu i Zenu; a ako ne moete razumeti
Heraklita, Zen i Isusa, onda neete moi da razumete ni Patanjalija.
Prvo pravilo za razumevanje jeste da to ne moe da se uporeuje. Kako moete
porediti? ta vi znate o unutarnjem stanju Heraklita ili Baoa, Bude, Isusa ili Patanjalija? Ko
ste vi da uporeujete? - jer poreenje je procenjivanje. Ko ste vi da sudite? Ali um eli da
sudi, jer se u prosuivanju um osea superiornim. Postajete sudija; va ego se osea vrlo, vrlo
dobro. Hranite ego. Kroz ocenjivanje i uporeivanje vi mislite da znate.
Oni su razliiti tipovi cvetova - neuporedivi. Kako moete uporediti ruu sa lotosom?
Ima li ikakve mogunosti da se uporeuju? Ne postoje mogunosti jer oboje su razliiti
svetovi. Kako moete uporeivati mesec sa suncem? Ne postoji mogunost. Oni su razliite
dimenzije. Heraklit je divlji cvet; Patanjali je kultivisana bata. Patanjali e biti blii vaem
intelektu, Heraklit blii vaem srcu. Meutim, kako idete dublje, razlike se gube. Kada vi
sami zaponete da cvetate, onda novo razumevanje svie u vama - razumevanje da se cvetovi
razlikuju u svojoj boji, oni se razlikuju u svom mirisu, oni se razlikuju u svom obliku i imenu.
Ali u cvetanju oni se ne razlikuju. Cvetanje, fenomen da su oni procvetali, isti je.
Heraklit je, naravno, drugaiji; mora da bude. Svaka individua je jedinstvena; Patanjali je
drugaiji. Ne moete ih staviti u istu kategoriju. Ne postoje pregrade gde ih moete strpati,
kategorizovati ih. Ali kada i vi procvetate, onda ete razumeti da cvetanje je isto bilo da je
cvet lotos ili rua - nema razlike. Unutarnji fenomen energije koja se time slavi je isti.
Oni govore razliito; oni imaju razliite obrasce uma. Patanjali je nauni mislilac. On
je gramatiar, lingvista. Heraklit je divlji pesnik. On ne brine o gramatici, jeziku i formi. A
kada kaete, da sluajui Patanjalija, oseate da Heraklit, Bao i Zen izgledaju detinjasto,
uenja iz dejeg vrtia, vi ne kaete nita o Patanjaliju ili Heraklitu, vi govorite o sebi.
Kaete da ste osoba orijentisana na um.
Patanjalija moete razumeti; Heraklit vam jednostavno izmie. Patanjali je mnogo
vri, ozbiljniji. Moete ga dohvatiti i razumeti. Heraklit je oblak, ne moete ga uopte
uhvatiti. Patanjalija moete 'uhvatiti i za glavu i za rep'; on izgleda racionalan. ta ete
uiniti sa Heraklitom, sa Baoom? Ne, jednostavno oni su suvie iracionalni. Razmiljanjem o
njima, va um postaje apsolutno nemoan. Kada iskaete takve stvari kao poreenja, ocene, vi
govorite neto o sebi - ono ko ste vi.
Patanjali moe biti shvaen; nema sumnje u to. On je apsolutno racionalan, moe da
se sledi, nema problema s tim. Sve njegove metode rada mogu da se sprovedu jer vam on
objanjava kako, a 'kako' uvek je lako razumeti. ta da se ini? Kako da se ini? On vam daje
naine izvoenja.
Pitajte Baoa ili Heraklita ta da radite, oni e jednostavno rei da nema nita da se
ini. Onda ste izgubljeni. Ako neto treba da se uini vi moete to uraditi, ali ako nita ne
treba da se ini, vi ste izgubljeni. Vi ete i dalje nastavljati da pitate, opet i opet, "ta da
132
uradim? Kako da uradim? Kako da postignem ovo o emu vi govorite?"
Oni govore o onom najviem ne kazujui o putu koji vodi do toga. Patanjali govori o
putu, nikada ne govorei o cilju. Patanjali se bavi sredstvima, Heraklit sa ciljem. Cilj je
misteriozan. To je poezija; to nije matematiko reenje. To je misterija. Ali staza je nauna
stvar, tehnika, znati kako; to vas privlai. Ali ovo pokazuje neto o vama, ne o Heraklitu ili
Patanjaliju. Vi ste osoba orijentisana na um, osoba orijentisana na glavu. Pokuajte da
uvidite ovo. Ne uporeujte Patanjalija i Heraklita. Jednostavno pokuajte da vidite stvar - da
ona pokazuje neto o vama. Ako ona pokae neto o vama, vi neto moete uraditi.
Nemojte misliti da znate ta je Patanjali i ta je Heraklit. Ne moete razumeti ak ni
obian cvet u bati, a oni su najvie rascvetavanje samog postojanja. Dok ne procvetate na isti
nain, neete biti sposobni da razumete. Ali moete porediti, moete suditi, a kroz
prosuivanje propustiete celu sutinu.
Dakle, prvo pravilo razumevanja je nikada ne ocenjivati. Nikada ne procenjujte i
nikada ne uporeujte Budu, Mahaviru, Muhameda, Hrista, Krinu; nikada ne uporeujte! Oni
postoje u dimenziji izvan poreenja, a ta god da znate o njima zaista je nita - samo
fragmenti. Vi ne moete imati totalno razumevanje. Oni su toliko iznad. Zapravo, vi
jednostavno vidite njihovu refleksiju u ogledalu svog uma.
Vi niste videli mesec; videli ste mesec odraen u jezeru. Niste videli realnost;
jednostavno ste videli odraz; a odraz zavisi od ogledala. Ako je ogledalo manjkavo, odraz je
razliit. Va um je vae ogledalo.
Kada kaete da Patanjali izgleda vrlo velik, i uenje je vrlo veliko, vi jednostavno
govorite da ne moete uopte razumeti Heraklita. A ako ga ne moete razumeti, to
jednostavno pokazuje da je on vie iznad vas nego to je Patanjali. Barem moete razumeti
ovoliko - da izgleda da Patanjali jeste teak. Sada me sledite paljivo. Ako je neto teko, vi
se moete latiti toga. Ma koliko da je teko, moete prionuti! Nuan je mnogo vei napor, ali
se to moe uraditi.
Heraklit nije lak; on je jednostavno nemogu. Patanjali je teak. Teko moete
razumeti, moete neto uiniti, moete uloiti svoju volju u to, svoj napor, svu svoju energiju,
moete uiniti neto, i to moe biti reeno. Teko moe biti uinjeno lakim, mnogo suptilnije
metode mogu biti otkrivene. Ali ta ete uiniti sa nemoguim? Ono se ne moe uiniti
lakim. Ali vi moete obmanuti sebe. Moete rei da nema niega u tome, to je uenje dejeg
vrtia, a vi ste tako odrasli, pa to nije za vas; to je za decu, ne za vas.
Ovo je trik uma da se izbegne nemogue, jer vi znate da to neete moi da reite.
Stoga je jedini najlaki smer jednostavno rei: "To nije za mene; to je ispod mene - uenje
dejeg vrtia," a vi ste odrasla, zrela osoba. Vama treba univerzitet; vama ne treba kola
dejeg vrtia. Patanjali vam odgovara, izgleda vrlo teak, moe biti odgonetnut. Nemogue
ne moe biti razreeno.
Ako elite da razumete Heraklita, ne postoji nain izuzev da potpuno odbacite svoj
um. Ako elite da razumete Patanjalija, postoji postepen put. On vam daje korake koje da
inite; ali zapamtite, on e vam na kraju, konano takoe rei: "Odbacite um." Ono to
Heraklit kae na poetku, on e rei na kraju, ali na stazi, celim putem, vi ete biti obmanuti
da je proces laki. Na kraju on e rei istu stvar, ali ipak e tada biti razumljiv jer vas on
izgrauje i usavrava, a skok ne izgleda kao skok kada imate korake.
Upravo je ovakva situacija: Heraklit vas dovodi do ambisa i kae "Skoi!" Vi gledate
dole; va um jednostavno ne moe da shvati ta on govori. To izgleda samoubistveno. Ne
postoje koraci. Pitate, "Kako"? On kae: "Ne postoji kako, jednostavno skoi. ta e ti
'kako'?" Jer ne postoje koraci, stoga 'kako' ne moe biti objanjeno. Vi jednostavno skoite, a
on kae: "Ako ste spremni ja vas mogu gurnuti, inae nema drugih metoda." Ima li ikakve
metode da se skoi? Skok je iznenadan, nagao. Metode postoje kada je to postepen proces.
Nalazei da je to nemogue, vi se okreete od toga. Ali da biste uteili sebe da niste takav
slabi, vi kaete: "Ovo je za decu. Ovo nije dovoljno teko." Ovo nije za vas.
Patanjali vas dovodi do istog ambisa, ali on je nainio korake. On kae: korak po
korak. To privlai! Moete razumeti. Matematika je jednostavna; preduzmite jedan korak
onda drugi. Ne postoji skok. Meutim, zapamtite, pre li kasnije on e vas dovesti do take
133
odakle morate skoiti. Korake je on kreirao, ali oni ne dovode do dna - samo do sredine, a dno
je jo daleko, moete tano rei da je to ambis bez dna.
Dakle, koliko koraka vi nainite ne pravi razliku. Ambis ostaje isti. On e vas voditi
devedeset devet koraka, i vi ste vrlo sreni - kao da ste preli ambis, i sada se dno pribliilo.
Ne, dno ostaje isto onoliko udaljeno kao pre. Ovih devedeset devet koraka samo su obmana
vaeg uma, samo da vam prue tehniku, 'kako'. Onda pri stotom koraku, on kae, "Sada
skoi!" A ambis ostaje isti, razmak je isti.
Nema razlike jer bezdan je beskonaan, Bog je beskonaan. Kako moete sresti njega
postepeno? Ali ovih devedeset devet koraka e vas obmanuti. Patanjali je mnogo lukaviji.
Heraklit je nevin; on vam jednostavno kae: "To je to; ambis je ovde. Skoi!" On vas ne
nagovara; on vas ne zavodi. On jednostavno kae: "To je to. Ako elite da skoite, skoite;
ako ne elite da skoite, odlazite."
A on zna da je beskorisno da se naine koraci, jer ovek na kraju mora da skoi. Ali ja
mislim da e za vas biti dobro da sledite Patanjalija jer vas on postepeno zavodi. Vi
preduzmete barem jedan korak, onda drugi korak postaje laki, onda trei. A kada ste
preduzeli devedeset devet koraka, teko e biti da se vratite natrag, jer onda e to izgledati
apsolutno protiv vaeg ega da se vratite natrag; jer onda e se itav svet smejati, a vi ste
postali tako veliki mudrac, a vraate se natrag u svet! Postali ste takav maha-yogi - veliki jogi,
i zato se vraate natrag? Sada sve uhvaeni, i ne moete se vratiti natrag.
Heraklit je jednostavan, nevin. Njegovo uenje nije kola iz dejeg vrtia, ali on jeste
dete - to je u redu, nevin kao dete, takoe i mudar kao dete. Patanjali je lukav, bistar, ali
Patanjali e vam odgovarati vie jer vama je potreban neko ko vas moe voditi lukavim
putem do take odakle se ne moete vratiti natrag. To postaje jednostavno nemogue.
Gurijev je imao obiaj da kae da postoje dva tipa majstora: jedan je nevin i
jednostavan, drugi je lukav, otrouman. On sam je rekao: "Ja pripadam drugoj kategoriji."
Patanjali je izvor svih lukavih majstora. Oni vas vode do vrta rua, a onda, iznenada, ambis.
I vi ste uhvaeni u takvom zahvatu svog vlastitog delanja, da se ne moete vratiti natrag. Vi
ste meditirali, ostavili ste svet, odrekli se ene i dece. Godinama ste radili asane (joga
poloaje), meditirali, i stvorili ste takvu jednu auru oko sebe da su vas ljudi potovali. Milioni
ljudi su gledali u vas kao u boga, a sada dolazi ambis. Sada upravo da biste se spasli morate
skoiti, samo da biste sauvali svoj ugled. Gde da odete? Sada ne moete otii.
Buda je jednostavan, Patanjali je lukav. Sva nauka je lukavost, vetina. Ovo treba da
se razume, i ja to ne govorim ni u kakvom pogrdnom i omalovaavajuem smislu, zapamtite;
ja ne osuujem. Sva nauka je lukavost!
Reeno je da je jedan sledbenik Lao Ce-a, jedan stari ovek, seljak, crpeo vodu iz
bunara, i umesto da koristi volove ili konje, on je sam - jedan star ovek - sa svojim sinom,
radio slino volu i izvlaio vodu iz bunara, znojei se; starac je pri tome teko disao. To je
bilo teko.
Sledbenik Konfuija je prolazio. Rekao je starom oveku: "Zar niste uli? Ovo je vrlo
primitivno. Zato gubite svoj dah? Sada se mogu koristiti volovi, konji se mogu koristiti. Zar
niste uli da u varoi, u gradovima, sada niko ne radi ovako kao to vi radite. Ovo je vrlo
primitivno. Nauka je brzo napredovala."
Stari ovek je rekao: "Saekaj, i ne govori tako glasno. Kada moj sin ode onda u
odgovoriti." Kada je sin otiao da obavi neki posao, on je rekao: "Sada ste vi opasna osoba.
Ako moj sin ikada uje o ovome, odmah e rei: U redu! Onda ne elim ovo da vuem. Ne
mogu obavljati ovaj posao vola. Potreban je vo."
Konfuijev uenik je pitao: "ta je pogreno u tome?" Starac je rekao: "Sve je
pogreno u tome jer je to lukavstvo. To je varanje vola; to je obmanjivanje konja. Jedna stvar
vodi do druge. Ovaj deak koji je mlad i nije mudar, ako jednom sazna da moe biti lukav sa
ivotinjama, on e se pitati zato ne bi bio vet i lukav sa ljudima. Jednom kada sazna da se
kroz vetinu i lukavost moe eksploatisati, onda ne znam gde e se zaustaviti. Molim vas idite
odavde i nikada se ne vraajte natrag ovim putem. Nemojte donositi takve lukave stvari u ovo
selo. Mi smo sreni."
Lao Ce je protiv nauke. On kae da je nauka lukavost. Ona je obmanjivanje,
134
iskoriavanje prirode - putem lukavstva prisiljava prirodu. to vie ovek postaje nauan,
vie je lukav i vet, on postaje takav. Dok je bezazlen, ovek ne moe biti nauan, naporan.
Ali ovek postaje vet i lukav. A Patanjali znajui dobro da biti nauan jeste lukavost, takoe
zna da takav ovek moe biti vraen natrag prirodi samo kroz novi izum, novo lukavstvo.
Joga je nauka o unutarnjem biu. Zato to niste bezazleni, mora vam se pribliiti
lukavim nainom. Ako ste bezazleni i nevini, nikakva sredstva nisu potrebna, nikakve metode
nisu nune. Jednostavno razumevanje, detinje razumevanje, i biete preobraeni. Ali vi niste.
Zbog toga oseate da Patanjali izgleda vrlo velik. To je zbog vaeg uma orijentisanog na
glavu i vae lukavosti.
Druga stvar da se zapamti: on izgleda teak. A mislite da je Heraklit jednostavan? On
izgleda teak, to takoe postaje privlano za ego. Ego uvek eli da uini neto to je teko, jer
nasuprot tekoi vi oseate da ste neko. Ako je neto vrlo jednostavno, kako ego moe biti
nahranjen time?
Ljudi mi dolaze i kau: "Ponekad vi uite da samo sedenjem i ne injenjem niega to
moe da se dogodi. Kako to moe biti tako jednostavno? Kako to moe biti tako lako?" uang
Ce kae: "Lako i jednostavno je ispravno" ali ovi ljudi kau: "Ne! Kako to moe biti lako? To
mora biti teko - vrlo, vrlo teko, naporno."
elite da radite teke stvari jer kada se borite protiv tekoe, protiv struje, oseate da
ste neko - pobednik. Ako je neto jednostavno, neto je tako lako da ak i dete moe to da
uradi, gde e onda va ego biti? Vi traite prepreke, traite tekoe, a ako ih nema vi ih
stvarate, tako da se moete boriti, tako da se moete baciti protiv jakog vetra i moete oseati:
"Ja sam neko - pobednik!"
Ali ne budite tako pametni. Znate frazu "pametni Aleks"?
39
Moda ne znate odakle to
dolazi - to dolazi od Aleksandra. Re "aleck" dolazi od rei Aleksandar, kao kratica. "Ne
budite pametni Aleksandar." Budite jednostavni: ne pokuavajte da budete pobednik, jer to je
besmisleno. Nemojte pokuavati da budete neko.
Ali Patanjali je privlaan; Patanjali je mnogo privlaan indijskom egu, jer Indija je
stvorila najsuptilnije egoiste u svetu. Nigde ne moete nai suptilnije egoiste u svetu kao to
moete nai u Indiji. Gotovo je nemogue nai jednostavnog jogina. Jogin ne moe biti
jednostavan, jer radi toliko mnogo asana, toliko mnogo mudri, od radi tako marljivo, kako
onda moe biti jednostavan? On misli da bude na vrhu - pobednik. Celi svet mora da mu se
klanja; on je elita - sama so ivota.
Odete li da posmatrate jogine, nai ete u njima vrlo, vrlo prefinjen ego. Njihova
unutranjost je ostala prazna; tu boansko nije ulo. Njuhova unutranjost je samo oltar za
njihov ego. Oni su postali vrlo suptilni; mogu postati tako suptilni da izgleda da su vrlo
ponizni; ali ako paljivo posmatrate u njihovoj skromnosti nai ete takoe ego.
Oni su svesni da su ponizni, to je potekoa. Stvarno ponizna osoba nije svesna da je
skromna. Stvarno skromna osoba je jednostavno ponizna, nije svesna, i stvarno ponizna osoba
nikada ne tvrdi: "Ja sam ponizan," jer sve tvrdnje su od ega. Na poniznost se ne moe polagati
pravo; poniznost nije pretenzija, to je stanje bia. Sva polaganja prava i zahtevi ispunjavaju
ego. Zato se ovo deava? Zato Indija postaje vrlo suptilna egoistika zemlja? Kada je tu ego,
postajete slepi.
Sada pitajte indijske jogine: oni krive i osuuju itav svet. Oni kau 'Zapad je
materijalistiki - samo Indija je spiritualna'. itav svet je materijalistiki, kao da tu postoji
monopol. A oni su tako slepi, ne mogu videti injenicu da je upravo obrnut sluaj.
to sam vie posmatrao indijski i zapadni um, oseam da je zapadni um manje
materijalistiki nego indijski. Indijski um je vie materijalistiki, prijanja uz stvari vie, ne
moe sudelovati, ne moe deliti; on je tvrdica. Zapadni um moe deliti, sudelovati; manje je
krt. Zato to je Zapad stvorio toliko mnogo materijalistikog obilja, ne znai da je on
materijalista, a zato to je Indija siromana, ne znai da je duhovna.
Ako je siromatvo duhovnost, onda bi impotencija bila brahmacharya. Ne, siromatvo
nije duhovnost; niti je bogatstvo materijalizam. Materijalizam ne pripada stvarima, on pripada
39
Smart Aleck.
135
stanovitu, odnosu prema stvarima. Niti duhovnost pripada siromatvu, ona pripada
unutarnjem, nevezanosti, zajednikoj deobi. Ne moete nai u Indiji nikoga ko deli ita. Niko
ne moe da deli, svako gomila. Zato to su takvi grabljivci, oni su siromani. Jer mali broj
ljudi previe zgre, onda mnogi ljudi postaju siromani.
40
Zapad je delio. Zbog toga se celo drutvo uzdiglo iz siromatva do obilja. U Indiji,
nekoliko ljudi postaju tako bogati, tako bogate ljude nigde ne moete nai - ali nekolicina - a
itavo drutvo se vue u siromatvu, a procep meu njima je ogroman. Nigde ne moete nai
takav jaz, jaz izmeu bogataa i prosjaka je ogroman. Takav jaz ne moe postojati nigde, ne
postoji nigde. Bogatih ljudi ima i na Zapadu, i siromanih ljudi ima na Zapadu, ali jaz meu
njima nije tako ogroman. Ovde je jaz jednostavno beskonaan. Ne moete zamisliti takav jaz.
Kako da se on okona? On ne moe biti prevazien jer ljudi su materijalisti. Inae otkuda
toliki jaz? emu ovaj jaz? Zar ne moete da delite? Nemogue! Ali samo njihov ego kae da
je takav itav svet, ceo svet je materijalistiki.
Do ovoga je dolo jer su ljudi bili privueni Patanjaliju i ljudima koji su davali teke
metode. Nije nita pogreno sa Patanjalijem, ali indijski ego je naao lep, suptilan izlaz da
bude egoista.
Isto se dogaa vama. Patanjali vas privlai; on je teak. Heraklit je 'deji vrti' jer je
on tako jednostavan. Jednostavnost nikada ne privlai ego. Meutim, zapamtite, ako
jednostavnost moe postati privlana, staza nije duga. Ako tekoa postane privlana, onda e
staza biti vrlo duga jer, od samog poetka, radije nego da odbacite ego, vi ste poeli da ga
akumulirate.
Ja ne govorim o Patanjaliju da vas nainim veim egoistom. Paljivo motrite. Uvek
se bojim govoriti o Patanjaliju, a nikada se ne bojim govoriti o Heraklitu, Baou, Budi.
Bojim se zbog vas. Patanjali je divan, ali vi moete biti privueni iz pogrenih razloga, a
pogrean razlog e biti ako mislite da je on teak, i onda e sama tekoa postati privlana.
Neko je pitao Hilari Edmunda, koji je osvojio Everest - najvii vrh, jedini vrh koji je bio
neosvojen - neko je pitao: "Zato? Zato ste se upustili u tu nevolju? ta vam je to trebalo?
ak i ako dospete do vrha, ta ete raditi? Moraete da se vratite natrag."
Hilari je rekao: "To je izazov ljudskom egu. Jedan neosvojeni vrh mora da bude
osvojen!" Nema druge koristi... ta ete vi uiniti? ta je on uradio? Otiao je tamo, postavio
zastavu i vratio se natrag. Kakva besmislica! Mnogi ljudi su umrli u tom nastojanju.
Vekovima su mnoge grupe pokuavale. Mnogi su umrli, bili su izgubljeni, pali su u provaliju,
nikada se nisu vratili natrag, ali to je to bilo tee postii, vie je privlailo.
Zato ii na Mesec? ta ete uiniti? Nije li Zemlja dovoljna? Ali ne, ljudski ego ne
moe to tolerisati - da Mesec ostane neosvojen. ovek mora stii tamo, jer je to teko, on
mora da bude osvojen. Tako vi moete biti privueni iz pogrenih razloga. Sada odlazak na
Mesec nije pesniko nastojanje; to nije kao kada mala deca podignu ruke i pokuavaju da
dohvate mesec.
Otkad je oveanstvo nastalo svako dete je eznulo da dosegne mesec. Svako dete je
pokuavalo, ali razlika se mora dobro razumeti. Nastojanje deteta je lepo. Mesec je tako lep.
To je pesniki napor da se dodirne mesec, da se dopre do njega. Ne postoji ego. To je
jednostavno privlanost, ljubavni dogaaj. Svako dete je u to zaljubljeno. Ako moete nai
dete koje nije privueno mesecom, kakva je to vrsta deteta?
Mesec stvara suptilnu poeziju, suptilnu privlanost. ovek bi voleo da ga dodirne i da
ga oseti; ovek bi eleo da ode na mesec. Ali to nije razlog za naunike. Za naunike Mesec
postoji kao izazov. Kako se Mesec usuuje da bude tu neprekidno, da bude izazov, a oveku
koji je ovde nije dostupan! On mora da stigne tamo.
Moete biti privueni iz pogrenih razloga. Ta greka nije do Meseca, niti do
Patanjalija, nego zato to ste vi privueni iz pogrenog razloga. Patanjali je teak - najtei -
jer on analizira itavu stazu, i svaki deo izgleda da je vrlo teak, ali tekoa ne treba da bude
privlana - zapamtite to. Moete proi kroz Patanjalijeva vrata, ali da se ne zaljubite u
40
Ovde je takoe na delu i zakon privlaenja po kome ljudi ne prose zato to nemaju, ve nemaju zato to prose.
To im se sve deava zbog mentalnog stava po kome ele da imaju jer oseaju da nemaju. Taj unutarnji primarni
oseaj, da nemaju, privlai sebi slino, situaciju da jo vie nemaju. Zato moraju da prose.
136
tekoe, ve u uvid - u lakou s kojom Patanjali osvetljava stazu. Zaljubiete se u lakou, ne
u tekou na stazi. To e biti pogrean razlog.
to ste govorili o Heraklitu, Hristu i Zenu izgleda kao deji vrti u poreenju sa
Patanjalijem.
Molim vas ne uporeujte. Uporeivanje je takoe iz ega. U stvarnoj egzistenciji, stvari
postoje bez ikakvog poreenja. Drvo koje dosegne do etiri stotine stopa u nebo, i sasvim,
sasvim mali cvet u travi, oboje su isti to se tie egzistencije. Ali vi idete dalje i kaete: "Ovo
je veliko drvo, a ta je ovo? Samo obina travka." Vi uvodite poreenje, a kad god doe do
poreenja, nastupa runoa. Vi ste unitili fenomen lepote.
Drvo je bilo veliko i divno u svojoj "drv-nosti" a trava je bila divna u svojoj
"travnatosti". Drvo se moda uzdiglo etiri stotine stopa. Njegovo cvee moda cveta na
najviem nebu, a trava samo prijanja uz zemlju. Njeni svetii su vrlo, vrlo mali. Niko ne moe
biti ak ni svestan kada oni cvetaju ni kada uvenu. Ali kada ova trava cveta, fenomen cvetanja
je isti, slavlje je isto, nema ni malo razlike. Zapamtite ovo: u samoj egzistenciji nema
poreenja; um donosi poreenje. On kae: "Vi ste lepi." Zar ne moe jednostavno rei: "Vi
ste lepi"? Zato unositi "vie lepi" ili "lepi"?
Mula Nasrudin je bio zaljubljen u enu, i kao to su ene sklone da pitaju, kada ju je
Mula Nasrudin poljubio ena je pitala: "Da li me ljubi kao prvu enu? Jesam li ja prva ena
koju ljubi? Da li je tvoj poljubac prvi koji daje eni?" Nasrudin je odgovorio: "Da, prvi i
najslai."
Uporeivanje je u vaoj krvi. Ne moete ostati sa stvarima kakve jesu. ena takoe
trai uporeivanje; inae zato bi marila da li je to prvi poljubac ili drugi? Svaki poljubac je
nov i nevin. On nema nikakvu vezu s nekim drugi poljupcem iz prolosti ili budunosti. Svaki
poljubac je egzistencija za sebe. On postoji sam u svojoj jedinstvenosti. On je vrhunac sam u
sebi; on je celina - nije ni na koji nain povezan sa prolou ili budunou. Zato pitati da li
je to prvi? Kakvu lepotu donosi prvi? A zato ne drugi, zato ne trei?
Meutim, um eli da uporeuje. Zato um eli da uporeuje? Jer se kroz uporeivanje
ego hrani, poto: "Ja sam prva ena; ovo je prvi poljubac." Vi niste zainteresovani za poljubac
- za kvalitet poljupca. Tog trenutka poljubac otvara vrata srca; vi niste zainteresovani za to, to
nije nita. Zainteresovani ste da li je prvi ili ne. Ego je uvek zainteresovan za uporeivanje, a
egzistencija ne zna za poreenje. Ljudi kao Heraklit, Patanjali, iveli su u egzistenciji, ne u
umu. Ne uporeujte ih.
Mnogi ljudi mi dolaze i kau: "Ko je vei, Buda ili Hrist?" Kakva besmislenost pitati
to! "Buda je vei od Hrista, a Hrist je vei od Bude". Ja im na to kaem: "Zato stalno
uporeujete? Suptilna stvar tu deluje. Ako ste sledbenici Hrista, eleete da Hrist bude vei,
jer vi moete biti veliki ako je Hrist najvei. To je zadovoljenje vaeg vlastitog ega. Kako
moe va majstor (guru) da ne bude najvei? On to mora biti, jer ste vi tako veliki sledbenik.
A ako Hrist nije najvei, gde e onda hriani biti? Ako Buda nije najvei, ta e se onda
dogoditi s egom budista?
Svaka rasa, svaka religija, svaka zemlja, misli da je sama najvea - ne zato to je neka
zemlja velika, ne zato to je neka rasa velika: u ovoj egzistenciji sve je najvee. Egzistencija
kreira samo najvee, svako bie je jedinstveno. Ali to ne privlai um jer je onda veliina tako
uobiajena. Svako je velik? Kakva je onda korist od toga! Neko mora biti nizak. Hijerarhija
mora da bude stvorena.
Jedne noi itao sam knjigu ora Mikea, koji je rekao da se u Budimpeti, u
Maarskoj gde je on roen, zaljubila jedna Engleskinja u njega. U Maarskoj se Engleskinja
zaljubila u njega. On nije bio mnogo zaljubljen; ali nije eleo da bude neutiv, pa kada ga je
ona pitala: "Moemo li se venati?" on je rekao: "To e biti teko jer mi majka nee dozvoliti,
ona nee biti srena ako se oenim strankinjom." Engleskinju je to veoma mnogo uvredilo.
Rekla je: "ta, ja sam stranac? Ja nisam stranac! Ja sam Engleskinja! Ti si stranac, i tvoja
majka takoe!" Mike je pitao: "U Budimpeti, u Maarskoj, jesam li ja stranac?" ena je
137
odgovorila: "Da! Istina ne zavisi od geografije."
Svako razmilja na taj nain. Um pokuava da ispuni svoje elje, da bude najvii,
najvei. Van regiona, rase, zemlje, svega, ovek mora da bude paljiv - vrlo paljiv. Samo
onda moete otii izvan ovog suptilnog fenomena ega.
Heraklit, Hrist i Zen ine da zavrni korak izgleda blizak; Patanjali ini da ak i prvi
korak izgleda gotovo nemogu.
Jer on je oboje. "On je blii od najblieg i dalji od najdaljeg", kae Upaniada. On je
oboje, i blizu i daleko. Mora da bude, jer ko e biti daleko onda? On mora da bude blizu
takoe, jer ko e biti blizu vas? On dodiruje vau kou, i on se iri izvan granica. On je oboje!
Heraklit istie blizinu jer on je jednostavan ovek. On kae da je tako blizu, nita nije
potrebno initi da se on dovede blie. On je gotovo tu; on samo gleda u vrata, kuca na vrata,
eka blizu vaeg srca. Nita ne treba da se uradi. Jednostavno budite tihi i videete; samo
sedite smireno i posmatrajte. Nikada ga niste izgubili. Istina je blizu.
Zapravo, pogreno je rei da je ona blizu jer vi ste sama ta istina. ak i blizina izgleda
da je vrlo, vrlo daleka; ak i blizina pokazuje da postoji rastojanje, udaljenost, procep. ak i
taj jaz ne postoji: vi ste to! Kae Upaniada: "Ti si to: tat tvam asi." Vi ste ve to: ak i toliko
rastojanje ne postoji da bi se reklo da je to blizu.
Zato to Heraklit i Zen ele od vas da skoite odmah - ne ekajte. Patanjali kae da je
to vrlo daleko. On je takoe u pravu: to je takoe vrlo daleko. Onda e vas privlaiti vie, jer
ako je to tako blizu a niste dospeli do njega, vi ete se oseati vrlo potiteno. Ako je to tako
blizu, upravo iza ugla, stoji pored vas, ako je to jedini sused, i svuda vas okruuje a vi ga niste
dostigli, va ego e se oseati vrlo razoarano. Tako veliki ovek kao vi, i cilj vam je tako
blizu a vi to proputate? To izgleda vrlo frustrirajue. Ali ako je on vrlo daleko, onda je sve u
redu jer vreme je potrebno, napor je nuan - nita nije pogreno u vama, on je tako daleko.
Rastojanje je tako veliko. Uzee vam vreme, vi ete ii, kretaete se, i jednog dana
ete stii, uspeti. Ako je on blizu, onda ete oseati kvalitet. Zato ga onda ne dostiete?
itajui Heraklita, Baoa i Budu, ovek se osea neudobno. Nikada se to ne deava sa
Patanjalijem. ovek se s njim osea spokojno, udobno.
Pogledajte paradoks uma. Sa najlakim ljudima ovek se osea nelagodno.
Nelagodnost dolazi od vas. Da se kreete sa Heraklitom ili Isusom vrlo je nelagodno jer oni
stalno tvrde da je carstvo boje u vama, a vi znate da nita ne postoji u vama osim pakla. A
oni tvrde da je carstvo nebesko u vama; to postaje neugodno.
Ako je carstvo boje u vama, neto je pogreno kod vas. Zato ga ne moete videti? A
ako je tako prisutno, zato se ne deava upravo ovog trenutka. To je poruka zena - da je ono
trenutno, neposredno. Nije potrebno ekati, nije potrebno gubiti vreme. To se moe dogoditi
odmah sada, ba ovog momenta. Nema opravdanja. Ovo stvara nelagodnost; vi oseate
nelagodnost, ne moete nai nikakav izgovor. S Patanjalijem moete nai milion opravdanja,
poto je cilj vrlo daleko. Nastojanje milionima ivota je nuno. Da, to se moe postii, ali
uvek u budunosti. Vi ste spokojni. Nema urbe oko toga, i vi moete ostati kakvi ste upravo
sada. Vi ete sutra ujutru zapoeti da se kreete na stazi, a takva sutranjica nikada ne dolazi.
Patanjali vam daje prostor, budunost. On kae: "Uradi to i to, i uskoro e postii -
jednog dana, niko ne zna kada - u nekom buduem ivotu." Vi ste spokojni, nema urbe.
Moete biti kakvi jeste; nema urbe.
Ako vas ovi zen ljudi dovode do ludila, ne nagonim li vas ja da budete jo lui,
mm? - jer ja govorim s obe strane, dakle nepristrasno. Upravo je ovo put. Ovo je koan. Ovo
je nain da vas otera u ludilo. Ja koristim Heraklita, koristim i Patanjalija, koristim ih oboje
kao trikove da vas nateram u ludilo. Vama se jednostavno ne moe dopustiti da se opustite.
Uvek kad ima budunosti, vi ste u redu. Onda um ne mora udeti za Bogom, i s vama nije
nita pogreno. Sam fenomen je takav da e zahtevati vreme. Ovo postaje samo izgovor.
Sa Patanjalijem moete odgaati, sa zenom ne moete odgaati. Ako odgaate, to ste
vi koji odgaate, ne Bog. Sa Patanjalijem moete odgaati jer sama priroda Boga je takva da
se on moe postii samo postepenim metodama. Vrlo, vrlo teko, zbog toga se sa tekoom vi
138
oseate ugodno, i ovo je paradoks: s ljudima koji kau da je to lako, vi se oseate neugodno; a
s ljudima koji kau da je teko, vi se oseate ugodno. To bi trebalo da bude upravo suprotno.
Istinito je i jedno i drugo, jer to zavisi od vas. Ako elite da odlaete, Patanjali je
savren. Ako elite to ovde i sada, onda ete morati da sluate zen i moraete da odluite. Da
li vam je hitno? Niste li patili dovoljno? elite li da patite vie? Onda je Patanjali savren.
Sledite Patanjalija. Onda negde u dalekoj budunosti ete dospeti do blaenstva. Ali ako ste
dovoljno patili onda ste zreli da se sada odluite - a to je ono to zrelost jeste: razumevanje da
ste dovoljno patili.
I vi smatrate Heraklita i zen da su za decu? Deji vrti? Ovo je jedina zrelost, shvatiti:
"Dovoljno sam patio." Ako ovo oseate, onda je hitnost stvorena, onda je vatra stvorena.
Neto mora da se uini upravo sada! Ne moete odlagati to; nema znaenja u odlaganju. Ve
ste dovoljno odlagali. Ali ako elite budunost, eleete da patite malo vie, moraete postati
naviknuti na pakao, makar samo jedan dan da ostane isto, ili ete eleti neke modifikacije...
To je ono to Patanjali kae: "Uradi ovo, uradi ono, polako. Uradi jednu stvar, onda
drugu stvar," milione stvari treba uraditi, a one se ne mogu uraditi odmah, tako da vi
nastavljate da menjate sebe. Danas usvojite zavet da neete biti nasilni, sutra ete usvojiti
drugi zavet. Onda prekosutra biete u celibatu, na taj nain se to nastavlja dalje i dalje, a onda
postoje milioni preostalih stvari: laganje treba da se odbaci, nasilje treba ostaviti, agresiju
treba ostaviti; ljutnju, mrnju, ljubomoru, posesivnost - imate milion stvari, postepeno. A u
meuvremenu ostajete isti.
Kako moete ostaviti ljutnju ako niste odbacili mrnju? Kako moete ostaviti ljutnju
ako niste ostavili ljubomoru? Kako moete ostaviti ljutnju ako niste odbacili agresivnost? Oni
su meusobno zavisni. Tako kaete da sada vie neete biti ljuti, ali ta govorite? Besmislicu!
Zato to ete ostati puni mrnje, ostaete agresivni, eleete da dominirate, voleete da budete
na vrhu, a odbacujete mrnju? Kako je moete odbaciti? Sve je to meusobno zavisno.
Ovo kae zen: Ako elite da ostavite neto, shvatite da je ta pojava meusobno
povezana sa svime. Ili ostavite to odmah, ili to nikada neete ostaviti. Ne obmanjujte se.
Jednostavno moete se zamajavati: malo ovde, malo zakrpe onde, a stara kua ostaje sa svom
starou. I dok nastavljate to da radite, bojei zidove, krpei rupe, i ovo i ono, mislite da
stvarate nov ivot, a u meuvremenu nastavljate s istim. A to vie s njim nastavljate,
postajete vie i dublje ukorenjeni.
Ne obmanjujte se. Ako moete razumeti, razumite odmah bez odlaganja. To je poruka
zena. Ako ne moete razumeti, onda neto mora da se uini, i Patanjali e biti dobar. Sledite
Patanjalija. Jednog dana doi ete do razumevanja gde ete uvideti da je cela ova stvar bila
trik - trik vaeg uma da izbegne realnost, da izbegne i pobegne - i tog dana iznenada ete ga
odbaciti.
Patanjali je postepen, zen je iznenadan. Ako ne moete biti iznenadni, onda je bolje
da budete postepeni. Bolje nego da ne budete nita, ni ovo ni ono, bolje je da budete
postepeni. Patanjali e vas dovesti takoe do iste situacije, ali e vam dati malo prostora. To
je mnogo ugodnije - teko, ali mnogo ugodnije. Nikakva neposredna transformacija se ne
zahteva, a sa postepenim napretkom, um moe da se prilagodi.
Heraklit, Hrist i zen ine da zavrni korak izgleda blizak; a Patanjali ini da ak i
prvi korak izgleda gotovo nemogu. To izgleda kao da smo mi zapadnjaci teko poeli da
shvatamo vanost i koliinu rada koji treba da se obavi.
To zavisi od vas, ako elite da obavite posao, vi ga moete obaviti. Ako elite
ostvarenje bez obavljanja rada, to je takoe mogue. To je takoe mogue! To zavisi od vaeg
izbora! Ako elite naporno da radite, ja u vam dati teak posao. Mogu kreirati ak i vie
koraka. Patanjali moe biti uinjen ak i duim, proirenim. Mogu postaviti cilj jo daljim,
mogu vam dati nemogue stvari da radite. To je va izbor. Ili ako elite zaista to da ostvarite,
onda se to moe uraditi upravo ovog trenutka. To zavisi od vas. Patanjali je nain
posmatranja, Heraklit je takoe nain posmatranja.
Jednom se to dogodilo. Prolazio sam ulicom i video malog deaka kako jede vrlo
veliku lubenicu. Lubenica je bila prevelika za njega, pa sam primetio da mu je teko da je
pojede. Stoga sam ga pitao, rekao sam mu: "Izgleda prevelika, zar ne?" Deak me je pogledao
139
i rekao: "Ne! Nije dovoljna za mene."
On je takoe u pravu. Sve se moe gledati sa dva stanovita. Bog je blizu i daleko.
Sada je na vama da odluite odakle elite da skoite - iz blizine ili iz daleka. Ako elite da
skoite iz daleka, onda dolaze sve tehnike, jer e vas one dovesti dovoljno daleko odakle ete
moi da skoite. To je upravo kao da stojite na ovoj obali okeana; okean je ovde i tamo, i sa
druge obale takoe - koja je potpuno nevidljiva, vrlo, vrlo udaljena. Moete nainiti skok sa
ove obale jer je to isti okean, ali ako odluite da skoite s druge obale, Patanjali vam daje
amac.
itava joga je amac za prelaz do druge obale, da bi se nainio skok. To zavisi od vas.
Moete uivati u putovanju; niega nema pogrenog u tome. Ja ne kaem da je to pogreno.
To je do vas. Moete uzeti amac i otii do druge obale, i skoiti odatle. Ali tu je isti okean.
Zato to ne uiniti s ove strane? Skok e biti isti, okean e biti isti, i vi ete biti isti. Kakva se
razlika pravi ako se ode na drugu obalu? I tamo, na drugoj obali, mogu biti ljudi koji
pokuavaju da dou ovamo. Tamo takoe ima Patanjalija; oni su tamo napravili amce. Oni
dolaze ovamo iz daleka da bi nainili skok.
To se dogodilo: jedan ovek je pokuavao da pree put. Bilo je to u vreme najveeg
saobraaja, pa je teko bilo prei put; tako mnogo kola jure velikom brzinom, a on je bio vrlo
slab ovek. Pokuao je mnogo puta, a onda se vraao natrag. Onda je video Mula Nasrudina
na drugoj strani - starog poznanika. Povikao je: "Nasrudine, kao ste preli put?" Nasrudin je
odgovorio: "Nikada nisam prelazio. Ja sam roen na ovoj strani."
Ima ljudi koji uvek misle o udaljenoj obali. Udaljeno uvek izgleda lepo, udaljeno ima
svoj vlastiti magnetizam, jer je pokriveno izmaglicom. Meutim, okean je isti. To zavisi od
vaeg izbora. Nije nita pogreno otii do tog okeana, ali otii radi pravih razloga. Moda
jednostavno izbegavate skok na ovoj obali. Onda ak i ako vas amac odveze do druge obale,
onog momenta kada dospete do druge obale poeete da mislite o ovoj obali, jer e onda ona
biti udaljena taka. I mnogo puta, u mnogo ivota, vi ste uradili ovo. Promenili ste obalu, ali
niste nainili skok.
Video sam prelaenje okeana s ove strane na onu, i sa one strane na ovu. Zato to je to
problem: ta obala je udaljena jer ste vi ovde; kada budete tamo, ova obala e biti udaljena. A
vi ste u takvom spavanju da uvek iznova potpuno zaboravljate da ste takoe bili i na toj obali.
Vremenom kada stignete do druge obale, zaboravljate obalu koju ste ostavili za sobom.
Vremenom dok stignete, zaborav prevlada.
Gledate u udaljeno, i opet neko kae: "Evo amca gospodine, moete prei na drugu
obalu, i moete skoiti odatle jer Bog je vrlo, vrlo daleko." I vi opet poinjete da se
pripremate da napustite ovu obalu. Patanjali vam daje amac da odete na drugu obalu, ali
kada stignete do nje, zen e vam uvek dati skok. Zavrni skok je iz zena. U meuvremenu
moete uraditi mnoge stvari; u njima nije poenta. Kad god da nainite skok to e biti
iznenadan skok. On ne moe biti postepen!
Sva "postupnost" je odlazak s ove obale na onu. Inae u tome nema niega pogrenog.
Ako uivate da putujete, to je lepo, jer Bog je ovde, on je u sredini, on je na drugoj obali
takoe. Nije ni potrebno da idete na drugu obalu. Moete skoiti takoe u sredini, upravo iz
amca. Onda amac postaje obala. Odakle skaete to je obala. Svakog trenutka vi moete
nainiti skok; onda to postaje obala. Ako ne skoite, onda to vie nije obala. To sve zavisi od
vas, zapamtite to dobro.
Zato ja govorim o svim kontradiktornim gleditima, tako da moete razumeti sa svih
strana, i moete videti realnost sa svih strana, pa onda moete odluiti. Ako odluite malo da
ekate, lepo. Ako odluite da krenete ba sada, lepo. Za mene, sve je lepo i sjajno, i ja nemam
izbor. Jednostavno sam dao vama sve izbore. Ako kaete: "eleo bih malo da ekam," ja
kaem: "Dobro! Blagosiljam vas. ekajte malo." Ako kaete: "Spreman sam i elim da
skoim", ja kaem: "Skoi, s mojim blagoslovom."
Za mene ne postoji izbor - ni Heraklit, niti Patanjali. Ja jednostavno otvaram sva
vrata za vas s nadom da ete ui kroz neka vrata. Ali zapamtite trikove uma. Kada govorimo
140
Heraklitu, vi mislite to je previe nejasno, previe misteriozno, previe jednostavno. Kada
govorim o Patanjaliju, mislite to je previe teko, gotovo nemogue. Ja otvaram vrata, a vi
interpretirate neto, ocenjujete i zaustavljate se. Vrata vam nisu otvorena da ocenjujete. Vrata
su vam otvorena da uete.
Drugo pitanje:
Govorili ste o kretanju od vere do poverenja. Kako moemo koristiti um koji osciluje
od sumnje do uverenja da odemo izvan ova dva pola?
Sumnja i uverenje nisu razliiti - dva su aspekta istog novia. Ovo prvo treba
razumeti, jer ljudi misle kada su uvereni da su otili izvan sumnje. Uverenje je isto kao i
sumnja, jer oboje se tiu uma. Va um raspravlja, obrazlae, kae 'ne', ne nalazi dokaz da kae
'da'; vi sumnjate. Onda va um nalazi argumente da kae 'da', dokaze da kae 'da', vi verujete.
Ali u oba sluaja verujete u razum; u oba sluaja verujete u argumente. Razlika je samo na
povrini, duboko dole vi verujete u rasuivanje, poverenje se odbacuje od strane rasuivanja.
To je ludost! To je iracionalno! To je apsurd!
A ja kaem poverenje nije vera; poverenje je lini susret. Vera se opet daje i
pozajmljuje. To je uslovljavanje. Vera je uslovljavanje od strane roditelja, kulture; drutvo
vam je daje. Vi ne brinete o tome; ne inite to linim interesom, vlastitim zanimanjem. To je
data stvar, a ono to je dato i nije bilo lini rast, samo je fasada, lano lice, nedeljno lice.
est dana ste drugaiji; a kada ulazite u crkvu stavljate masku. Pogledajte kako se ljudi
ponaaju u crkvi; tako krotko, tako oveno - isti ljudi! ak i ubica dolazi u crkvu i moli se,
vidite njegovo lice - izgleda tako lepo i nevino, a taj ovek je ubica. U crkvi morate koristiti
odgovarajue lice, i vi znate kako da ga koristite. To je bilo uslovljavanje. Od samog
detinjstva to vam je dato.
Vera je data; poverenje je rast u kome susreete realnost, suoavate se s njom, ivite
realnost i postepeno dolazite do razumevanja da sumnja vodi u pakao, bedu. to vie
sumnjate, vie jadni postajete. Ako moete potpuno sumnjati, biete u savrenoj bedi. Ako
niste u savrenoj patnji, to je stoga to ne moete sumnjati potpuno: jo uvek imate neko
poverenje. ak i ateista, on takoe veruje. ak i ovek koji sumnja da li svet postoji ili ne, on
takoe ima poverenje; inae ne bi mogao da ivi, ivot bi bio nemogu.
Ako sumnja postane totalna, ne moete iveti nijednog trenutka. Kako moete disati
ako sumnjate? Ako zaista sumnjate, ko zna nije li disanje otrovno? Ko zna ne unose li se
milioni klica? Ko zna dolazi li rak kroz disanje? Ako stvarno sumnjate, ne moete ak ni
disati. Ne moete iveti nijednog trenutka; odmah ete umreti. Sumnja je samoubistvo. Ali vi
nikada ne sumnjate savreno, tako da oklevate. Zamajavate se; nekako se oteete. Zato va
ivot nije potpun. Samo razmislite: ako je totalna sumnja samoubistvo, onda e totalno
poverenje biti najpotpuniji mogui ivot.
To je ono to se deava oveku poverenja: on ima poverenje, to vie poklanja
poverenje, vie postaje sposobniji da ima poverenje. to vie postaje sposoban da ima
poverenje, vie ivota se otvara. On osea vie, on ivi vie, on ivi intenzivnije. ivot postaje
autentino blaenstvo. Sada moete imati vie poverenja. Ne znai da sada neete biti
zavedeni, jer ako imate poverenje, to ne znai da vas niko nee obmanuti. Zapravo, vie ljudi
e vas obmanuti jer postajete ranjivi, osetljivi. Ako imate poverenje, vie ljudi e vas
obmanuti, ali niko vas ne moe uiniti nesrenim i jadnim; ovo je detalj koji treba razumeti.
Oni vas mogu obmanuti, mogu ukrasti stvari od vas, mogu pozajmiti novac koji vam nikada
nee vratiti - ali niko vas ne moe uiniti nesrenim - to postaje nemogue. ak i ako vas
ubiju, ne mogu vas uiniti alosnim.
Vi imate poverenje, a poverenje vas ini osetljivim, ranjivim - ali takoe apsolutno
pobedonosnim, jer niko vas ne moe pobediti. Oni mogu obmanuti, mogu krasti, vi moete
postati prosjak, ali pored toga ete biti car. Poverenje ini careve od prosjaka, a sumnja ini
prosjake od careva. Pogledajte jednog cara koji ne moe imati poverenje; on se uvek boji. On
ne moe verovati svojoj vlastitoj eni, ne moe imati poverenje u svoju decu, zato to kralj
poseduje toliko mnogo njegov sin e ga ubiti, njegova ena e ga otrovati. On ne moe imati
141
poverenje ni u koga. On ivi u takvom nepoverenju da je ve u paklu. ak i kada spava, on se
ne moe opustiti. Ko zna ta e se dogoditi!
Poverenje vas ini sve vie i vie otvorenim. Naravno, kada ste otvoreni, mnoge stvari
e postati mogue. Kada ste otvoreni, prijatelji e dopreti do vaeg srca; naravno, neprijatelj
moe takoe dopreti do vaeg srca - vrata su otvorena. Dakle, postoje dve mogunosti. Ako
elite da budete sigurni, potpuno zatvorite vrata. Stavite rezu, zakljuajte ih i sakrijte se
unutra. Sada nikakav neprijatelj ne moe ui, ali takoe ne moe ui ni prijatelj. ak i ako
Bog doe, ne moe ui. Sada niko ne moe da vas obmane, ali u emu je poenta? Vi ste u
grobu. Vi ste ve mrtvi. Niko vas ne moe ubiti, ali ste ve mrtvi: ne moete izai van. ivite
u sigurnosti, naravno, ali kakav je to nain ivota? Vi uopte ne ivite. Onda otvorite vrata.
Sumnja je zatvaranje vrata; poverenje je otvaranje vrata. Kada otvorite vrata, sve
alternative postaju mogue. Prijatelj moe ui, neprijatelj moe ui. Vetar e doi; donee
miris cvea; donee takoe klice bolesti. Sada je sve mogue - dobro i loe. Ljubav e doi;
mrnja e doi takoe. Sada Bog moe doi, avo moe takoe doi. Ovo je strah da neto
moe krenuti nepovoljno, stoga zatvarate vrata. Ali onda sve ide nepovoljno. Otvorite vrata -
neto je mogue da krene nepovoljno, ali za vas, nita, ako je vae poverenje potpuno. ak i u
neprijatelju ete nai prijatelja i ak u avolu ete nai Boga. Poverenje je takav preobraaj da
ni u emu ne moete nai nita loe, jer se itavo vae gledite promenilo.
To je znaenje Isusove izreke: "Volite svoje neprijatelje." Kako moete voleti svog
neprijatelja? To je bilo problematino za razumevanje - zagonetka za hrianske teologe.
Kako voleti svoga neprijatelja? Meutim, ovek poverenja moe to da ini, jer ovek
poverenja ne zna za neprijatelje. ovek poverenja zna samo prijatelje. U kom god obliku on
da doe nema razlike. Ako doe da krade on je prijatelj; ako doe da primi, on je prijatelj; ako
doe da daje, on je prijatelj; u kome god obliku da doe.
Dogodilo se da je Al-Hilaj Mansur, veliki mistik, veliki sufi, bio ubijen, raspet, od
strane muslimana. Poslednje rei su mu bile - pogledao je u nebo - i rekao: "Ali ne moe me
obmanuti." Mnogi ljudi su bili prisutni, a Al-Hilaj se smeio, i rekao obraajui se nebu:
"Vidi, ne moe me obmanuti." Neko ga je pitao: "ta misli pod tim? Kome govori?" On je
rekao: "Govorim mom Bogu: u bilo kom obliku da doe ne moe me obmanuti. Ja te znam
dobro. Sada si doao kao smrt. Ne moe me obmanuti."
ovek poverenja ne moe biti obmanut. U bilo kom obliku, bilo ta da doe, uvek
boansko dolazi njemu jer poverenje ini sve svetim. Poverenje je alhemija. Ono preobraava
ne samo vas; ono preobraava za vas itav svet. Gde god pogledate vidite boansko: u
prijatelju, u neprijatelju; u noi, u danu. Da, Heraklit je u pravu. Bog je leto i zima, dan i no,
Bog je sitost i glad. To je poverenje. Patanjali ini poverenje osnovom - osnovom sveg rasta.
Govorili ste o kretanju od vere do poverenja...
Vera je ono to je dato; poverenje je ono to se nalazi. Veru vam daju vai roditelji;
poverenje vi morate nai. Veru vam daje drutvo; za poverenje morate istraivati, tragati i
ispitivati. Poverenje je lino, intimno; vera je kao roba iroke potronje. Moete je kupiti na
trnici.
Moete je kupiti u prodavnici - kada ja kaem to, kaem to sa vrlo promiljenim
umom. Moete otii i postati musliman; moete otii i postati hindus. Idite u jedan Arja hram
i biete preobraeni da budete hindus. Nema problema. Vera se moe kupiti u trnici. Od
muslimana moete postati hindus, od hindusa moete postati ain. To je tako jednostavno da
svaki glupi svetenik moe to uiniti. Meutim, poverenje - nije roba iroke potronje. Ne
moete otii i nai ga na tritu, ne moete ga kupiti. Morate proi kroz mnoga iskustva. Ono
postepeno nastaje; postepeno vas menja. Novi kvalitet, novi plamen dolazi u vae bie.
Kada uvidite da je sumnja nevolja i patnja, onda dolazi poverenje. Kada vidite da je
vera mrtva, onda dolazi poverenje. Vi ste hrianin, hindus, musliman; jeste li ikada primetili
da ste sasvim mrtvi? Koji ste vi vrsta hrianina? Ako ste zaista hrianin, vi ete biti Hrist -
nita manje od toga. Poverenje e vas uiniti Hristom, vera e vas uiniti hrianinom - vrlo
siromanom imitacijom. Koja ste vrsta hrianina? Ona koja odlazi u crkvu, koja ita Bibliju?
142
Vaa vera nije znanje. To je neznanje.
Ovo se dogodilo u jednom Rotari klubu.
41
Doao je veliki ekonomista da govori.
Govorio je strunim jezikom ekonomista. Prisutan je bio i gradski svetenik i sluao je
njegovo izlaganje. Posle govora, priao mu je i rekao: "Odrali ste divan govor, ali da budem
iskren, nisam mogao da sledim nijednu re." Ekonomista je rekao: "U tom sluaju, ja u vam
rei ta da kaete svojim sluaocima: "Imajte veru."
Kada ne moete razumeti, kada ste neznalica, celo drutvo kae: "Imaj veru." Ja u
vam rei: Bolje je sumnjati nego imati lanu veru. Bolje je sumnjati jer sumnja e stvoriti
patnju. Vera je uteha; sumnja e stvoriti jad, nevolju. A ako postoji patnja, vi ete traiti
poverenje. Ovo je problem dileme koja se javila u svetu. Zbog vere vi ste zaboravili kako da
traite poverenje. Zbog vere vi ste ostali bez poverenja. Zbog vere vi nosite leeve: vi ste
hriani, hindusi, muslimani, i propustili ste celu sutinu.
42
Zbog vere vi mislite da ste
religiozni. Onda istraivanje prestaje.
Iskrena sumnja je bolja od neiskrene vere. Ako je vera lana - a svaka vera je lana
ako niste izrasli u njoj, ako ona nije vae oseanje i vae bie i vae iskustvo - svaka vera je
lana! Budite iskreni! Sumnjajte! Patite! Samo patnja e vas dovesti do razumevanja. Ako
patite istinski, jednog dana ete razumeti da je sumnja ta koja ini da patite. Onda preobraaj
postaje mogu.
Pitate me: Kako moemo koristiti um koji osciluje od sumnje do verovanja da odemo
izvan ova dva pola?
Ne moete ga koristiti, jer nikada niste iskreno sumnjali. Vaa vera je lana: duboko
ispod je skrivena sumnja. Samo na povrini se nalazi premaz vere. Duboko ispod vi ste
nesigurni - ali se bojite da priznate da ste ispunjeni sumnjom, zato stalno prianjate uz veru,
stalno inite gestove vere. Moete izvoditi gestove, ali kroz njih ne moete stii do realnosti.
Moete ii da se klanjate u hramu, da inite rituale oveka koji veruje. Ali neete rasti, jer
duboko ispod nema poverenja, samo sumnja. Vera je samo nadgradnja sumnje.
To je kao ljubljenje osobe koju ne volite. Spolja sve je isto, vi inite gest ljubljenja.
Nijedan naunik ne moe nai ikakvu razliku. Ako ljubite osobu, fotografija, psiholoka
pojava, prenoenje miliona klica s jednih usana na druge, sve je sasvim isto bilo da volite ili
ne. Ako naunik gleda i prati, kakva e biti razlika? Nema razlike - nema ak nijedne trunice
razlike. On e rei oba poljupca su sasvim ista.
Meutim, vi znate da kada volite osobu onda neto nevidljivo tee, to ne moe biti
otkriveno nijednim instrumentom. Kada ne volite osobu, onda moete dati poljubac, ali nita
se ne deava. Nema prenoenja energije, nikakvo prisno optenje se ne deava. Isto je sa
verom i poverenjem. Poverenje je poljubac s ljubavlju, s duboko zaljubljenim srcem, a vera je
poljubac bez ljubavi.
Dakle, odakle poeti? Prva stvar je istraivanje same sumnje. Odbaciti lanu veru.
Postati iskreni sumnjalica - iskreni. Vaa iskrenost e pomoi, jer ako ste iskreni, kako moete
propustiti glavnu stvar da sumnja stvara patnju? Ako ste iskreni, vi ste prinueni to da znate.
Pre ili kasnije doi ete do spoznaje da je sumnja stvorila vie patnje - to vie ulazite u
sumnju, vie ima patnje. Samo kroz jad ili nevolje ovek raste.
A kada stignete do take gde patnju vie nije mogue tolerisati, nepodnoljiva je, vi je
ostavljate, odbacujete. Ne odbacujete je vi; sama nepodnoljivost postaje odbacivanje. A kada
jednom nema sumnje, a vi ste patili kroz nju, zapoinjete da se kreete prema poverenju.
Poverenje je preobraaj - raddha; a Patanjali kae, da je raddha - poverenje -
osnova svakog samadhija, svakog krajnjeg iskustva boanskog.
41
Lokalni klub koji okuplja biznismene zbog veza i interesa, spadaju u nii rang masonskih organizacija, i pod
kontrolom su masona.
42
Aluzija na Nieovog Zaratustru. (Nie: Tako je govorio Zaratustra, gl. 9)
143
Poglavlje 3
POTPUNI NAPOR ILI PREDANOST
Izlaganje 3. januara 1975. u Buddha dvorani.
I, 21: tivrasamveganamasannah.
Onima koji arko ele [asamprajnatasamadhi] je na domaku.
I, 22: mrdumadhyadhimatratvat tato 'pi vieah.
Postoji nadalje [u relaciji jogin - samadhi pedagoki relevantna] razlika [s
obzirom na injenicu] nedovoljnosti, odmerenosti ili prekomernosti [joginove
motivacije].
I, 23: ivarapranidhanad va.
U predanosti Uzvienom [nalazi se] takoe [jedan od naina da se dostigne
samadhi].
I, 24: kleakarmavipakaayairaparamrtah puruaviea ivarah.
[Taj] Uzvieni [ideal] (ivara) predstavlja onu izuzetnu sve-
transcendirajuu-individualnost (purua), koja je iznad [svega to se javlja kao]
zapreenost [klea) [realizaciji istine], iznad inova i njihovih [neposrednih i posrednih]
plodova (karmavipaka), iznad [svih] determinirajuih ostataka ranijih iskustava
(aaya).
I, 25: tatra niratiayam sarvajnabijam.
Tu je klica istinskog znanja dostigla svoj najvii domet.
Postoje tri tipa tragaoca. Prvi tip dolazi na stazu zbog radoznalosti. Patanjali to
naziva kutuhala. On nije zaista zainteresovan. Kao da je uplovio u to sluajno. Moda je neto
itao. Moda je sluao nekoga da govori o Bogu, istini, krajnjem osloboenju, i zainteresovao
se.
Interesovanje je intelektualno, kao dete koje postane zainteresovano za sve i svaku
stvar, a onda, posle nekog vremena skree daleko od toga jer sve vie i vie radoznalosti uvek
otvara vie vrata.
Takav ovek nikada nee postii istinu. Iz radoznalosti vi ne moete postii istinu, jer
istina trai istrajan napor, kontinuitet, postojanost, to radoznali ovek ne moe izvriti.
Radoznao ovek moe initi izvesnu stvar odreeni period vremena prema svojoj udi, ali
onda nastupa praznina, a u tom procepu sve to je uinjeno nestaje, ostaje nedovreno. Opet
e zapoeti od samog poetka, i ista stvar e se dogoditi.
On ne moe ponjeti rezultat. On ne moe zasaditi seme jer ne moe ekati, milioni
novih interesovanja ga uvek pozivaju. On ide na jug, onda se seli na istok, a onda ide na
zapad, onda na sever. On je kao drvo noeno po moru. Ne ide nikuda, njegova energija se ne
kree do jednog odreenog cilja. Koja god okolnost ga gurne... On je bez bitnih svojstava, a
takav ovek ne moe postii boansko. Moda izvri neku veliku aktivnost, ali to je
nekorisno, jer danju e je on uiniti, a nou ponititi. Istrajnost je potrebna; neprekidno
kovanje je neophodno.
alaludin Rumi je imao malu kolu - kolu mudrosti. Imao je obiaj da odvede svoje
uenike u polja, na oblinja imanja. Posebno bi na jedan posed odvodio sve svoje nove
uenike da pokae ta se tamo deava. Kad god bi novi uenik doao, odveo bi ga na to
144
imanje. Tamo je bilo neto vredno. Seljak je bio primer odreenog stanja uma. Seljak je
kopao bunar, meutim, kopao bi deset stopa, petnaest stopa, a onda bi se predomislio. "Ovo
mesto ne izgleda dobro" - tako da bi poinjao da kopa drugu jamu, a onda jo jednu.
Ve vie godina on je to radio. Sada je tu bilo osam nedovrenih jama. Celo imanje je
bilo uniteno, a on je radio na devetoj. alaludin bi rekao svojim novim uenicima,
"Pogledajte, nemojte biti kao ovaj seljak. Da je uloio sav svoj napor u jednu jamu, do sada bi
jama bila barem sto stopa. On je uloio veliki napor, mnogo je radio, ali nije mogao ekati.
Deset, dvanaest, petnaest stopa, onda mu postane dosadno. Onda zapoinje novu jamu. Na
ovaj nain ceo posed e biti pokriven jamama, a nikada nee biti bunara."
Ovo je radoznao ovek, sluajan ovek koji radi neke stvari, i kada zapone, on ima
veliko oduevljenje - zapravo, preveliko. Ovo preveliko oduevljenje ne moe ostati
neprekidno. On zapoinje s takvom snagom i oduevljenjem, tako da znate da e se ubrzo
zaustaviti.
Drugi tip oveka koji dolazi do unutarnjeg traganja je ovek od istraivanja - igjasa.
On ne dolazi iz radoznalosti. On dolazi sa jednim intenzivnim istraivanjem. On podrazumeva
to, ali to takoe nije dovoljno jer njegove namere su u osnovi intelektualne. On moe postati
filozof, ali ne moe postati religiozan ovek. On e istraivati duboko, ali njegovo istraivanje
je intelektualno. On ostaje orjentisan na glavu; to je problem koji treba reiti.
ivot i smrt nisu obuhvaeni; to kod njega nije pitanje ivota i smrti. To je zagonetka,
slagalica. On uiva reavajui to ba kao to vi uivate reavajui zagonetku ukrtenice jer
vam prua izazov. To mora da se rei, oseaete se vrlo dobro ako je moete reiti. Meutim,
to je intelektualno, duboko dole ukljuen je ego. Ovaj ovek e postati filozof. Naporno e
raditi. Razmiljae, kontemplirae, ali nikada nee meditirati. Razmiljae logino,
racionalno; nai e mnogo reenja. On e kreirati sistem, ali cela stvar bie njegova vlastita
projekcija.
Istina vas treba totalno. ak i devedeset devet procenata nee delovati: nuno je tano
sto posto vas, a glava je samo jedan procenat. Vi moete iveti "bez glave". ivotinje ive
"bez glave", drvee ivi "bez glave". Glava nije tako bitna stvar u egzistenciji. Vi moete lako
iveti - zapravo, moete mnogo lake iveti "bez glave" nego "sa glavom". Ona stvara milione
komplikacija. Glava nije ba apsolutno nuna i priroda zna to. Ona je suvian luksuz. Ako
nemate dovoljno hrane, telo zna gde hrana treba da ide; ono prestaje da je daje glavi.
Zbog toga, u siromanim zemljama, intelekt se ne moe razviti, jer intelekt je luksuz.
Kada je sve zavreno, kada telo u potpunosti dobija sve, samo tada se energija kree prema
glavi. ak i u vaem ivotu se to deava svakog dana, ali niste svesni. Ako pojedete previe
hrane - odmah ete se oseati pospano. ta se deava? Telu je potrebna energija za probavu.
Glava moe biti zaboravljena, energija se kree prema stomaku. Glava osea vrtoglavicu,
pospanost. Energija se ne kree, krv se ne kree prema glavi. Telo ima svoju vlastitu
ekonomiju.
Postoje osnovne stvari, a ima stvari koje nisu osnovne. Osnovne stvari treba prvo da
budu ispunjene, jer one koje nisu osnovne mogu ekati, vae filozofiranje moe ekati. Nema
velike potrebe za tim. Ali va stomak ne moe ekati, on mora biti prvo napunjen; ta glad je
mnogo osnovnija. Zbog ove osnovne realizacije mnoge religije su pokuale post, jer ako
postite glava ne moe da misli, jer energija nije tako velika; ne moe biti data glavi. Ali ovo je
varka. Kada energija bude tu, glava e zapoeti da misli opet. Ova meditacija je la.
Ako postite dugo, neprekidno nekoliko dana, glava ne moe da misli. Niste vi dospeli
do ne-uma, do transcendencije; jednostavno u vama ne postoji suvina energija. Telu je
potrebna prvo; telesne potrebe su osnovne, bitne; potrebe glave su sekundarne, suvine. To je
kao da imate jednu ekonomiju u vaoj kui. Ako vae dete umire, vi ete prodati TV aparat. U
tome nema mnogo toga sadranog. Moete prodati nametaj kada dete umire; a kada ste vi
gladni, moete prodati ak i kuu. Prvo osnovne stvari - to je znaenje ekonomije - zatim
druge stvari. A glava je poslednja; ona je samo jedan posto vas, i to takoe suvian. Moete
postojati "bez glave", tj. intelekta.
Moete li postojati bez stomaka? Moete li postojati bez srca? Meutim, moete
postojati bez glave (intelekta). A kada posvetite preveliku panju glavi (intelektu), vi ste
145
potpuno uvrnuti. Radite stoj na glavi; shirshasana. Potpuno ste zaboravili da glava nije bitna.
Kada date samo glavi (intelektu) da istrauje, to je igjasa. To je luksuz. Moete
postati filozof i sedeti u fotelji; odmarati se i razmiljati. Filozofi su kao luksuzni nametaj.
Ako to moete priutiti, dobro; ali to nije problem ivota i smrti. Stoga Patanjali kae da
ovek radoznalosti - kutuhala - ne moe postii ostvarenje; ovek igjase - istraivanja -
postae filozof.
Onda postoji trei ovek koga Patanjali zove ovek mumuka. Teko je prevesti re
mumuka, stoga u je objasniti. Mumuka oznaava elju da se bude beeljan; elja da se bude
potpuno osloboen, elja da se izae iz kruenja egzistencije, elja da se ne bude roen
ponovo, da se ponovo ne umre, oseanje - da je dovoljno - biti roen milionima puta, umirati
stalno i kretati se u istom zaaranom krugu. Mumuka znai da se konano ispadne iz samog
kruenja egzistencije. Dosaivan, napaen ovek eli da izae iz nje. Istraivanje postaje sada
pitanje ivota i smrti. itavo vae postojanje je dovedeno u pitanje. Patanjali kae samo
ovek mumuke, u kome se elja za osloboenjem - moka - probudila, moe postati
religiozan ovek, jer je on vrlo, vrlo logian mislilac.
Onda takoe ima tri tipa ljudi koji pripadaju samo mumuka kategoriji. Prvi tip oveka
koji pripada mumuki ulae jednu treinu bia u svoje nastojanje. Ulaui jednu treinu vaeg
bia u vaem nastojanju vi ete postii neto. Ono to dostignete bie negativno postignue:
neete biti napeti - ovo treba shvatiti vrlo duboko - ali, neete biti ni spokojni. Neete biti
napeti; napetost e otpasti. Ali neete biti ni spokojni, tihi, staloeni. Postignue e biti
negativno. Neete biti bolesni, ali takoe neete biti ni zdravi. Bolest e ieznuti. Neete se
oseati razdraeno, neete oseati frustraciju. Ali neete oseati ni ispunjenje, takoe.
Negativnost e otpasti, bodlje e otpasti, ali cvetanje se nee dogoditi.
Ovo je prvi stepen mumuke. Moete nai mnoge ljude koji su se u njemu zaglavili.
Osetiete izvestan kvalitet u njima: oni ne reaguju, nisu razdraeni, ne moete ih naljutiti, ne
moete ih uznemiriti. Oni su postigli neto, ali jo oseate da neto nedostaje. Oni nisu
oputeni. ak i ako nisu ljuti, nemaju saoseanje ni samilost. Oni moda nisu ljuti na vas, ali
ne mogu oprostiti. Suptilna je razlika. Oni nisu ljuti, to je uredu. Ali ak i ako nisu ljuti ne
postoji potpuno opratanje. Tu su se zaglavili.
Oni ne mare za vas, vau uvredu, ve su, na neki nain, iskljueni iz uzajamnih
odnosa. Oni ne mogu sudelovati. Pokuavajui da ne budu ljuti, oni su izali iz svih
uzajamnih odnosa. Postali su kao ostrva - zatvoreni. A kada ste jedno ostrvo, zatvoreni, vi ste
iupani iz korena. Ne moete cvetati, ne moete biti sreni, ne moete imati blagostanje. To
je negativno postignue. Neto je odbaeno, ali nita nije postignuto. Staza je jasna, naravno.
ak je vrlo dobro odbaciti neto, jer tada nastaje mogunost da neto ue u postojanje; moete
neto postii.
Patanjali njih naziva mridu: meki, slabi. Prvi stepen postignua, odricanje ili
negiranje. Nai ete mnoge sannyasine u Indiji, mnoge monahe u katolikim manastirima,
koji su se zaglavili u ovome. Oni su dobri ljudi, ali ete otkriti da su dosadni i jednolini. Vrlo
je dobro ne biti ljut, ali to nije dovoljno. Neto nedostaje; nita pozitivno se nije dogodilo. Oni
su prazne posude. Oni su ispraznili sebe, ali se na neki nain nisu ponovo ispunili. Ono vie se
nije spustilo, a nie je odbaeno.
Onda postoji drugi stepen mumuke - drugi stepen istinitog tragaoca - koji ulae dve
treine svoga napora. Jo se ne zalae totalno, ve samo osrednje. Zbog osrednjosti, Patanjali
naziva njega madhya - osrednji ovek. On postie neto. ovek prvog stepena je u njemu, ali
neto vie je dodato. On je u tiini - smiren, staloen, sabran. ta god da se desi u svetu, ne
utie na njega. On ostaje nedirnut, izdvojen. On postaje kao planinski vrh: vrlo miran.
Ako doete blizu njega osetiete njegov mir kako vas okruuje; isto kao kada odete u
vrt i miris cvea i pevanje ptica vas okruuju; oni vas dodiruju, to moete osetiti. Sa ovekom
prvog stupnja, mridu, neete osetiti nita. Osetiete samo prazninu - stvorenje nalik pustinji.
Prvi tip oveka e vas isisati. Ako doete blizu njega, osetiete da ste ispranjeni - neko vas je
isisao, jer je on kao pustinja. S njim ete osetiti da ste isueni, i bojaete se.
Ovo ete osetiti s mnogim sannyasinima. Ako im priete blizu, osetiete da vas
isisavaju, ne znajui to. Oni su postigli prvi stepen. Oni su postali prazni, a sama praznina je
146
postala kao jama i ona vas automatski usisava.
Reeno je na Tibetu da, ako je ovaj ovek prvog stepena negde, ne treba mu dozvoliti
da se kree u gradu. Kada lame na Tibetu dostignu prvi stupanj, njima je zabranjeno da izlaze
van manastira - jer ako ovaj ovek doe blizu vas, on usisava. To sisanje je izvan njegove
kontrole; on ne moe uiniti nita u pogledu toga. On je kao pustinja. Sve to doe blizu njega
biva usisano, iskorieno.
Lamama prvog stupnja nije dozvoljeno da dodiruju drvo, jer je zapaeno da drvo
umire. ak i na Himalajima, hindu sannyasinu nije dozvoljeno da dodiruje drvee - ono e
umreti. On je sisajui fenomen. Ovom lami prvog stepena nije dozvoljeno da prisustvuje
niijem venanju, jer e postati destruktivna sila. Njemu nije dozvoljeno da blagoslovi
nikoga, jer on ne moe blagosloviti. ak i kada blagosilja, on isisava. Vi moda ovo niste
znali, da su za ove lame prvog stepena, sannyasine, sadhue, stvoreni manastiri, tako da mogu
iveti u svom vlastitom zatvorenom svetu, nije im dozvoljeno da se kreu van. Dok ne
postignu drugi stupanj, nije im dozvoljeno da blagosiljaju nikoga.
Tragalac drugog stepena koji je uloio svoje dve treine bia postaje miran, spokojan.
Ako mu priete blizu, on se uliva u vas, on uestvuje, deli. Sada on vie nije pustinja, sada je
zelena uma. Mnoge stvari nadolaze u njemu - tiina, mir, blagost. Vi ete osetiti to. Meutim
ovo takoe nije cilj; mnogi su se zaglavili u tome. Nije dovoljno samo biti smiren. Koja je to
vrsta postignua? Samo da se bude tih? To je kao smrt, nema kretanja, nema aktivnosti. Vi ste
u spokojstvu, naravno, kod kue naravno, ali nema slavljenja, nema blaenstva.
Tragalac treeg stepena ulae svoju celokupnost u to i stie do blaenstva. Blaenstvo
je pozitivan fenomen; mir je samo njegov pratilac. Kada blaenstvo doe blie, vi postanete
mirni. To je udaljeni uticaj blaenstva koje stie blizu vas. To je kao pribliavanje reci: s
velike udaljenosti vi poinjete da oseate da se vazduh osveava, kvalitet zelenila se menja.
Drvee je zelenije s vie listova. Vazduh je sve. Reku jo niste videli, ali je ona negde blizu,
izvor vode je negde blizu. Kada je izvor ivota negde blizu, vi postajete mirni, ali jo to niste
dostigli - samo ste na putu. Patanjali zove takvog oveka madhya: usrediten ovek,
posrednik.
On takoe nije cilj. Dok ne moete plesati sa ekstazom... Ovaj ovek ne moe plesati,
ovaj ovek ne moe pevati, jer pevanje e izgledati kao ometanje mira, ples e izgledati
blesavo - ta vi to radite? Ovaj ovek moe samo sedeti kao mrtva statua - tih, naravno, ali
nije procvetao; zelen, ali cvetovi se jo nisu dogodili: poslednji in nije nastupio. Tek kada se
to dogodi onda e ovek treeg stepena postati ovek koji moe da plee, koji e izgledati lud
jer ima toliko mnogo. On se ne moe obuzdati, i zato to se ne moe uzdrati pevae, igrae i
delie, bacae kad god moe seme koje ga zapljuskuje neogranieno. Ovo je ovek treeg
stepena.
Patanjali kae:
Uspeh je blii onima iji su napori intenzivni i iskreni.
Izgledi za uspeh variraju prema stepenu nastojanja.
Uspeh je blii onima iji su napori intenzivni i iskreni.
Neophodna je vaa celokupnost. Zapamtite, iskrenost je kvalitet koji se deava kad
god ste u neemu totalno, ali ljudi veim delom nisu u pravu u svojim predstavama o
iskrenosti. Oni misle da biti ozbiljan znai biti iskren. Biti ozbiljan ne znai biti iskren.
Iskrenost je kvalitet koji se deava kad god ste potpuno u neemu. Dete koje se igra sa svojim
igrakama je iskreno, potpuno je u tome, apsorbovano, nita ne preostaje u pozadini, nema
zadravanja pozadine; ono nije tu, samo se igra odvija.
Budui da nita ne zadravate, gde ste vi? Vi ste potpuno postali jedno sa delovanjem.
Delatelj vie ne postoji, inilac vie nije tu. Kada poinioca nema, postoji iskrenost. Ne
moete biti ni ozbiljni, jer ozbiljnost pripada iniocu. Dakle, u damijama, hramovima,
crkvama, nai ete dva tipa ljudi - iskrene i ozbiljne. Ozbiljni e biti sa izduenim licima, kao
da rade vrlo vanu stvar - neto sveto, neto iz drugog sveta. Ovo je takoe ego, kao da inite
neto veliko, kao da sluite ceo svet time to se molite.
147
Pogledajte religiozne ljude - takozvane religiozne ljude: oni hodaju na takav nain kao
da slue celom svetu. Oni su so zemlje. Ako oni ieznu, itava egzistencija e ieznuti. Oni
je podravaju. Zbog njih ivot postoji - zbog njihovih molitvi. Videete da su u tome vrlo
ozbiljni.
Ozbiljnost pripada egu, iniocu. Pogledajte oca koji radi u trgovini, ili negde u
kancelariji. Iako ne voli svoju enu, svoju decu, bie ozbiljan jer to je dunost. On ini to, i
sluisvakoga okolo. On e uvek rei: "Ja to radim za moju enu, za moju decu." Taj ovek e
sa svojom ozbiljnou postati mrtav kamen koji visi oko vrata njegove dece, a ona nikada
nee moi to da mu oproste jer ih nikada nije voleo.
Ako volite, vi nikada ne izgovarate takve rei. Ako volite svoju decu, idete pleui u
svoju kancelariju. Vi ih volite, to nije neto emu sluite. Vi ne izvravate dunost; to je vaa
ljubav. Sreni ste to vam je dozvoljeno da uradite neto za svoju decu. Sreni ste i blaeni da
moete uiniti neto za svoju enu jer ljubav osea takvu bespomonost; ljubav eli da uini
toliko mnogo stvari, a ne moe uiniti. Ljubav uvek osea: "ta god da uinim manje je nego
to treba da se uini." A dunost? Dunost uvek osea: "inim vie nego to je potrebno."
Dunost postaje ozbiljna; ljubav je iskrena. Ljubav je biti sasvim sa nekom osobom, biti tako
potpuno sa osobom da dualnost nestaje - barem na trenutke - ne postoji dualnost, jedan postoji
u dvoje, izvreno je premoavanje. Ljubav je iskrena, nikada ozbiljna. Kad god moete
staviti svoje ukupno bie u neto, to postaje ljubav. Ako ste batovan i volite, vi unosite celo
svoje bie u to. Onda se iskrenost deava.
Iskrenost ne moete kultivisati. Ozbiljnost moete kultivisati, ali iskrenost ne.
Iskrenost je senka totalnog postojanja u neemu. Patanjali kae:
Uspeh je blii onima iji su napori intenzivni i iskreni.
Naravno, nije nuno rei intenzivni i iskreni. Iskrenost je uvek intenzivna. Zato onda
Patanjali kae intenzivni i iskreni (napori)? Iz odreenog razloga. Iskrenost je uvek
intenzivna, ali intenzivnost nije uvek nuno iskrena. Vi moete biti jaki u neemu, ali ne i
iskreni, moete da ne budete iskreni. Stoga on dodaje blie odreenje, intenzivno i iskreno, jer
moete biti jaki ak i u vaoj ozbiljnosti. Moete biti jaki samo sa delom svoga bia, moete
biti moni u odreenoj sklonosti, moete biti intenzivni u svojoj ljutnji, vi moete biti estoki
u svojoj poudi, moete biti intenzivni u milionima stvari a da ne budete iskreni, jer iskrenosti
pripadate kada ste totalno u tome.
Moete biti moni u seksu, a moete da ne budete iskreni, jer seks nije nuno i ljubav.
Moete biti vrlo, vrlo estoki u svojoj seksualnosti - ali kada je jednom seksualnost
zadovoljena, ona je okonana, estina nestaje. Ljubav moe da ne izgleda tako jaka, ali je
iskrena - a stoga to je iskrena, snaga joj je trajna. Zapravo, ako ste stvarno u ljubavi to
postaje bezvremeno. To je uvek jako. Nainite jasnu razliku: ako ste jaki bez iskrenosti, ne
moete biti zauvek jaki. Samo trenutno moete biti moni; kada se elja probudi vi ste moni.
To nije zaista vaa mo. To je iznueno eljom.
Seks se pojavi. Vi oseate glad, udnju. itavo telo, itava bioenergija trai
oslobaanje; vi postajete moni. Ali ta snaga nije vaa; to uopte ne dolazi iz vaeg bia. To je
samo iznueno od biolokog omotaa oko vas: to se telo namee vaem biu. To ne dolazi iz
centra. To je nametnuto sa periferije. Vi ete biti jaki, a onda kada je seks izvren, mo
nestaje, onda ne marite za enu.
Mnoge ene su mi rekle kako oseaju da su obmanute, oseaju da su prevarene,
oseaju se iskoriene, jer kad god vode ljubav s muevima, u poetku kad oseaju da su tako
zaljubljeni, tako jako oseajni; srene su. Ali onog momenta kada se seks zavri, oni se
okreu i odlaze da spavaju. Uopte ne mare ta se dogaa sa enom. Nakon voenja ljubavi,
vi ak ne kaete ni do vienja, i ne zahvalite se; ena se osea iskorienom.
Vaa snaga je bioloka, telesna; nita ne dolazi iz vas. U seksualnoj snazi postoji
predigra, ali ne i "igra" posle ina. Ta re stvarno ne postoji. Video sam hiljade napisanih
knjiga o seksu; re "afterplay" ne postoji. Koji je to tip ljubavi? Telesna potreba je ispunjena,
okonana. ena je bila iskoriena, sada je moete odbaciti kao kada upotrebite neto a onda
odbacite - na primer, plastinu ambalau - iskoristite, a onda bacite. Zavreno! Kada se elja
probudi, onda opet gledate enu, i za tu enu ste jako strastveni.
148
Ne, Patanjali ne misli na taj tip snage. Uzeo sam seks da bih vam objasnio, jer je to
jedina snaga, strast, koja je preostala u vama. Nije mogu drugi primer. Vi ste postali tako
mlaki u svom ivotu, postojite na tako niskom nivou energije da ne postoji silina. Jedva idete i
na posao. Samo stanite na uglu ulice dok ljudi ure na posao; posmatrajte samo njihova lica -
sanjiva.
Kuda idu? Zato idu? Izgleda kao da nemaju nigde drugde da odu, stoga odlaze na
posao. Nema im pomoi; jer ta e raditi kod kue? Stoga odlaze na posao, dosadno,
automatski, poput robota, odlaze jer svako ide na posao i vreme je za odlazak. ta da se ini
ako ne elite da idete? Odmori postaju takva patnja, nema siline. Vraajui se natrag -
pogledajte ljude uvee; vraaju se natrag kuama ne znajui zato se ponovo vraaju, ali
nemaju gde da odu, ivot se na neki nain vue. Ispoljavaju samo mlakost i slabu energiju.
Zbog toga sam uzeo primer seksa - jer ja ne mogu nai neku drugu snagu u vama. Vi
ne pevate, ne pleete, nemate nikakvu mo. Vi se ne smejete, ne plaete. Sva snaga je nestala.
U seksu, malo snage ima; a to je takoe zbog prirode - ne od vas.
Patanjali kae: "snano i iskreno". Religija je zaista kao seks - dublja nego seks, via
nego seks, svetija nego seks, ali slina seksu. To je ovekov individualan susret sa celinom: to
je duboki orgazam. Vi se stapate sa celinom, potpuno nestajete. Molitva je kao ljubav. Joga, u
stvari, sama re "yoga" znai susretanje, sjedinjavanje, susret dvoje - tako dubok, snaan i
iskren susret da dvoje nestaju. Granice postaju nejasne i samo jedno postoji. To se ne moe
dogoditi ni na jedan drugi nain. Ako niste iskreni i jaki, ako ne dajete vae totalno
postojanje. Samo onda je mogue najvie. Morate potpuno uloiti celog sebe, manje od toga
nee delovati.
Izgledi za uspeh variraju prema stepenu nastojanja.
Ovo je jedan put - put volje. Patanjali se u osnovi bavi stazom volje, ali on zna, on je
svestan, da druga staza takoe postoji, stoga on daje jednu fusnotu.
Ta fusnota je:
Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Samo jedna fusnota, samo da naznai da druga staza takoe postoji. Ovo je staza volje
- intenzivan trud, iskren, potpun. Daj svoju celovitost tome. Ali Patanjali je svestran; svi oni
koji znaju, jesu svestrani. Patanjali je vrlo obazriv, on je vrlo nauan um; nee ostaviti
nijednu sitnicu. Iako to nije njegova staza, stoga on jednostavno daje fusnotu samo da podseti
da druga staza postoji.
Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Trud ili predanost, meutim, osnovna stvar je ista: potrebna je celovitost. Staze se
razlikuju. Ali se ne mogu potpuno razlikovati. Njihov oblik, njihov pravac moe da se
razlikuje, ali njihovo unutranje znaenje i vanost treba da ostane isto jer oboje vode do
boanskog. Trud trai vau celovitost. Predanost takoe zahteva vau celovitost. Tako za
mene postoji samo jedna staza, a to je: dajte svoju celovitost.
Bilo da je dajete kroz trud - jogu - to zavisi od vas, ili je dajete kroz samarpan -
predanost - to zavisi od vas. Ali zapamtite da je totalnost uvek potrebna; morate uloiti sebe
potpuno. To je igra - kockanje s nepoznatim. A niko ne moe rei kada e se to dogoditi -
niko ne moe predvideti, niko vam ne moe dati garanciju. Vi se kockate. Moete pobediti,
moete izgubiti. Mogunost da ne pobedite je uvek prisutna jer je to vrlo sloen fenomen. To
nije jednostavno kao to izgleda. Ali ako se stalno kockate, to se mora desiti jednog dana.
Ako ne postignete cilj odjednom, nemojte biti snudeni, jer ak i Buda je bio prinuen
da ne postigne cilj mnogo puta. Ako ne postignete cilj, samo ustanite i odluite se da ponovo
rizikujte. Ponekad, na neki nepoznat nain, itava egzistencija se angauje da vam pomogne.
Ponekad na neki nepoznat nain, vi pogaate cilj tano i u pravo vreme kada su vrata bila
otvorena. Ali morate pogaati mnogo puta. Stalno bacajte svoje strele svesnosti. Ne brinite o
rezultatu. Vrlo je mrano i cilj nije odreen, on nastavlja da se menja. Tako da vi nastavljate
da bacate svoju strelu u mrak. Mnogo puta ete promaiti, a ja vam kaem, ne budite
potiteni. Svako promai mnogo puta, tako je to. Ali ako s tim nastavite i ne budete potiteni,
149
to e se dogoditi. To se uvek dogaalo. Zbog toga je potrebno beskonano strpljenje.
ta je predavanje Bogu? Kako se moete predati? Kako e predanost postati mogua?
To takoe postaje mogue ako ulaete velike napore, a nastavljaju se neuspesi. Vi inite
mnoge napore, zavisite od samog sebe; napor zavisi od samog sebe. To je snaga volje - staza
volje. Vi zavisite od sebe. Vi padate, padate i padate. Ustanete, opet padnete, ustanete opet, i
ponovo ponete da hodate. I dolazi trenutak posle silnih neuspeha kada uviate da je sam va
napor uzrok neuspesima, jer va napor je postao va ego.
To je problem staze volje. Jer ovek koji radi na stazi volje - ulae napore, metode,
koristi tehnike, radi ovo i ono - prinuen je da akumulira odreen oseaj "ja sam". "Ja sam
vii, nadmoniji, poseban, izuzetan. Ja radim ovo i ono - odricanje, post, sadhanu. Toliko toga
sam uradio."
Na stazi volje ovek mora biti vrlo, vrlo oprezan prema egu, jer ego e obavezno
izbiti. Ako moete posmatrati ego, a da ne akumulirate ego, nije nuno predavati se - jer ako
nema ega, nema ta da se predaje. Ovo treba shvatiti vrlo, vrlo duboko. A kada to razumete -
pokuajte da razumete Patanjalija - to vrlo je bitna stvar.
Ako za mnogo ivota neprekidno ulaete svoj napor, ego je prinuen da se pojavi.
Morate biti vrlo paljivi. Treba da radite, treba da ulaete velike napore, ali nemojte gojiti
ego. Onda nema potrebe za predavanjem, moete pogoditi cilj bez predavanja. Nema potrebe
jer bolest ne postoji.
Ako je ego prisutan, onda se javlja potreba za predavanjem. Zbog toga Patanjali kae
- nakon govora o snanom, iskrenom totalnom naporu, on iznenada kae -
Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Ako konstantno ne uspevate, onda zapamtite da neuspeh nije zbog boanskog.
Neuspeh se deava zbog vaeg ega, odakle je strela baena, iz izvora vaeg bia, tamo se
neto dogaa - diverzija. Ego se sakuplja tamo. Onda postoji samo jedna mogunost: predajte
ga! Niste imali uspeha s njim totalno, na toliko mnogo naina. inili ste ovo i ono, pokuavali
ste da uradite ovo i ono, i niste uspevali, podbacili ste, i niste postigli cilj. Kada razoarenje
postane konano i ne znate ta da inite, Patanjali kae: "Sada, predajte se Bogu."
Patanjali je vrlo izuzetan u ovom smislu. On ne veruje u Boga; on nije boji vernik.
Bog je takoe tehnika. Patanjali ne veruje ni u jednog Boga, da postoji neki Bog. Ne, on
kae Bog je metod. Oni koji nisu uspeli, za njih je ovaj metod - poslednji. Ako ne uspete ni u
tome, tada nema vie naina. Patanjali kae da to nije pitanje da li Bog postoji ili ne; uopte
nije stvar u tome. Stvar je u tome da je Bog hipoteza, pretpostavka. Bez Boga bilo bi teko
predati se. Pitaete: "Kome?"
Stoga Bog je upravo hipotetika stvar, ideal koji jednostavno treba da pomogne
predavanju. Kada se budete predali znaete da nema Boga, ali to se deava kada ste se predali
i kada ste spoznali. Za Patanjalija ak i Bog je hipoteza, pretpostavka da vam se pomogne.
To je samo fiktivni ideal. Zbog toga sam vam rekao da je Patanjali lukav uitelj. To je samo
da bi vam se pomoglo. Predanost je osnovna stvar, ne Bog. Ovu razliku morate zapaziti, jer
postoje ljudi koji misle da je Bog osnovna stvar - zato to ima Boga, vi se predajete.
Patanjali kae da zato to se morate predati, pretpostavljate Boga. Bog je
pretpostavljena stvar. Kada se budete predali, smejaete se. Ne postoji Bog. Zapravo: postoje
bogovi - ne Bog - mnotvo bogova, jer kad god se predate vi postajete Bog. Nemojte biti
zbunjeni sa Patanjalijevim Bogom i judeo-hrianskim Bogom. Patanjali kae: Bog je
potencijalnost svakog bia. ovek kao da je seme Boga - svaki ovek. A kada seme procveta,
doe do ispunjenja, postalo je Bog. Dakle, svaki ovek, svako bie, postae na kraju Bog.
43
"Bog" oznaava upravo najvii vrhunac, krajnje cvetanje. Ne postoji Bog, ali ima
bogova - beskonano bogova.
44
Ovo je potpuno razliita koncepcija. Ako pitate muslimane,
43
Takvo je bilo i uenje izvornog hrianstva, gnosticizma, da se Bog ispoljava kroz oveka. Zato je ono
uniteno od strane institucionalne religije, hrianske crkve u Rimu koja je nametnula mentalitet grenosti i rtve
ljudima da bi bili pokoreni.
44
Stav da ima mnogo bogova ne negira Boga, on upravo potvruje da je sve boansko, da je Bog u svemu.
150
oni e rei da postoji samo jedan Bog. Ako pitate hriane, oni e takoe rei da postoji samo
jedan Bog. Meutim, Patanjali je vie nauan. On kae Bog je mogunost. Svako nosi tu
mogunost unutar srca. Svako je samo seme, potencijalnost da postane Bog. Kada doprete do
najvieg, izvan kojeg nita ne postoji, vi postajete Bog.
45
Mnogi su postigli to pre vas, mnogi
e postii posle vas.
Svako na kraju postaje Bog, jer svako je potencijalno Bog, beskonano bogova. Zbog
toga je hrianima postalo teko da to shvate. Vi zovete Ramu bogom, vi nazivate Krinu
bogom, zovete Budu bogom, vi nazivate Mahaviru bogom. ak i Radnea nazivate bogom.
Za hrianina je to postalo nemogue da se razume. ta to radite? Za njih postoji samo
jedan Bog koji je stvorio svet. Za Patanjalija niko nije stvorio svet. Milioni bogova postoje, i
svako je na putu da postane Bog. Bilo da vi to znate ili ne, vi nosite Boga u svojoj utrobi.
Moete da ne primetite to mnogo puta, ali kako to na kraju moete propustiti? Ako nosite to u
sebi, jednog dana seme e procvetati. Ne moete to potpuno da propustite - ne.
Ovo je totalno razliita koncepcija. Hrianski Bog izgleda kao diktator, dominira
itavom egzistencijom. Patanjalijev je vie demokrata - nije despot, nije diktator, nije Staljin,
nije car koji sedi na najviem tronu, sa svojim jedino roenim sinom Hristom sa strane i
apostolima okolo. To je besmislica. itav koncept kao da je nainjen prema liku imperatora
na prestolu. Ne, Patanjali je apsolutno demokrata. On kae da je boanstvenost svaiji
kvalitet. Vi nosite to; od vas zavisi da li ete ga dovesti do njegove potpunosti. Ako ne elite,
to je takoe na vama.
Niko ne sedi kao despot nad svetom; niko vas ne prisiljava ili stvara. Sloboda je
apsolutna. Vi moete greiti zbog slobode, moete se udaljavati od boanskog zbog slobode.
Vi patite zbog slobode, a kada to razumete, nije potrebno da patite; moete se vratiti natrag, to
je takoe usled slobode. Niko vas ne vraa natrag, i nee biti sudnjeg dana. Nema nikog da
vam sudi, izuzev vaeg vlastitog bia. Vi ste poinilac, vi ste sudija, vi ste kriminalac, vi ste
zakon. Vi ste sve! Vi ste minijaturna egzistencija.
46
Bog je uzvieni ideal. On je zapravo individualna jedinica boanske svesti. On je
netaknut od nesrea ivota, delovanja i rezultata delovanja.
Bog je stanje svesti. To nije osoba, zaista, ali je "individualan", tako da ete morati da
razumete razliku izmeu linosti i individualnosti. Linost je spoljna povrina tela. Kako vi
izgledate drugima, to je vaa linost. Vi kaete: "Prefinjena linost, lepa linost, runa linost"
- kako vi izgledate drugima. Vaa linost je izbor, miljenje drugih o vama. Ako ste sami na
zemlji, hoete li imati ikakvu linost? Nikakvu linost, jer ko e rei da ste lepi, ko e rei da
ste glupi, i ko e rei da ste veliki voa ljudi? Nema nikoga da kae bilo ta o vama. Miljenje
nee postojati, neete imati nikakvu linost.
Re linost dolazi od grke rei persona. U grkoj drami, glumci su koristili maske.
Ove maske su se zvale persona. Od te persone dolazi re personality (linost). Lice koje
nosite kada gledate u svoju enu i osmehujete se, to je linost - persona. Vi se ne oseate tako
da biste se smekali, ali morate da se osmehujete. Gost doe i vi mu iskaete dobrodolicu, a
duboko ispod nikada niste eleli da vam doe, duboko dole vi ste uznemireni - "ta sada da
radim s ovim ovekom?" - ali se osmehujete, iskazujete dobrodolicu i govorite: "Tako sam
radostan".
Linost je ono to vi postavljate, grimasa koju stavljate na lice, maska. Ali ako nema
nikoga u vaem kupatilu, nemate nikakvu linost dok ne pogledate u ogledalo. Onda odmah
linost dolazi jer vi sami poinjete da vrite rad drugog miljenja. Gledate u lice i kaete,
"Lepo". Sada ste podeljeni, sada ste vi dvoje, dajete miljenje o sebi. Inae u kupatilu kada
nema nikoga, a vi se uopte ne plaite da vas neko posmatra kroz kljuaonicu... Jer ako neko
gleda kroz kljuaonicu, linost ulazi unutra, vi poinjete da se ponaate na odreen nain.
Koncept jednog Boga zapravo izdvaja i otuuje boansko od postojanja. Koncept jednog Boga odvaja oveka od
Boga, dok ga koncept mnotva bogova spaja sa boanskim kroz samu egzistenciju.
45
Tanije reeno: Bog je prestao da zamilja da je ovek.
46
Mikrokosmos.
151
Samo u kupatilu vi odbacujete linost. Zbog toga je kupatilo tako osveavajue. Iz
kupanja izlazite tako lepi, svei, bez linosti; postajete individua. Individualnost je ono to vi
jeste; linost je ono to vi pokazujete da jeste. Linost je vae lice, individualnost je vae bie,
bivanje. Bog u Patanjalijevoj koncepciji, nema linost. On je jedna individualna jedinica.
Kada sazrite, postepeno, miljenje drugih postaje detinjasto. Ne brinete o njima;
beznaajno je ta oni kau. Ono to oni kau nije to to nosi znaenje. To ste vi, ono to vi
jeste nosi znaenje, ne ono ta oni kau, "Lepo". To je beskorisno. Ako ste lepi, to je glavna
stvar. ta oni kau je nevano. ta vi jeste - stvarno, autentini vi - to je vaa individualnost.
Kada odbacite linost, vi postajete sannyasin, postajete individualna jedinica. Sada
ivite kroz svoj pravi centar. Ne pozirate. Kada ne pozirate, niste zabrinuti. Kada ne pozirate,
vi ste nedirnuti onim to drugi kau. Kada ne pozirate, ostajete izdvojeni, nepristrasni. Linost
ne moe ostati nepristrasna. To je vrlo krhka stvar. To postoji izmeu vas i drugog, i to zavisi
od drugog. On se moe predomisliti, moe vas potpuno unititi. Pogledate enu koja se smei,
i oseate se lepo zbog njenog smeka. A ako se ona jednostavno preobrati sa mrnjom u
svojim oima, vi ste jednostavno smodeni. Zapravo, vi ste smodeni jer je vaa linost
baena pod noge. Ona vas je pregazila, ak ne eli ni da vas pogleda.
Svakog momenta se bojite da neko moe slomiti vau linost. Onda ceo svet postaje
jedna briga. Bog ima individualnost, ali ne linost. ta god da on jeste, to je ono to on
pokazuje. ta god da je on unutra, on je spolja. Zapravo, unutra i spolja nestaju za njega.
Bog je uzvieni ideal.
Na engleskom je to prevedeno: bog je vrhovni vladar. Zbog toga kaem da postoji
nerazumevanje o Patanjaliju. Na sanskritu on ga naziva purua-viea - vrhovno bie, ne
vladar. Ja bih voleo da prevedem "Bog" kao "najvii, vrhovni". On je individualna jedinica
boanske svesti - individualna, ne univerzalna, jer Patanjali kae svaka individua je
boanska.
47
On je netaknut od nesrea ivota, delovanja i rezultata delovanja.
Zato? Jer to vie postanete individua, vie ivot uzima razliit kvalitet. Nova
dimenzija se otvara - dimenzija igre. to se vie bavite s linou i spoljanjim, ljuskom,
periferijom... Vaa dimenzija ivota je dimenzija rada: zabrinuti oko rezultata, zabrinuti o
tome da li ete dostii cilj ili ne, uvek zabrinuti da li e vam stvari pomoi ili ne, ta e se
dogoditi sutra.
ovek iji je ivot postao igra ne brine se za sutra, jer on postoji samo danas. Isus
kae: "Pogledajte ljiljane. Tako su lepi," jer za njih ivot nije rad. Pogledajte reke, pogledajte
zvezde. Izuzev oveka, sve je lepo i sveto jer itava egzistencija je igra. Niko se ne brine oko
rezultata. Da li se drvo brine hoe li e cvetovi doi ili ne? Da li se reka brine hoe li dostii
okean ili ne? Izvan oveka, ne postoji briga. Zato je ovek zabrinut? Zato to gleda ivot kao
rad, a ne kao igru - a itava egzistencija je igra.
Patanjali kae: kada ovek postane usredsreen u sebi, on postaje igra; on se igra.
ivot je igra i to je lepo; nije potrebno brinuti o rezultatu. Rezultat nije vaan, to je
jednostavno nevano. Stvari koje radite same po sebi imaju vrednost. Ja vam govorim; vi me
sluate. Ali vi sluate sa svrhom, a ja govorim bez cilja. Vi sluate sa svrhom, jer kroz
sluanje vi elite da postignete neto - neko znanje, neka reenja, neke tehnike, metode, neko
razumevanje, a onda ete otii da ih odradite. Vi ste za rezultat. Ja vam govorim bez cilja. Ja
jednostavno uivam.
Ljudi me pitaju: "Zato nastavlja da govori svakog dana?" Ja uivam, to je isto kao
to ptice pevaju. Kakva je svrha? Pitajte ruu zato nastavlja da cveta? Koja je svrha? Ja vam
govorim jer ovo deljenje mene samog s vama je samo po sebi vrednost, to ima sutinsku
47
U originalnom tekstu Joga sutri stoji: purua viea ivarah. Znai da Patanjali postoveuje uzvieni (viea)
boanski ideal, Ivara, sa puruom, transcendentalnom individualnou, koja je ujedno i sutina ovekova. O
purui videti u knjizi Sankhya. Inae teorija sankhye je osnova Patanjaalijeve joge.
152
unutarnju vrednost. Ja ne traim rezultat; nisam zabrinut da li ete vi biti preobraeni kroz ovo
ili ne. Ne postoji zabrinutost. Ako me sluate, to je sve. Ako ni vi niste zabrinuti, onda se
preobraaj moe dogoditi upravo ovog trenutka. Zato to ste zabrinuti kako ete to iskoristiti -
bilo ta to kaem, kako da koristite to, ta da se radi oko toga... Vi ste ve u budunosti. Vi
niste ovde; ne uestvujete u igri. Vi ste u radionici ili na seminaru. Ne uestvujete u igri.
Razmiljate da dobijete neke rezultate iz toga, a ja sam potpuno beskoristan. Tako ja delim
sebe s vama. Ja ne govorim da se radi neto u budunosti: ja govorim jer se upravo sada, kroz
ovo deljenje, neto deava, i to je dovoljno.
Zapamtite rei: "sutinska unutarnja vrednost", i nainite svaki svoj in jednom
sutinskom unutarnjom vrednou. Ne brinite oko rezultata - jer onog trenutka kada
razmiljate o rezultatu, ta god da inite postaje sredstvo, a cilj je u budunosti. Nainite
sredstva sama sebi ciljem; nainite stazu ciljem. Nainite upravo ovaj trenutak najviim; ne
postoji nita izvan njega. Ovo je stanje Boga i kad god igrate, vi imate odsjaj tog stanja.
Deca se igraju, i ne moete nai nita boanstvenije od dejeg igranja. Otuda Isus
kae: "Dok ne postanete kao deca, neete ui u carstvo Boije." Postanite slini deci.
Znaenje nije da postanete detinjasti, jer da se bude detinjast jedna je stvar, a da se bude slian
deci totalno je razliita stvar. Detinjasto treba da bude odbaeno. To je mladalako, nezrelo.
Treba da se poveava slinost deci. To je nevinost - besciljna nevinost. Traenje koristi
donosi otrov; rezultat vas truje. Onda je nevinost izgubljena.
Bog je vrhovni. On je individualna jedinica boanske svesti. On je netaknut od nesrea
ivota, delovanja i rezultata delanja.
Moete postati Bog upravo sada jer ste ve to - samo stvar treba da se realizuje, shvati.
Vi ste ve ono to mislite da treba da budete.
48
Nije potrebno da izrastete u Boga. Zaista, treba
da shvatite da ste ve to. Ovo se dogaa kroz predanost.
Patanjali kae: verujte u Boga, imajte poverenje u Boga tamo, negde, visoko u
univerzumu, na vrhu, i predajte se. Taj Bog je samo oslonac, pomaga koji pomae
predavanje. Kada se predavanje dogodi, vi postajete Bog, jer predavanje znai: "Sada se ne
bavim rezultatom, ne interesujem se za budunost, ne brinem se za sebe uopte. Ja se
predajem."
Kada kaete: "Ja se predajem", ta se predaje? 'Ja' - ego. A bez ega kako moete
misliti o svrsi, rezultatu? Ko e misliti o tome? Onda se preputate. Onda idete gde god to
vodi. Sada itava volja odluuje; vi ste se predali svojoj odluci. Patanjali kae da postoje dva
puta. Uinite napor totalnim. Ako ne akumulirate ego, onda taj totalni napor e postati
predanost u sebi. Ako akumulirate ego, onda postoji put: predanost Bogu.
U Bogu seme je razvijeno do svog najvieg opsega.
Vi ste seme, Bog je manifestacija. Vi ste seme, a Bog je ostvarenje. Vi ste
potencijalnost, on je aktuelnost. Bog je vaa sudbina, i vi nosite tu svoju sudbinu ve mnogo
ivota, a ne vidite je, jer vae oi su fiksirane negde u budunost. One ne gledaju u sadanjost.
Ovde i sada sve je kao to treba da bude ako ste spremni da gledate. Nita nije potrebno;
nikakvo injenje nije potrebno. Egzistencija je savrena svakog pojedinog trenutka. Ona
nikada nije bila nesavrena, to ne moe da bude. Da je bila nesavrena, kako bi onda postala
savrena? Ko bi je onda nainio savrenom?
Egzistencija je savrena; uopte nita nije potrebno da se uradi. Ako ovo razumete,
predanost je onda dovoljna. Nema napora, nema pranayame, nema bhastrike, nema
shirshasane, nema yoga asana (poloaja), nema meditacije, niega, ako razumete ovo - da je
egzistencija savrena kakva jeste. Pogledajte unutra, pogledajte spolja: sve je tako savreno da
nita ne moe da se uradi osim slavljenja. ovek koji se predaje zapoinje slavlje.
48
I samim miljenjem o tome odvajamo se od onoga to jesmo ovde i sada, projektujemo se u vreme, nae
"ostvarenje" je vazda u budunosti. Otuda nunost transcendencije uma.
153
Poglavlje 4
NAI UVEK PRISUTNI CVET
Izlaganje 4. januara 1975. pre podne u Buddha dvorani.
Prvo pitanje:
Molimo vas, objasnite kako seme moe procvetati bez vremenskog razmaka.
Seme moe procvetati bez procepa, bez vremenskog razmaka, jer seme ve cveta. Vi
ste ve ono to postajete. Da nije tako, onda se seme upravo sada ne bi moglo razviti u cvet.
Onda bi vreme bilo potrebno. Onda zen ne bi bio mogu. Onda bi samo Patanjali bio
put. Ako treba da postanete neto, nuan e biti proces vremena. Ovo je poenta koju treba
razumeti: svi oni koji su spoznali, takoe su spoznali da je takvo postajanje tokom vremena
san. Vi ve postojite; savreni ste kakvi jeste.
49
Nesavrenstvo se javlja kada ste vrsto uspavani. Cvet ve cveta; samo su vae oi
zatvorene. Ako seme nije stiglo do cvetanja, onda e mnogo vremena trebati, a to nije obian
cvet: Bog e da se rascveta u vama. Onda ak ni venost nee biti dovoljna, onda je to gotovo
nemogue. Ako tek treba da procvetate, onda je to gotovo nemogue. To se nee dogoditi; to
se ne moe dogoditi. Bie potrebna venost.
Ne, nije u tome stvar. To se moe dogoditi upravo sada, ba ovog trenutka. ak ni
jedan trenutak ne mora da bude izgubljen. Nije stvar u tome da seme postaje cvet. Stvar je u
otvaranju oiju. Vi moete sada odmah otvoriti svoje oi, i onda ete otkriti da cvet uvek
cveta. Nikada to nije bilo drugaije; nikada nije moglo biti drugaije.
50
Bog je uvek prisutan u vama; samo pogled i on je manifestovan. Nije on bio skriven u
semenu; vi niste gledali u to. Dakle, samo toliko je potrebno - da pogledate u to. ta god da
ste vi, pogledajte u to, postanite svesni toga. Ne kreite se kao mesear.
Zbog toga je saopteno da su se mnogi zen majstori grohotom smejali kada su postali
probueni. Njihovi uenici nisu mogli razumeti, njihovi saputnici nisu mogli razumeti ta se
dogodilo. Zato ludo urliu? emu taj smeh? Oni su se smejali zbog opte besmislenosti.
Traili su ono to su ve bili, trali su za neim to je ve bilo u njima; traili su neto negde
drugde to je bilo skriveno u samom tragaocu.
Tragalac je traen; putnik je cilj. Ne treba da stignete negde drugde. Vi samo treba da
stignete do sebe. Ovo se moe dogoditi u jednom trenutku; ak i deli trenutka je dovoljan.
Ako seme treba da postane cvet, onda venost nije dovoljna jer to je rascvetavanje Boga. Ako
ste ve Bog, onda samo pogledajte natrag, pogledajte unutra, tada se to moe dogoditi.
Onda emu Patanjali? Patanjali je potreban zbog vas. Vama treba toliko mnogo
vremena da izaete iz sna, treba vam toliko mnogo vremena da izaete iz vaih snova, tako
ste mnogo angaovani u snovima, toliko ste mnogo uloili u svoje snove, zbog toga je
potrebno. Vreme nije potrebno zato to seme treba da postane cvet; vreme je nuno jer ne
49
Vreme je san - san je vreme. To je sutina buenja.
50
Ovo je taan opis prirode ili pra-krti, ona je pra-datost, bezvremena suma svega to uopte moe da bude, to
je bilo i to e biti, sve se samo ispoljava iz te pra-datosti, to znai da je sve ve postojalo u njoj, nita novo ne
nastaje. Samo na um, uhvaen u snoliku iluziju vremena, doivljava to ispoljavanje kao pojedinano u
linearnom vremenskom sledu. Sam takav um izaziva to pojavljivanje. Zato vidimo trodimenzionalni svet i da se
sve odvija tokom vremena. Stvar je u probuenju. Samo u snu postoji vreme, iluzija odvojenosti, i nekog procesa
postizanja bezvremenog jedinstva. Mi smo uvek ve u njemu, ali sanjamo da nismo, da smo odvojene fizike
individue, da se stvari pojavljuju kao nove i pojedinano u naem iskustvu. Ni nae pojedinano fiziko roenje
nikada se nije ni dogodilo, samo je naa svest ula u iluziju trodimenzionalnog vremena odnosno uma. Zato i
nae buenje ili prosvetljenje nastaje samo onda kada se probudimo od iluzije vremena, kada vidimo celu prakrti
kao prakrti, kao jednovremeno ili bezvremeno Jedno, a sebe kao svesnog subjekta ili svedoka svega, puruu,
zbog koga se sve to i zbiva: radi diferencijacije svesti i/ili buenja. Svekoliko postojanje postoji samo radi
buenja.
154
moete otvoriti svoje oi. Sa zatvorenim oima ste toliko postali naviknuti, to je postala
duboka navika. Ne samo to: vi ste sasvim zaboravili da zapravo ivite sa zatvorenim oima.
Potpuno ste zaboravili to. Mislite: "O kakvoj besmislici govorite. Moje oi su ve otvorene."
A vae oi su zatvorene.
Ako ja kaem: "Izaite iz vaih snova," vi odgovarate: "Ja sam ve budan", a to je
takoe san. Vi moete sanjati da ste budni; moete sanjati da su vam oi otvorene. Onda e
trebati mnogo vremena - ne zato to cvet jo nije procvetao - ve zato to je vama tako teko
da se probudite. Ima mnogo ulaganja. Ova ulaganja moraju da se shvate. Ego je osnovno
angaovanje. Ako otvorite svoje oi, vi nestajete. Otvaranje oiju izgleda kao smrt. To i jeste.
Tako vi govorite o tome, sluate o tome, razmiljate o tome, ali nikada ne otvarate oi, jer ako
zaista otvorite oi takoe znate da ete ieznuti. Ko ete onda biti? Niko i nita. Ova
nitavnost je prisutna kada otvorite oi; stoga je bolje verovati da su oi ve otvorene, a vi
ostajete neko.
Ego je prvi koji vas obavija u san. Ego moe postojati samo dok ste uspavani, upravo
kao to snovi mogu postojati dok ste uspavani. Ego moe postojati samo dok ste uspavani -
metafiziki uspavani, egzistencijalno uspavani. Kad otvorite oi prvo vi iezavate; onda se
Bog pojavljuje: ovo je problem. Vi se bojite da ete ieznuti, ali to su ta vrata ka boanskom,
sluali ste o tome, razmiljali ste o tome, ali nastavljate da odgaate - sutra, sutra i sutra.
Zbog toga je Patanjali nuan. Patanjali kae da nije potrebno otvarati oi odmah,
ima mnogo koraka. Moete izai iz svog sna u koracima, u postepeno. Odreene stvari radite
danas, odreene sutra, onda prekosutra, i to e dugo potrajati. Patanjali privlai jer vam daje
vreme da spavate. On kae nije nuno da izaete iz spavanja odmah sada; samo okretanje e
delovati. Onda odspavajte jo malo; onda uradite neto drugo. Tako malo po malo,
postepeno...
On je sjajan nagovara. On vas nagovara da izaete iz vaeg spavanja. Zen vas
protrese da izaete iz vaeg spavanja. Zbog toga zen majstor moe da vas udari u glavu;
nikada Patanjali. Zen majstor moe da vas izbaci kroz prozor; nikada Patanjali. Zato to zen
majstor koristi ok tretman - moete udarcem biti izbaeni iz sna, dakle zato nastavljati sa
pokuajima i nagovarati vas? Zato gubiti vreme?
Patanjali vas pribliava postepeno. Izvodi vas van a da vi ak niste ni svesni ta on
radi. On radi kao majka, ali obrnuto. Majka nagovara dete na spavanje. Moe da peva
uspavanku, doputa detetu da osea da je ona tu, da ne treba da se plai. Ponavljajui stalno
isti stih, dete se osea namamljeno u san. Ono pada u san drei ruku svoje majke. Ne mora
da brine. Majka je tu i ona peva, a pevanje je lepo! Majka ne kae: "Idi da spava," jer e to
ometati odlazak u san, uznemiriti. Ona jednostavno nagovara indirektno. Onda, ubrzo izvlai
svoju ruku, pokriva dete ebetom, izlazi iz sobe, i dete je brzo uspavano.
Isto ini Patanjali u obrnutom smeru. On vas postepeno izvodi iz vaeg sna. Zbog
toga je vreme potrebno; inae cvet ve cveta. Pogledajte: on je ve tu. Otvorite oi i on je tu,
otvorite vrata i on stoji tamo ekajui vas. On je uvek tamo stajao.
To zavisi od vas. Ako elite ok tretman, onda je zen staza. Ako elite vrlo postepen
proces, onda je joga put. Birajte! U biranju ste vi takoe vrlo varljivi. Pitate me: "Kako mogu
da izaberem?" Ovo je takoe trik. Sve je jasno. Ako vam treba vreme, izaberite Patanjalija.
Ako se plaite okova, izaberite Patanjalija. Ali izaberite! Inae, ako ne izaberete, to e
postati odlaganje. Onda kaete: "Teko je izabrati", a dok ne izaberete kako se moete
pokrenuti?
ok tretman je trenutan. On vas odmah sputa na zemlju. Moje vlastite metode su ok
tretman. One nisu postepene. Sa mnom se moete nadati da postignete u ovom ivotu; sa
Patanjalijem mnogo ivota e vam trebati. Sa mnom se takoe moete nadati da postignete
ba sada, ali imate mnogo stvari da uradite pre nego to postignete.
Vi znate da e ego nestati, vi znate da e seks nestati. Tada nema mogunosti za seks,
jednom kada postignete; to postaje apsurdno, smeno. Tako vi mislite: "Jo malo. ta je
pogreno u ekanju? Pustite me da uivam jo malo."
51
Ljutnja nee biti mogua, nasilje nee
51
Mentalna vezanost i zavisnost za seks je glavni razlog neuspeha kod praktiara meditacije. Svaki centar treba
da radi svoj posao i tada je rast energije i svesti kroz centre, akre, prirodan i lak. Ali ako je rad centara pomean,
155
biti mogue, ljubomora nee postojati; posesivnost, manipulacija sve to e nestati.
Vi iznenada oseate: "Ako sve ovo iezne, ta u onda ja biti?" - jer vi niste nita do
kombinacija svega ovoga, sveanj svega ovoga, i ako sve ovo nestane, preostaje samo
nepostojanje, nitavilo. To nepostojanje vas uasava. To izgleda kao bezdan. eleli biste da
zatvorite svoje oi i sanjate jo malo, upravo kao to se ujutru probudite ali biste eleli da se
okrenete na stranu barem pet minuta i jo malo sanjate, jer to je tako lepo.
Jedne noi Mula Nasrudin je probudio svoju enu i rekao joj: "Donesi mi odmah
naoare. Imao sam tako lep san, a jo vie je obeano."
elje nastavljaju da vam obeavaju - uvek se vie obeava - i one kau: "Uradite ovo i
ono, zato da se urite kada je prosvetljenje uvek mogue? Moete ga postii bilo kada; nema
potrebe za urbom. Moete to odlagati. To je pitanje venosti, briga venosti; zato ne uivati
ovog trenutka?
Vi ne uivate, ali um kae: "Zato ne uiva ovog trenutka?" A vi nikada niste uivali;
jer ovek bez unutarnjeg razumevanja ne moe uivati ni u emu. On jednostavno pati; za
njega sve postaje patnja. Ljubav - stvar kao ljubav - on pati ak i u tome. Najlepa mogua
pojava za uspavanog oveka jeste ljubav, ali on pati ak i kroz to. Nita nije mogue bolje od
ljubavi kada ste uspavani. Ljubav je najvea mogunost, ali vi ak patite i od toga. Jer to nije
pitanje ljubavi ili neeg drugog - spavanje je patnja - tako da ta god da se dogodi, vi ete
patiti. Spavanje okree svaki san u nonu moru. To zapoinje lepo, ali neto negde uvek krene
pogreno. Na kraju stiete u pakao.
Svaka elja vodi u pakao. Kau da svaki put vodi u Rim - ne znam, ali u jednu stvar
sam siguran: svaka elja vodi u pakao. U poetku elja vam daje mnogo nade, snove: to je
trik. Tako vi bivate uhvaeni. Ako bi elja od samog poetka rekla: "Budi paljiv, ja te vodim
u pakao," vi je ne biste sledili. elja vam obeava raj, obeava: "Samo nekoliko koraka i vi
ete to dostii; samo doite sa mnom" - zavodi vas, hipnotie i obeava vam mnoge stvari, a
vi bivajui u patnji, mislite: "ta je pogreno pokuati? Kuajmo malo i ovu elju takoe."
To e vas takoe voditi u pakao jer sama elja kao takva jeste put do pakla. Otuda
Buda kae: "Dok ne postanete bez elja, ne moete biti blaeni." elja je patnja, elja je san, i
elja postoji samo kada ste beivotni, uspavani. Kada ste budni i ivahni, elje vas ne mogu
obmanuti. Onda vidite skroz, onda je sve tako jasno da ne moete biti obmanuti. Kako novac
moe da vas obmane i kae da ete biti vrlo, vrlo sreni kada ima novca? Onda pogledajte
bogate ljude: oni su takoe u paklu - moda u bogatom paklu, ali to ne ini razliku. Bogatiji
pakao e biti gori od siromanog pakla. Sada su oni stekli novac, i jednostavno su u stanju
stalne nervoze.
Mula Nasrudin je sakupio veliko bogatstvo, a onda je otiao u bolnicu jer nije mogao
spavati. Bio je nervozan i stalno je drhtao i bojao se, ali ne neega odreenog. Siromaan
ovek se boji neega odreenog; a bogat ovek se jednostavno boji. Ako se bojite neega
odreenog, neto se moe uraditi. Ali on se jednostavno plaio, nije znao zato, jer je imao
pa je centar seksa, umesto da je tamo gde prirodno jeste, zapravo u glavi, u umu, onda se dogaa perverzija
seksualnosti, tada, zbog umeanosti mate i uma u seks, postaje mogue da bude seksualno privlano i ono to
prirodno nije (pornografija, homoseksualnost, zoofilija itd.). Seksualnost je sastavni deo bioloke ili organske
reprodukcije kroz magnetizam polova. Sav organski svet ima svoju svrhu. Svrha mu je raanje celovitog i
probuenog oveka. Za takvog oveka je nemogue da se vraa nazad u organske procese iji je smisao bio
njegova pojava. Kao to novoroeno dete ne moe da se vrati natrag u majinu utrobu, tako ni probueni ovek
ne moe da se vrati natrag u seksualnost. On je potpun u sebi i nita mu ne nedostaje. Pojava bilo kakve elje je
pokazatelj da nismo potpuni i celoviti, da ne ivimo u istinskom smislu, pa nam je zato potrebno neto da nas
oivi i upotpuni.
U kasnijim govorima ove knjige Osho objanjava sutinu seksualne zavisnosti upravo kao vezanost
detinjeg uma za majinu utrobu, kao infantilnu tenju za povratkom u nju. Smo telo je proizvod seksualnosti i
celo je seksualno. Otuda je identifikacija sa telom (egom) osnovni uzrok identifikacije sa seksom i zavisnosti od
seksa. Nema osloboenja od identifikacije sa telom, umom i egom bez prestanka identifikacije sa seksom.
Prestanak jedne identifikacije prirodno i automatski vodi do prestanka druge. Bez ikakvog potiskivanja i
odricanja. Zapravo pojava bilo kakvog potiskivanja i odricanja (svejedno da li prvo od seksa, ili od tela ega i
uma) pokazatelj je lanog prestanka identifikacije i vodi u daljni poremeaj rada centara. Tada ovek upada u
teku i komplikovanu situaciju da sanja da je budan i svestan, racionalizuje i opravdava svoju vezanost za seks
dok misli da je budan, svestan sebe i nezavisan od tela i uma.
156
sve; nije bilo potrebno da se boji; ali se jednostavno plaio i drhtao.
Otiao je u bolnicu, a za doruak su mu doneli nekoliko stvari, a meu tim stvarima
bila je posuda sa "drhtavim" elatinom. On je rekao: "Ne, ne mogu jesti ovo." Doktor je pitao:
"Zato ste tako nepokolebljivi u vezi s tim?" On je rekao: "Ne mogu jesti nita to je
nervoznije od mene!"
Bogat ovek je nervozan. Kakva je njegova nervoza, njegov strah? Zato se on tako
plai. Iako je svaka elja ispunjena, jo ostaje frustracija. Sada on ne moe ak ni da sanja, jer
je proao kroz sve snove; oni ne vode nikuda. Ne moe sanjati i ne moe sakupiti hrabrost da
otvori oi takoe, jer postoje angaovanja, uplitanja. On je obeao mnoge stvari u svom snu.
One noi kada je Buda naputao svoju palatu, eleo je da kae svojoj eni: "Ja
odlazim." eleo je da dodirne dete koje se upravo prethodnog dana rodilo, jer se vie nee
vraati. Priao je samo do vrata sobe. Pogledao je enu. vrsto je spavala, mora da je sanjala;
lice joj je bilo lepo, osmeh, dete u njenim rukama. Saekao je nekoliko sekundi na vratima;
onda se okrenuo. eleo je da kae neto; ali onda se uplaio. Ako bi neto rekao, onda bi ena
bila prinuena da plae, jadikuje i pravi scenu.
On se bojao sebe takoe, jer ako ona plae i jadikuje, onda moe postati svestan svojih
vlastitih obeanja: "Ja u te voleti zauvek, i biu s tobom stalno i veno." A ta je sa ovim
detetom koje se prethodnog dana rodilo? Ona bi naravno iznela dete pred mene, i rekla bi:
"Vidi ta si mi uinio. Onda zato ti se rodilo ovo dete? A sada ko e biti njegov otac? Jesam
li ja sama odgovorna za njega? Da li bei kao kukavica?" Dole bi mu sve ove misli, jer u
spavanju svako obeava. Svako nastavlja da obeava ne znajui kako e ispuniti obeanja, ali
u spavanju to se deava, jer niko nije svestan ta se deava.
Iznenada je postao svestan da e sve ove stvari nastupiti a onda e se porodica sakupiti
- otac i svi ostali - a on je samo sin, a otac oekuje od njega, u svom snu on je obeao njemu
takoe. Onda je on jednostavno pobegao; jednostavno je pobegao kao lopov.
Posle dvanaest godina, kada se vratio natrag, prva stvar koju ga je ena pitala bilo je
da li mu je ona pala na um one noi kada je odlazio. Pitala je: "Zato mi nisi rekao? Prva stvar
koju eli da pitam - a ekala sam te ovih dvanaest godina - zato mi nisi rekao? Kakva je to
vrsta ljubavi? Jednostavno si me napustio. Ti si kukavica."
Buda je sluao smireno. Kada je ena uutala on je rekao: "Sve te misli su mi dole.
Doao sam do vrata, ak sam ih i otvorio. Pogledao sam te; u snu sam ti obeao mnoge stvari.
Ali ako u postati budan, ako izlazim iz spavanja, onda ne mogu odrati obeanja data u snu.
Ako pokuam da odrim obeanja, onda se ne mogu probuditi."
"Dakle, ti si u pravu. Moe misliti da sam kukavica; moe misliti da sam pobegao iz
palate kao lopov, ne kao ratnik, ne kao hrabar ovek. Ali ja ti kaem, sasvim je obrnut sluaj,
jer kada sam beao, za mene u tom momentu, bio je trenutak najvee hrabrosti jer itavo moje
bie je govorilo: Ovo nije dobro. Ne budi kukavica. A da sam se zaustavio, da sam sluao
moje uspavano bie, onda za mene ne bi bilo mogunosti da se probudim."
"A sada sam doao k tebi; sada mogu ispuniti neto, jer samo ovek koji je prosvetljen
moe ispuniti. ovek koji je neznalica, kako moe ita ispuniti? Sada sam ti doao. Tog
trenutka da sam stao, ne bih ti mogao dati nita, ali sada donosim veliko blago sa sobom, i
sada ti ga mogu dati. Ne plai, ne jadikuj; otvori oi i pogledaj me. Ja nisam isti ovek koji je
otiao te noi. Potpuno razliito bie je dolo pred tvoja vrata. Ja nisam tvoj mu. Ti moe
biti moja ena, jer je to tvoje stanovite. Pogledaj u mene - ja sam potpuno druga osoba. Sada
ti donosim blaga. Mogu te takoe uiniti svesnom i prosvetljenom."
ena je sluala. Isti problem uvek dolazi svima. Poela je da razmilja o detetu. Ako
postane sannyasin i krene s ovim prosjakom - s njenim bivim muem, koji je sada prosjak -
ako ona krene... ta e se dogoditi sa detetom? Nije rekla nita, ali Buda je rekao: "Znam ta
misli, jer sam ja proao period gde su obeanja data u usnulom stanju sva skupa, i kae: ta
radi? A dete... Ti misli ovo: Neka dete postane malo starije, neka se oeni, onda moe
preuzeti palatu i kraljevstvo, a onda e me slediti. Ali zapamti, nema budunosti, ne postoji
sutra. Ili me sledi sada ili me ne sledi."
Ali njegova ena... enski um je vie uspavan nego muki. Postoji razlog za to, jer
ena je vei sanjar, ona ivi vie u nadi i snovima. Ona mora da bude vei spava jer bilo bi
157
teko prirodi da je koristi kao majku. ena mora biti u dubokom hipnotikom stanju, samo
onda moe nositi dete devet meseci u materici i patiti, onda ga roditi i patiti, onda ga podizati
i patiti, a onda jednog dana dete je jednostavno ostavi i odlazi drugoj eni... i pati.
U tako dugoj patnji, ena je prinuena da bude vei spava od oveka. Inae kako
moete patiti toliko? I ona se uvek nada. Onda se ona nada s drugim detetom, onda sa jo
jednim, i njen ivot je potroen.
Dakle, Buda je rekao, "Znam ta misli, i znam da si ti vei sanjar od mene. Ali ja sam
sada doao da iseem svo korenje tvoga spavanja. Dovedi dete. Gde je moj sin? Dovedi ga."
enski um je ponovo odigrao ulogu. Ona je dovela Rahula, dete koje je sada imalo dvanaest
godina, i rekla je: "Ovo je tvoj otac. Pogledaj ga - on je postao prosjak - i pitaj ga koje je
njegovo nasledstvo, ta ti on moe dati. Ovo je tvoj otac; on je kukavica! Pobegao je kao
lopov, ak i ne rekavi mi, napustio je tek roeno dete. Trai mu tvoje naslee!"
Buda se nasmejao i rekao Anandi: "Donesi moju prosjaku posudu." Dao je prosjaku
posudu Rahulu i rekao: "Ovo je moje naslee. inim te prosjakom. Ti si iniciran. Postaje
sannyasin." A svojoj eni je rekao: "Isekao sam koren. Sada nema potrebe za sanjanjem. Ti si
takoe probuena jer ovo je bio koren. Rahul je ve sannyasin; ti se takoe probudi, Jasodara,
ti se takoe probudi, i postani sannyasin."
Trenutak uvek dolazi kada ste u prelaznom periodu odakle se spavanje okree u
budnost. itava prolost vas zadrava, a prolost je mona. Budunost je nemona za
pospanog oveka. Za oveka koji nije pospan, budunost je mona; a za oveka koji je vrsto
uspavan, prolost je jaka, jer ovek koji je vrsto uspavan zna samo da sanja jer je samo
sanjao u prolosti. On nije svestan nikakve budunosti. ak i ako misli o budunosti, to nije
nita do samo opet refleksija prolosti, to je opet samo projekcija prolosti. Samo onaj ko je
svestan postaje svestan budunosti. Onda prolost nije nita.
Imajte to na umu. Moda neete moi da razumete odmah sada, ali jednog dana moi
ete da razumete. Za uspavanog oveka, uzrok je mnogo snaniji od posledice; seme je
mnogo monije nego cvet. Za oveka koji je budan, posledica je mnogo snanija od uzroka,
cvet je mnogo moniji nego seme. Logika spavanja je: uzrok proizvodi posledicu, seme
proizvodi cvet. Logika probuenog oveka je upravo obrnuta: cvet je taj koji proizvodi seme;
posledica je ono to proizvodi uzrok; budunost proizvodi prolost, a ne da prolost proizvodi
budunost. Ali za uspavani um, prolost, mrtvo, ono to je otilo, jeste mnogo monije. Nije...
Ono to tek treba da bude je mnogo snanije; ono to treba da bude roeno mnogo je
jae jer ivot je tamo. Prolost nema ivot. Kako ona moe biti snana? Prolost je ve
groblje. ivot se ve premestio odatle; zbog toga je to prolost. ivot ju je napustio, ali
groblja su vrlo mona za vas. Ono to tek treba da bude, ono to tek treba da bude roeno,
novo, ono to e se dogoditi, za oveka koji je probuen to postaje mnogo jae. Prolost njega
ne moe zadrati.
Prolost vas zadrava. Uvek mislite o prolim delima; uvek se razvlaite oko groblja.
Odlazite uvek iznova da posetite groblje i izrazite svoje potovanje mrtvom. Uvek izraavajte
potovanje onome to tek treba da se rodi, jer ivot je tamo.
Molimo vas, objasnite kako seme moe procvetati bez vremenskog razmaka.
Da, seme moe cvetati jer ono ve cveta. Cvet stvara seme, a ne seme cvet.
Rascvetavanje je ono iz ega sve postaje, ono je stvorilo svako seme. Ali zapamtite: samo
otvaranje je potrebno. Otvorite vrata; sunce je tu, oekuje vas. ivot nije zapravo napredak u
realnosti. On izgleda kao napredak u spavanju.
Postojanje, bivanje je ve ovde - sve kako jeste ve je savreno, potpuno, ekstatino -
nita ne moe biti dodato, ne postoji nain da se to popravlja. Onda ta je potrebno? Samo
jedna stvar: da postanete svesni i vidite to. To se moe dogoditi na dva naina. Moete biti
okom izbaeni iz svog sna: to je zen. Ili moete biti navedeni, nagovoreni da izaete iz vaeg
sna: to je joga. Izaberite! Nemojte samo da visite izmeu.
Drugo pitanje:
158
Da li je predavanje Ivari - Bogu - i predavanje guruu isto?
Predavanje ne zavisi od objekta. To je kvalitet koji vi unosite u vae bie. Kome se
predajete je nebitno. Bilo koji objekat e delovati. Moete se predati drvetu; moete se predati
reci; moete se predati bilo emu - svojoj eni, vaem muu, vaem detetu. Ne postoji
problem u objektu, svaki objekat e delovati. Problem je predati se.
Dogaaj se deava zbog predanosti, ne zbog onoga kome ste se predali. A ovo je
najlepa stvar koju treba razumeti: kome god da se predate, taj objekat postaje Bog. Nije u
pitanju predavanje Bogu. Gde ete nai Boga da mu se predate? Nikada ga neete nai.
Predajte se! Kome god da se predate, Bog je tamo. Dete postaje Bog, mu postaje Bog, ena
postaje Bog, Guru postaje Bog, ak i kamen moe postati Bog.
ak i kroz kamenje ljudi su dostigli, jer uopte nije pitanje emu se predajete. Vi se
predajete, a to donosi celu stvar, to otvara vrata. Predavanje, napor da se preda, donosi vam
otvaranje. A ako ste otvoreni kamenu, postajete otvoreni itavoj egzistenciji, jer je to samo
pitanje otvaranja. Kako moete biti otvoreni kamenu, a da ne budete otvoreni drvetu? Jednom
kada znate otvaranje, jednom kada uivate u euforiji koju ono donosi, ekstazi koja se desi
samo otvaranjem kamenu, onda ne moete nai tako glupog oveka koji e se zatvoriti odmah
preostaloj egzistenciji. Kada vam samo otvaranje kamenu daje tako ekstatino iskustvo, onda
zato se ne otvoriti svemu?
U poetku ovek se predaje neemu, a onda je predat svemu. Znaenje toga je da ako
ste se predali majstoru, u iskustvu predavanja, vi ste nauili putokaz, vodilju kako se moete
predati svemu. Majstor postaje samo prolaz kroz koji se prolazi. On postaje vrata, a kroz ta
vrata moete gledati u celo nebo. Zapamtite, ne moete nai Boga da mu se predate, mada
mnogi ljudi misle na taj nain; oni su vrlo prepredeni ljudi. Oni misle: "Kad Bog bude tu, mi
emo se predati."
52
Dakle, to je nemogue jer Bog je tu samo ako se predate. Predanost ini
sve boanskim. Predanost vam daje oi, i sve to se donese pred te oi postaje boansko.
Boanstvenost je kvalitet koji se dobija pomou predanosti.
U Indiji, hriani, Jevreji i muslimani smeju se hindusima, jer oni mogu da oboavaju
drvo, ili mogu da oboavaju kamen - ak i neoblikovan, koji nije ak ni statua. Mogu nai
kamen pored puta i od njega odmah nainiti boga. Nikakav umetnik nije potreban jer
predavanje je umetnost. Nije potrebno vajanje, nije potreban skupocen kamen, ak ni mermer.
Bilo koji obian kamen, koji je odbaen - ne moe se kupiti na trnici i stoga lei tamo pored
puta - i hindusi mogu odmah nainiti boga od njega. Ako se moete predati, on postaje
boanski. Oi predanosti ne mogu nai nita drugo nego boansko.
Drugi se tome smeju; ne mogu to razumeti. Oni misle da su ovi ljudi oboavaoci
kamena, oboavaoci idola. Nisu! Hindusi su bili pogreno shvaeni. Oni nisu oboavaoci
idola. Oni su nali klju, a taj klju je da sve moete uiniti boanskim ako se predate. A ako
se ne predate, moete nastaviti da tragate za Bogom milionima ivota. Nikada ga neete sresti,
jer nemate kvalitet koji susree, koji moe da sretne, koji moe da nae. Dakle, pitanje je
subjektivne predanosti, ne objekta kome se predajete.
Ali, naravno, postoje problemi. Vi se ne moete tako iznenadno predati kamenu, jer
va um nastavlja da govori: "Ovo je samo kamen. ta to radi?" A ako um nastavlja da
govori: Ovo je kamen; ta radi? - onda se ne moete predati, jer predanost trai vau
celovitost.
Otuda znaaj majstora. Majstor oznaava nekoga ko stoji na granici - na granici
ljudskog i boanskog. Neko ko je bio ljudsko bie kao vi, ali vie nije kao vi - neto se
dogodilo - on je sada neto vie, vie od ljudskog bia. Dakle, ako pogledate u njegovu
prolost, on je upravo kao vi - ali ako pogledate njegovu sadanjost i budunost, onda gledate
neto vie. Onda je on boanski.
Teko je predati se kamenu, reci - vrlo, vrlo teko - ak i predati se uitelju jeste tako
teko. Onda predavanje kamenu e nuno biti vrlo teko, jer kad god vidite uitelja, onda opet
52
Veina vernika ima ubeenje da su 'nali Boga' samo zato da bi izbegli pravu predaju. Koliko im je ego vrst,
toliko im je takva vera jaka. Njihova predanost je samo metod ouvanja ega, a 'Bog' je uvek u obliku nekog
simbola, relikvije ili fetia.
159
va um kae da on je ljudsko bie kao vi, dakle zato se predavati njemu? A va um ne moe
videti sadanjost; um moe videti samo prolost - da je taj ovek roen kao vi, stoga zato se
predavati njemu? On je upravo kao vi.
On jeste, a ipak nije. On je oboje i Isus i Hrist - Isus je ovek, sin oveiji, a Hrist je
vii poloaj. Ako gledate samo vidljivo, onda je on kamen; vi se ne moete predati. Ako
volite, ako postanete intimni, ako dozvolite da njegovo prisustvo ue duboko u vas, ako
moete nai vezu - o tome je re - vezu s njegovim biem, postojanjem - onda iznenada
postajete svesni vieg. On je vie nego ovek. Na neki nepoznat nain, on je neto to vi niste
dobili. Na neki nevidljivi nain on je prodro izvan granica ljudskog. Ali to moete osetiti
samo ako postoji odnos, veza.
To je ono to Patanjali kae, shraddha - poverenje; poverenje stvara vezu. Ta bliska
veza je unutarnja harmonija dvoje nevidljivih; ljubav je ta bliska veza. S nekim ste
jednostavno prilagoeni kao da ste oboje roeni jedno za drugo. Vi to zovete ljubav. Na
trenutak, ak i na prvi pogled, neko vam jednostavno odgovara, kao da ste zajedno stvoreni i
bili razdvojeni; a sada ste se opet sreli.
U starim mitologijama svuda u svetu, reeno je da su ovek i ena stvoreni zajedno. U
indijskoj mitologiji postoji vrlo lep mit. Mit je da su ena i mu na samom poetku stvoreni
kao blizanci, brat i sestra. Zajedno su bili roeni - ena i mu kao blizanci, spojeni zajedno u
jednoj materici. Postojao je odnos, veza od samog poetka. Od prvog trenutka postojala je
veza. Bili su zajedno u materici drei jedno drugo, a to je odnos. Onda, usled neke nesree,
taj fenomen je nestao sa zemlje. Meutim, mit kae da uzajamni odnos jo postoji. ovek i
ena... ovek moe da bude roen ovde, a ena moe da bude roena negde u Africi, u
Americi, ali postoji veza, i dok ne nau jedno drugo bie im teko. I vrlo je teko nai jedno
drugo. Svet je tako prostran, a vi ne znate gde da traite i gde da naete. Ako se to desi, to se
deava sluajno.
Naunici takoe veruju da emo pre ili docnije moi da ocenimo vezu uz pomo
naunih instrumenata, i pre nego to neko stupi u brak. Par mora otii u laboratoriju tako da
mogu otkriti da li je njihova bioenergija podesna ili ne. Ako nije podesna, onda su oni u
zabludi. Ovaj brak ne moe... Oni moda misle da e biti vrlo sreni, ali ne mogu biti jer
njihova bioenergija nije podesna.
Tako vi moete voleti nos ene, a ena moe voleti vae oi, ali to nije poenta.
Voljenje nosa nee pomoi, voljenje oiju nee pomoi, jer posle dva dana niko ne gleda u
nos i niko ne gleda u oi. Onda je problem bioenergija. Unutranje energije se susreu i
meaju jedna s drugom; ili se pak odbijaju. To je upravo kao kad vrite transfuziju krvi; ili je
vae telo prihvata ili odbacuje, jer postoje razliiti tipovi krvi. Ako su istog tipa, samo onda
telo prihvata; inae jednostavno odbacuje.
Isto se dogaa u braku. Ako se bioenergija slae, brak je prihvatljiv, i ne postoji
svestan nain da se to zna. Ljubav je vrlo obmanljiva, jer ljubav je uvek usredsreena na
neto. Glas ene je dobar, i vi ste privueni. Ali u tome nije poenta. To je parcijalna stvar.
Celina mora da se slae. Vae bioenergije treba da prihvate jedna drugu tako potpuno da
duboko ispod vi postanete jedna osoba. To je odnos, veza. Deava se u ljubavi retko, jer kako
je nai? To je ipak teko. Samo zaljubljivanje nije siguran kriterijum. Od hiljadu, devet stotina
devedeset devet puta nema uspeha. Zaljubljenost se pokazala neuspelom.
ak i vii odnos se deava sa majstorom. To je vie nego ljubav. To je shraddha -
poverenje. Ne susreu se i prilagoavaju samo vae bioenergije, nego se i same vae due
usklauju. Zbog toga, kad god neko postane uenik, itav svet misli da je on lud; jer ceo svet
ne moe videti u emu je poenta. Zato ste vi ludi za tim ovekom? A vi to sami takoe ne
moete objasniti, jer se to ne moe objasniti. Moete ak i da ne budete svesni ta se dogodilo,
ali s tim ovekom, iznenada, vi ste u poverenju. Iznenada se neto susretne, postaje jedno. To
je odnos, veza.
Teko je imati taj odnos s kamenom. Jer je ak teko imati taj odnos sa ivim
majstorom, kako moete imati to s kamenom? Ali ako se to dogodi, odmah majstor postaje
Bog. Za sledbenika majstor je uvek Bog. On moe da ne bude Bog za druge, to nije poenta.
Ali za uenika on je Bog, i kroz njega se vrata boanskog otvaraju. Onda vi imate klju - ovaj
160
unutranji odnos je klju, ova predanost. Onda moete pokuati to; prepustiti se reci...
Mora da ste itali novelu "Sidarta" od Hermana Hesea. On ui mnoge stvari od reke.
Vi ne moete uiti od Bude, samo posmatrajui reku, mnoga raspoloenja reke. On je postao
splavar samo posmatrajui hiljade stanja oko sebe. Ponekad, reka je srena i plee, ponekad
vrlo, vrlo tuna, kao da se uopte ne kree - ponekad vrlo ljuta i buna, protiv itave
egzistencije, a ponekad tako tiha i smirena kao Buda. A Sidarta je jednostavno splavar, prolazi
rekom, ivi pored reke, posmatra reku, ne ini nita drugo. To postaje duboka meditacija i
odnos, a kroz reku i njenu "renost" on to postie: on stie do istog sagledavanja kao Heraklit.
Vi moete zagaziti u istu reku i ne moete. Reka je ista i nije ista. Ona je tok, a kroz
reku i kroz odnos sa njom on saznaje celu egzistenciju kao reku - "renost".
To se moe dogoditi sa svime. Osnovno to treba zapamtiti jeste predaja.
Da li je predaja Ishvari - Bogu - i predaja guruu isto?
Da! Predaja je uvek ista. Do vas je kome se moete predati. Naite oveka, naite reku
i predajte se. To je rizik, najvei mogui rizik. Zbog toga je tako teko predati se. To je rizik!
Vi se kreete u nepoznatoj teritoriji i dajete toliko snage oveku ili neemu emu se predajete.
Ako se predate meni, vi mi dajete potpuno ovlaenje. Onda moje 'da' jeste vae 'da',
onda moje 'ne' jeste vae 'ne'. ak i po danu kada kaem, 'ovo je no', vi kaete: "Da, no je".
Vi dajete totalno ovlaenje nekome. Ego se odupire. Um kae: "Ovo nije dobro. Sauvaj
kontrolu nad sobom. Ko zna gde e te ovaj ovek odvesti? Ko zna, on moe rei: Skoi s
vrha brda, i onda e biti mrtav. Ko zna, ovaj ovek moe manipulisati s tobom, kontrolisati,
eksploatisati." Um e izneti sve ove stvari. To je rizik, a um preduzima sve mere sigurnosti.
Um govori: "Budi paljiv. Budi malo oprezniji s ovim ovekom." Ako sluate um,
predaja nije mogua. Um je u pravu! To je rizik! Ali ta god preduzmete, to e biti rizik.
uvanje nee mnogo pomoi. Moete se uvati zauvek, i moda neete moi da se odluite,
jer um nikada ne moe da se odlui. Um je pometnja. On nikada nije odluan. Moraete
zaobii um jednog dana, i moraete mu rei: "Ti ekaj. Ja idem; skoiu i videu ta se
deava."
ta vi zapravo imate da izgubite? Uvek se pitam ta to imate kada se tako bojite da
izgubite, ta tano dajete kada se predajete. Vi nemate nita. Moete dobiti iz toga, ali ne
moete izgubiti jer nemate nita. Moete uvek profitirati iz toga, ali ne postoji mogunost bilo
kakvog gubitka jer nemate ta da izgubite.
Mora da ste uli uvenu maksimu Karla Marksa: "Proleteri svih zemalja ujedinite se,
jer nemate ta da izgubite osim svojih lanaca." To moe biti istina, moe i da ne bude istina.
Meutim, za tragaoce ovo je tana stvar. ta ete izgubiti osim svojih lanaca, svog neznanja,
svoje patnje? Meutim, ljudi takoe postaju jako vezani za svoju patnju - oni prianjaju uz
samu svoju nevolju kao da je blago. Ako elite ukloniti njihovu nevolju, oni stvaraju sve vrste
prepreka.
Posmatrao sam ove prepreke i ove trikove kod hiljada ljudi. ak i ako elite da uzmete
njihovu bedu, oni prianjaju uz nju. Oni istiu neku stvar, jer nemaju nita drugo, to je svo
blago koje imaju. Ne uzimajte im to jer je uvek bolje imati neto nego nita. To je njihova
logika: uvek je bolje imati neto - barem ovu bedu koja postoji, nego biti potpuno prazan,
nego biti niko.
ak i kada ste jadni, vi ste neko. ak i ako imate pakao u sebi, barem imate neto. Ali
gledajte to, posmatrajte to, i kada se predate zapamtite da nemate nita drugo da date. Uitelj
uzima vau bedu, nita drugo. On ne uzima va ivot zato to ga nemate. On uzima samo vau
smrt. Ne uzima nita vredno od vas, jer vi to nemate. On uzima samo smee, besmislice koje
ste sakupili kroz mnoge ivote i sedite na gomili besmislica i mislite to je vae kraljevstvo.
On ne uzima nita. Ako ste spremni da mu date svoju patnju, postaete sposobni da
primite boansko. To je predanost, i tada uitelj postaje Bog. Sve i svako kome se predate
postaje boanski. Predanost ini boansko, predanost stvara boansko. Predanost je
stvaralaka sila.
161
Pitanje tree:
Da li je majstor potreban posle satorjia?
Da! ak i vie, jer satori je samo letimino sagledavanje, a takvo sagledavanje je
opasno jer ulazite u teritoriju nepoznatog. Pre toga majstor nije bio potreban. Pre toga kretali
ste se u poznatom svetu. Samo posle satorija majstor postaje apsolutno potreban, jer sada je
neko potreban da vas dri za ruku i vodi prema onome to nije samo odbljesak realnosti, nego
postaje apsolutna realnost. Posle satorija vi imate ukus, a ukus stvara vie elje. Ukus postaje
magnetski privlaan tako da ete eleti ludaki da jurnete u to. Tada je majstor potreban.
Posle satorija mnoge stvari e se dogoditi. Satori je kao vienje vrha Gourishankar,
(Mont Everesta) iz ravnica. Jednog dana, jednog jasnog sunanog jutra, magle nema, moete
videti stotinama milja udaljen vrg Gourishankar kako se die u nebo. To je satori. Onda pravo
putovanje zapoinje. Onda sav ostali svet izgleda beskoristan.
To je prekretnica. Sada sve to ste znali postaje nekorisno, sve to ste imali postaje
teret. Sada svet, ivot koji ste iveli do sada, jednostavno nestaje kao san, jer se vee
dogodilo. I to je satori, letimino sagledavanje, odbljesak. Ubrzo e magla biti tu, i vrh nee
biti vidljiv. Oblaci e doi i vrh e nestati. Sada ete biti u potpuno nesigurnom stanju svesti.
Prva stvar e biti, da li je to, ta god da ste videli, bilo realno ili samo san, jer gde je to
sada? To je nestalo. To je bio samo kratak proboj, samo procep i vraeni ste natrag - baeni u
va vlastiti svet.
Javie se sumnja: ta god da ste videli, da li je bilo istinito? Da li je to stvarno
postojalo, ili ste sanjali o tome, ili ste zamiljali to? A to je mogue. Mnogi ljudi zamiljaju,
tako da sumnja nije pogrena. Mnogo puta ete zamiljati, i ne moete nainiti razliku, ta je
realno a ta je nerealno. Samo majstor moe rei: "Da, ne brinite. To je bilo realno." Ili
majstor moe rei: "Odbacite to! To je bilo zamiljeno."
Samo onaj ko je upoznao vrh - ne iz ravnice - samo onaj ko je dosegao vrh, samo onaj
koji je sam postao vrh, samo on vam moe rei jer on ima kriterijum, on ima merilo. On moe
rei: "Baci to smee! To je samo vaa imaginacija," jer kada tragaoci stalno misle o ovim
stvarima, um zapoinje da sanja.
Mnogi ljudi dolaze kod mene. Samo jedan procenat od njih ima realnu stvar;
devedeset devet procenata donose nerealne stvari. Teko im je da odlue - ne teko, ve
nemogue - oni ne mogu odluiti. Iznenada oseate oivljavanje energije u osnovi kime:
kako ete odluiti, da li je to realno ili nerealno? Mnogo ste razmiljali o tome; takoe ste
eleli to. Nesvesno sejete seme da se to treba dogoditi, kundalini treba da se uzdigne. Onda ste
itali Patanjalija, onda ste razgovarali o tome, onda ste sreli ljude koji kau da je njihova
kundalini probuena. Va ego, onda se sve pomealo...
Iznenada, jednog dana osetite oivljavanje: to nije nita do kreacija uma - samo da vas
zadovolji: "Nemoj brinuti, nemoj biti tako mnogo zabrinut. Gledaj! Tvoja kundalini se
podigla," a to samo um zamilja. Onda ko e odluiti? I kako ete odluiti, jer vi ne znate
istinu? Samo istina moe postati kriterijum za odluivanje da li je to istina ili neistina.
Majstor je potreban ak i vie posle prvog satorija. Postoje tri satorija. Prvi satori je
samo letimian, poput svetlucanja. On je nekada mogu ak i kroz droge; to je mogue kroz
mnoge druge stvari - nekada sluajno. Ponekad se penjete na drvo i padnete, a to je takav ok
da se um zaustavlja za jedan trenutak, i svetlucanje nastaje, a vi ete osetiti takvu euforiju kao
da ste izbaeni iz svog tela, neto ste saznali.
Za sekundu se vraate natrag, um poinje da funkcionie; to je jednostavno ok. Kroz
elektrini ok je to mogue, kroz ok insulinom to je mogue, kroz droge to je mogue. ak
se ponekad i u bolesti to dogaa. Tako ste slabi da um ne moe funkcionisati; iznenada imate
uvid, letimino sagledavanje. Kroz seks je to mogue. U orgazmu, kada celo telo vibrira, to je
mogue.
Taj prvi uvid ne nastaje nuno kroz religijsko nastojanje. Zbog toga su LSD, meskalin,
i marihuana postali tako vani i privlani. Prvo letimino sagledavanje je mogue, i vi moete
biti uhvaeni zbog tog prvog sagledavanja u drogi. To moe postati trajan izlet; onda je to vrlo
opasno jer letimini uvidi nee pomoi. Oni mogu pomoi, ali nije nuno pomo doe samo
162
od njih. Oni mogu pomoi samo sa majstorom, jer e on onda rei: "Ne idi samo za
letiminim sagledavanjem. Imao si letimino sagledavanje, sada zaponi putovanje da
dostigne vrh." Budui da nije stvar samo u tome da se sagleda vrh, ve konano ovek treba
da postane vrh.
Ovo su tri stadijuma: prvi je letimian uvid - ovo je mogue kroz mnoge puteve, nije
nuno da budu religijski. ak i ateista moe imati letimian uvid. Droge, hemikalije mogu
vam dati letimino sagledavanje. ak i posle operacije, kada izlazite iz hloroforma, moete
imati letimian uvid. I dok vam daju hloroform, dok padate sve dublje i bublje, moete imati
to letimino sagledavanje.
Mnogi ljudi su postigli prvi satori; to nije mnogo znaajno. Moe se koristiti kao
korak za drugi satori. Drugi satori je dostizanje vrha. To se nikada ne dogaa sluajno. To se
dogaa samo kroz metode, tehnike, kole, jer je potrebno dugo nastojanje da se dostigne drugi
satori.
I tada je tu trei satori, koji Patanjali naziva samadhi: taj trei znai postati sam vrh.
Jer iz drugog vi takoe silazite dole. Kad dosegnete vrh, to moe biti nepodnoljivo.
Blaenstvo je takoe ponekad nepodnoljivo - ne samo bol, blaenstvo takoe; ovek se vraa
natrag bolu.
Teko je iveti na visokom vrhu - vrlo teko! - ovek bi eleo da se vrati natrag. Dok
ne postanete sam vrh, dok iskusilac ne postane iskustvo, to moe da se izgubi. I do treeg - do
samadhija - majstor je potreban. Samo kada se dostigne konani, najvii samadhi, majstor
nije potreban.
etvrto pitanje:
Dok vas sluam, mnogo puta odreene rei idu vrlo duboko, i postoji iznenadna
jasnoa i razumevanje. Ovo izgleda da se deava samo kada sluam rei koje vi izgovarate.
Ali, mir koji se sputa dok vas sluam bez ikakve posebne panje podjednako je blaen, ali
onda se gube rei i njihova znaenja. Molim vas, dajte nam uputstvo kako da vas sluamo, jer
je to jedna od vaih najboljih meditacija.
Ne brinite mnogo o reima i znaenju. Ako posveujete mnogo panje reima i
znaenju, to postaje intelektualna stvar. Naravno, nekada ete dospeti do jasnoe. Iznenada
oblak iezava i sunce je tu, ali to e biti samo trenutna stvar i jasnoa nee mnogo pomoi;
sledeeg trenutka nestaje. Intelektualna jasnoa nije od velike koristi.
Ako sluate rei i njihovo znaenje moete razumeti mnoge stvari, ali neete razumeti
mene, neete takoe razumeti ni sebe. Mnoge takve stvari nisu vredne. Ne brinite o reima i
znaenjima; sluajte me kao da ne govorim ve pevam, kao da vam ne govorim reima, nego
vam govorim zvukovima, kao da sam pesnik!
Nije potrebno traiti znaenje, ta sam ja mislio. Samo sluajte bez pridavanja ikakve
panje reima i znaenjima; i doi e vam razliit kvalitet jasnoe. Biete blaeni: to je prava
jasnoa. Osetiete sreu, osetiete smirenost, tiinu i spokojstvo. To je pravo znaenje.
Jer ja nisam ovde da bih vam objasnio odreene stvari, ve da stvorim odreen kvalitet
u vaem biu. Ja ne govorim da bih objasnio; moj govor je kreativan fenomen. Ne pokuavam
neto da vam objasnim - to vi moete uiniti kroz knjige i postoje milioni drugih naina da
razumete ove stvari - ja sam ovde da vas preobrazim.
Sluajte me - jednostavno, nevino, bez ikakve brige oko rei i njihovih znaenja.
Ostavite tu jasnou; ona nije od velike koristi. Kada me jednostavno sluate, transparentno,
intelekt vie ne postoji - od srca do srca, od bia do bia - onda govornik iezava, i slualac
takoe. Onda ja nisam ovde, i vi takoe niste ovde. Odnos, veza postoji; slualac i govornik
su postali jedno. U tom jedinstvu, vi ete biti preobraeni. Da biste dospeli do tog jedinstva
postoji meditacija. Nainite to meditacijom, ne kontemplacijom, ne razmiljanjem. Onda se
prenosi neto vie od rei - neto iznad znaenja. Pravo znaenje, krajnje znaenje se prenosi -
neto to nije u spisima i ne moe biti.
Moete i sami itati Patanjalija. Uz malo napora vi ete ga razumeti. Ja ne govorim
ovde da biste postali sposobni da razumete Patanjalija; ne, to uopte nije poenta. Patanjali
163
je samo izgovor, vealica. Ja veam neto na njemu to je izvan spisa.
Ako sluate moje rei, vi ete razumeti Patanjalija, bie jasnoe. Ali ako sluate moj
zvuk, ako ne sluate rei ve mene, onda e vam pravo znaenje biti otkriveno, a to znaenje
nema nita s Patanjalijem. To znaenje se prenosi izvan spisa.
Poglavlje 5
MAJSTOR MAJSTORA
Izlaganje 5. januara 1975. u Buddha dvorani.
I, 26: purveamapi guruh kalenanavacchedat.
On je uitelj i prvim mudracima, budui vremenom neogranien.
53
I, 27: tasya vacakah pranavah.
Re koja ga iskazuje je prvobitna vibracija [AUM].
I, 28: tajjapastadarthabhavanam.
Ponavljati je i realizovati u sebi njen smisao [vodi takoer ka samadhiju].
I, 29: tatah pratjakcetanadhigamo' pyantaraydbhavaca.
Ovim [ponavljanjem] postie se Uvid u vlastitu unutranjost (pratyakcetana), a
[svakovrsne psihosomatske i intelektualne] smetnje (antaraya) bie takoer otklonjene.
Patanjali govori o fenomenu Boga. Bog nije tvorac. Za Patanjalija, Bog je najvie
cvetanje individualne svesti.
Svako je na putu da postane Bog. Ne samo vi, nego i kamenje, stene, svaka jedinica
egzistencije je na putu da postane Bog. Neki su ve postali; neki postaju; neki e postati.
54
Bog nije tvorac, nego kulminacija, vrh, najvie od egzistencije. On nije u poetku; on
je u kraju. I, naravno, u izvesnom smislu, on je i na poetku takoe, jer na kraju moe da
cveta samo ono to je uvek bilo od samog poetka kao seme. Bog je potencijalnost, skrivena
mogunost: ovo treba da se zapamti. Dakle Patanjali nema jednog Boga, on ima beskonano
bogova. Cela egzistencija je puna bogova.
Jednom kada ste razumeli Patanjalijevu koncepciju Boga, onda Bog nije da bi se
samo oboavao. Vi morate da postanete jedno s njim; to je jedino oboavanje. Ako samo
oboavate Boga, to nee pomoi. Zapravo, to je neozbiljno. Oboavanje, pravo oboavanje
treba da se sastoji od postajanja vas samih Bogom. itav napor treba da bude da se dovede
vaa potencijalnost do take gde eksplodira u ostvarenju - gde se seme rasprsne i ono to je
bilo skriveno postaje ispoljeno. Vi ste neispoljeni Bog, i svo nastojanje je u tome kako dovesti
neispoljeno do ispoljenog stanja - kako ga dovesti do ravni manifestacije.
Budui da je on izvan ogranienja vremena, on je majstor majstora.
On govori o svojoj koncepciji Boga. Kada neko postaje cvet, kada neko postaje lotos
postojanja, mnoge stvari se njemu deavaju i mnoge stvari poinju da se u egzistenciji
deavaju kroz njega. On postaje velika mo, jedna beskonana snaga, i kroz njega na mnogo
naina, drugima se pomae da postanu bogovi na njihov vlastiti nain.
53
U ovom predavanju Osho pravi razliku izmeu Uitelja i Majstora, tako da se u ovoj sutri misli na Majstora.
54
Zapravo, sve je Boansko i nita osim Boanskog ne postoji, a postajanje Boanskim o emu se ovde govori
zapravo je buenje i prepoznavanje sebe kao Boanskog.
164
Budui da je on izvan ogranienja vremena, on je majstor majstora.
Postoje tri tipa majstora. Jedan nije sasvim majstor; pre je uitelj. Uitelj je ovek koji
ui, onaj koji pomae ljudima da znaju o stvarima, bez njihove vlastite realizacije. Ponekad
uitelji mogu privui hiljade ljudi. Jedina potrebna stvar je da oni budu dobri uitelji. Oni
moda nisu spoznali sebe, ali mogu govoriti, mogu raspravljati, mogu propovedati, i mnogi
ljudi mogu biti privueni njihovim govorima, besedama, propovedima. Ali govorei
neprekidno o Bogu oni mogu obmanjivati sebe. Postepeno mogu poeti da oseaju kako oni
znaju.
Kada govorite o nekoj stvari, najvea opasnost je da moete poeti da verujete da
znate. U poetku kada ponete da govorite, da poduavate - poduavanje ima neku privlanost
jer je to vrlo ispunjavajue za ego - kada vas neko slua paljivo, duboko ispod to ispunjava
va ego da vi znate, a on ne zna. Vi ste znalac, a on je neznalica.
Dogodilo se: svetenik, veliki svetenik, pozvan je u ludnicu da kae nekoliko rei
stanarima te kue. Svetenik nije oekivao mnogo, ali je bio iznenaen. Jedan ludak ga je
sluao toliko paljivo; nikada nije video nekog oveka da ga slua tako paljivo. On se
nagnuo napred i svaku re primao u svoje srce. ak nije ni treptao. Bio je toliko paljiv - kao
da je hipnotisan.
Kada je svetenik zavrio propoved, video je istog oveka kako prilazi upravniku i
govori mu neto. Bio je radoznao. im mu se pruila prilika, pitao je upravnika: "ta vam je
ovek rekao? Da li je rekao neto o mojoj propovedi?" Upravnik je odgovorio: "Da."
Svetenik je pitao: "Hoete li mi rei ta je rekao?" Upravnik je bio malo nerad da to uini, ali
je onda rekao: "Da, ovek je rekao: Vidite? A ja sam unutra, a on je van!"
Uitelj je tano na istom mestu, u istom amcu, kao to ste vi. On je takoe jedan
stanar ludnice. On nema nita vie nego vi - samo malo vie informacija. Informacije ne znae
nita. Moete da ih sakupite; obina, osrednja inteligencija je potrebna da skupi informacije.
ovek ne treba da bude genije, ne treba da bude mnogo talentovan. Samo osrednja
inteligencija je dovoljna. Moete skupiti informacije. Moete stalno da ih sakupljate; moete
postati uitelj.
Uitelj je onaj ko zna bez spoznaje. On privlai ljude, ako je dobar govornik, dobar
pisac, ako ima linost, ako ima odreenu harizmu oko sebe, magnetske oi, snano telo.
Postepeno on postaje sve vetiji. Meutim, ljudi oko njega ne mogu postati sledbenici, oni e
ostati uenici. ak i ako se on izdaje za majstora, ne moe vas nainiti sledbenikom. Najvie
vas moe nainiti uenikom. Uenik je onaj koji je u potrazi za vie informacija, a uitelj je
onaj koji je sakupio vie informacija. Ovo je prvi tip majstora - koji uopte nije majstor.
Onda postoji drugi tip majstora - koji je spoznao sebe. ta god kae, on kae kao
Heraklit: "Ja sam tragao." Ili kao Buda, on moe rei: "Ja sam naao." Heraklit je mnogo
suptilniji. On je govorio ljudima koji ga ne bi mogli razumeti da je kazivao kao Buda: "Naao
sam". Buda kae: "Ja sam najsavreniji prosvetljeni ovek koji se ikada dogodio." To izgleda
egoistino, ali nije, i on je govorio svojim sledbenicima koji su mogli razumeti da tu uopte
nije bilo ega.
Heraklit je govorio ljudima koji nisu bili disciplinovani - samo obinim ljudima. Oni
ne bi razumeli. On utivo kae: "Ja sam tragao, istraivao," i ostavlja drugu stranu, ono: "Ja
sam naao", vaoj imaginaciji. Buda nikada ne kae: "Ja sam tragao." On kae: "Naao sam! I
ovo prosvetljenje se nikada nije dogodilo pre. Ono je najvie i potpuno."
ovek koji je naao jeste majstor. On e prihvatiti sledbenike. Uenici su zabranjeni;
uenici ne mogu otii tamo sami od sebe. ak i ako ih nanese tamo put, otii e to je pre
mogue jer majstor vam nee pomoi da sakupljate jo vie znanja. On e pokuati da vas
preobrazi. Dae vam postojanje, a ne znanje. Dae vam vie bia, a ne vie znanja. Uinie
vas usreditenim, a sredite je negde oko pupka, ne u glavi.
Ko god ivi u glavi jeste ekscentrian. Ova re je lepa: engleska re eccentric znai
'izvan centra'. Zaista, lud je onaj ko god ivi u glavi - glava je periferija. Moete iveti u
svojim nogama, ili moete iveti u svojoj glavi; rastojanje od centra je isto. Centar je negde
blizu pupka.
165
Uitelj vam pomae da budete vie i vie ukorenjeni u glavi; majstor e vas iskoreniti
iz glave i presaditi u centar. To je ba kao presaivanje, ima tako mnogo bola - nuno je da
bude - patnje, agonije, jer kada se presauje, biljka mora da bude iupana iz svoga tla. Tako
je uvek bilo. A onda opet, treba da bude zasaena u novu zemlju. To e potrajati. Stari listovi
e otpasti. Cela biljka e proi kroz agoniju, nesigurnost, ne znajui da li e preiveti ili ne.
To je ponovno roenje. S uiteljem nema ponovnog roenja; s majstorom ima ponovnog
roenja.
Sokrat je u pravu, on kae: "Ja sam babica". Da, majstor je kao babica, pomae vam
da budete ponovo roeni. Ali to znai da ete morati da umrete: samo onda se moete ponovo
roditi. Dakle, majstor nije samo babica - Sokrat kae samo pola stvari. Majstor je i ubica
takoe - ubica plus babica. Prvo e vas ubiti kakvi jeste, i samo onda novo moe nastati od
vas. Iz vae smrti sledi vaskrsenje.
Uitelj vas nikada ne menja. ta god da vi jeste, ko god vi jeste, on vam jednostavno
dodaje vie informacija. On vam pridodaje i zadrava kontinuitet. On moe da vas
modifikuje, moe da vas profini. Moete postati kulturniji, vie uglaeni. Ali ostaete isti;
osnova e biti ista.
Sa majstorom se dogaa diskontinuitet. Vaa prolost postaje kao da nikada nije bila
vaa - kao da je pripadala nekom drugom, kao da je sanjana. Ona nije bila realna; bila je
nona mora. Kontinuitet se prekida. Postoji procep. Staro otpada, a novo dolazi, izmeu ova
dva postoji procep. Procep je problem; on mora da se pree. U tom procepu mnogi
jednostavno postaju preplaeni i vraaju se natrag, bee brzo natrag i prianjaju uz svoju staru
prolost.
Majstor vam pomae da preete taj jaz, ali za uitelja nema niega takvog, nema
problema. Uitelj vam pomae da nauite vie; majstorov prvi posao je da vam pomogne da
zaboravite ono to je naueno, da se oduite; to je razlika.
Neko je pitao Ramanu Maharija: "Doao sam iz velike daljine da uim od vas.
Poduite me:" Ramana se nasmejao i rekao: "Ako ste doli da uite, onda idite negde drugde
jer mi ovde zaboravljamo naueno. Ovde ne poduavamo. Previe ve znate; to je va
problem. Vie uenja i bie vie problema. Mi uimo kako da zaboravite naueno, kako da se
preuredite, razvijete."
Majstor privlai sledbenike, uitelj - uenike. ta je sledbenik? Sve mora tano da
bude shvaeno; samo ete onda moi da razumete Patanjalija. Ko je sledbenik? Koja je
razlika izmeu uenika i sledbenika? Uenik je u potrazi za znanjem, sledbenik trai
preobraaj, promenu. On je zasien, sit je samoga sebe. Doao je do take spoznaje: " Ovakav
kakav sam, ja sam bezvredan - praina, nita drugo. Ovakav kakav sam, to nema vrednosti."
On je doao do postizanja novog roenja, novog postojanja. Spreman je da proe
skroz krst, kroz smrtne muke i ponovno roenje; otuda re sledbenik. Re sledbenik (engl.
disciple) dolazi od 'disciplina'. On je spreman da proe kroz svaku disciplinu. ta god majstor
kae, on je spreman da sledi. On je sledio svoj vlastiti um do sada, tokom mnogo ivota, i nije
stigao nigde. Sluao je svoj vlastiti um, i dospevao je u sve vee nevolje. Sada je doao do
take gde je shvatio: "Dosta je ovoga."
On dolazi i predaje se majstoru. Ovo je disciplina, prvi korak. On kae: "Sada u vas
sluati. Sluao sam dovoljno samog sebe; bio sam sledbenik svog vlastitog uma, uenik, i to
nije vodilo nikuda. Shvatio sam to. Sada ste vi moj majstor." To znai: "Sada ste vi moj um.
Sve to kaete, ja u posluati. Gde god me vodite, ja u poi. Neu sumnjati u vas jer ta
sumnja e dolaziti iz mog uma."
Sledbenik je onaj ko je kroz ivot nauio jednu stvar: da je va um tvorac nevolja, va
um je osnovni uzrok vae patnje. Va um uvek kae: "Neko drugi je uzrok nevolje, ne ja."
Sledbenik je onaj ko je nauio da je to trik, da je to klopka uma. On uvek kae: "Neko drugi je
odgovoran; ja nisam odgovoran." Tako on spasava sebe, titi, ostaje siguran. Sledbenik je onaj
ko je razumeo da je to pogreno - to je trik uma.
Jednom kada osetite celu ovu apsurdnost uma... On vas vodi u elju; elja vas vodi u
frustraciju. On vas vodi u napredak i uspeh; svaki uspeh postaje propast. On vas vodi prema
lepoti, a svaka lepota se pokazuje runom. On vas stalno vodi dalje i dalje; nikada ne
166
ispunjava nijedno obeanje. Daje vam obeanja Ne, ni jedno jedino obeanje nije
ispunjeno. To vam stvara sumnju, sumnja postaje crv u srcu, otrovan. Ne dozvoljava vam da
imate poverenje, a bez poverenja ne postoji rast. Kada razumete celu ovu stvar, samo onda
moete postati sledbenik.
Kada doete kod majstora, simbolino polaete svoju glavu pred njegova stopala. To
je odbacivanje svoje glave: to znai stavljanje svoje glave pred njegova stopala. Tada kaete:
"Sada u ostati bez glave. ta god mi sada kaete bie moj ivot." To je predanost. Majstor
ima sledbenike koji su spremni da umru i budu ponovo roeni.
Onda postoji trei - majstor majstora. Uitelj uenika je prvi; majstor sledbenika
drugi; i onda trei, majstor majstora. Patanjali kae kada majstor postane Bog - a da postane
Bog znai da je transcendirao vreme; za njega vreme ne postoji, prestaje da postoji; za njega
ne postoji vreme; onaj ko je dospeo do razumevanja bezvremenosti, venosti; koji se nije
samo promenio i postao dobar, ko se nije samo promenio i postao svestan, koji je dospeo
izvan vremena - on postaje majstor majstora. Sada je on Bog.
ta e onda raditi majstor majstora? Ovaj stadijum dolazi samo kada majstor napusti
telo - nikada pre. Jer u telu vi moete biti svesni, u telu vi moete shvatiti da ne postoji vreme.
Ali telo ima bioloki sat. Ono osea glad, a posle izvesnog vremenskog perioda opet glad -
zasienost i glad, spavanje, bolest, zdravlje. Nou telo mora da ode na spavanje; ujutru mora
da se probudi. Telo ima bioloki sat. Dakle, trei majstor se deava samo kada majstor napusti
telo - kada on ne dolazi ponovo natrag u telo.
Buda ima dva termina. Prvi je nazvan nirvana, kada je Buda postao prosvetljen ali je
ostao u telu. To je prosvetljenje, nirvana. Onda je posle etrdeset godina napustio telo; nazvao
je to apsolutnom nirvanom - mahaparanirvana. Onda je postao majstor majstora, i ostao je
majstor majstora.
55
Svaki majstor, kada trajno napusti telo, kada se nee vie vraati natrag, postaje
majstor majstora. Muhamed, Isus, Mahavira, Buda, Patanjali; oni su ostali uitelji uitelja, i
oni neprekidno vode - majstore, ne sledbenike.
Kada neko postane majstor na stazi Patanjalija, odmah postoji kontakt sa
Patanjalijem ija dua lebdi u beskonanom, individualna dua, koju on zove Bog. Kada
osoba sledi Patanjalijevu stazu postaje majstor, prosvetljen, odmah postoji komunikacija sa
izvornim majstorom koji je sada Bog.
Kad god neko sledi Budu i postane prosvetljen, odmah uzajamni odnos zapoinje da
postoji. Iznenada on je sjedinjen s Budom - s Budom koji nije vie u telu, koji nije vie u
vremenu i prostoru, ali jo jeste - sa Budom koji je postao jedno sa apsolutnim, ali jo uvek
jeste.
Ovo je vrlo paradoksalno i vrlo je teko razumeti, jer mi ne moemo razumeti nita to
je izvan vremena; itavo nae razumevanje je unutar vremena; itavo nae razumevanje je
unutar prostora. Kada neko kae da Buda postoji izvan vremena i prostora, za nas to nema
smisla.
Kada kaete da Buda postoji izvan prostora, to znai da ne postoji nigde posebno. A
kako neko moe postojati a da ne postoji nigde posebno? On postoji, jednostavno postoji. Ne
moete pokazati gde; ne moete rei gde je on. U tom smislu on nije nigde, pa je u tom smislu
svuda. Za um koji ivi u prostoru, vrlo je teko da razume neto to je izvan prostora.
Meutim, ko god sledi metode Bude i postane majstor, odmah ima kontakt. Buda jo uvek
vodi ljude koji slede njegovu stazu; Isus jo uvek vodi ljude koji slede njegov put.
Na Tibetu postoji mesto Kaila gde se, svake godine na dan Budinog naputanja sveta,
u noi punog meseca, Vaia, pet stotina majstora okupljaju zajedno. Na tom mestu, gde se pet
55
Smatra se da ove klasifikacije vae samo za posmatrae, ne i za prosvetljenog. On je i za vreme potpunog
prosvetljenja u telu dostigao mahaparanirvanu, jer je i tada potpuno nezavisan od tela kao da ono ne postoji.
Maha znai veliki a ispred rei samadhi oznaava fiziku smrt prosvetljenog. Kada svetac fiziki umre, za
njega se kae da je uao u mahasamadhi. Re para (ispred nirvana) oznaava onostranu ili transcendentalnu
nirvanu koja se nastavlja posle smrti tela prosvetljenog. Stoga mahaparanirvana jednostavno za posmatrae
znai da je telo prosvetljenog umrlo, a ne novo stanje nirvane za prosvetljenog, koje nastupa samo posle smrti.
Ako je prosvetljeni u nirvani, on je potpuno nezavisan od tela, tako da smrt tela za njega ne predstavlja nikakvu
promenu.
167
stotina majstora okupljaju zajedno svake godine, oni ostvaruju Budin silazak, Buda ponovo
postaje vidljiv.
To je staro obeanje koje Buda ispunjava. Pet stotina majstora treba da bude tu,
nijedan manje, jer tada to nee biti mogue. Tih pet stortina majstora su kao teg, kao sidro
pomou koga Buda silazi dole. Ako jedan majstor nedostaje, pojava se nee dogoditi. To se
ponekad dogaa - nema pet stotina majstora. Te godine nema kontakta, nema vidljivog
kontakta. Nevidljivi kontakt ostaje, ali nema vidljivog kontakta.
Na Tibetu ima mnogo majstora, i to nije teko. Tibet je najprosvetljenija zemlja; ostala
je takva do danas. To nee biti u budunosti, zahvaljujui Maou. On je unitio itav suptilni
obrazac koji je Tibet stvorio. Cela zemlja bila je manastir. U drugim zemljama postoje
manastiri; Tibet je postojao u manastiru.
Pravilo je da iz svake familije jedna osoba mora da preuzme sannyas, da postane
lama, a to pravilo je tako nainjeno da su najmanje pet stotina majstora uvek dostupna. Kada
se pet stotina majstora sastanu na Kailau u pono - u dvanaest sati - Buda je opet vidljiv.
Spustio se u vreme i prostor.
On je vodi; svaki majstor nastavlja da vodi. Jednom kada ste blizu majstora, ne blizu
uitelja, vi moete imati poverenje. ak i ako ne postignete prosvetljenje u ovom ivotu,
imaete neprekidno suptilno voenje - ak i ako ne shvatite da ste voeni.
Mnogi uenici Gurijeva su dolazili kod mene. Oni su morali doi jer ih je Gurijev
bacao prema meni. Ne postoji niko drugi, Gurijev ih moe baciti ili odgurnuti. To je nesrea.
Ali je tako - sada ne postoji nijedan majstor u Gurijevom sistemu, tako da on ne moe
nainiti kontakt. Mnogi njegovi uenici dolaze pre ili kasnije, i oni nisu svesni jer ne mogu
razumeti ta se dogaa. Oni misle da je to samo sluajno.
Ako majstor postoji na odreenoj stazi u vremenu i prostoru, izvorni majstor moe
nastaviti da alje instrukcije. Na taj nain religije su uvek ostajale ive. Jednom kada se lanac
prekine, religija postaje mrtva. Na primer, religija aina je prekinuta jer ni jedan jedini
majstor ne postoji preko koga bi Mahavira nastavio da alje nove instrukcije. Jer u svakom
dobu stvari se menjaju; um se menja, tehnike su se promenile, uenja su se promenila, metode
moraju biti pronaene, nove stvari moraju biti dodate, stare stvari moraju biti izbrisane.
Svakom dobu je potrebno mnogo rada.
Ako majstor postoji na odreenoj stazi, onda izvorni majstor, koji je sada Bog, moe
nastaviti rad. Ali ako majstor nije ovde na zemlji, onda je lanac prekinut i religija postaje
mrtva. To se deavalo mnogo puta.
Na primer, Isus nikada nije nameravao da stvori novu religiju; nikada nije razmiljao o
tome. Bio je Jevrejin, primio je direktna uputstva od jevrejskih majstora koji su postali
bogovi. Ali Jevreji nisu sluali nova uputstva. Oni bi rekli: "To nije zapisano u spisima. O
emu ti pria?" U spisima je zapisano da, ako vas neko pogodi kamenom, vi na njega bacite
kamen; oko za oko, ivot za ivot. A Isus je poeo da govori da volite neprijatelja svog - i ako
vas on udari po jednom obrazu, okrenite mu i drugi.
To nije zapisano u jevrejskim spisima, ali je novo uputstvo jer se doba promenilo. To
je nova metoda koju je trebalo sprovoditi, a Isus ju je primio direktno od bogova - od bogova
u Patanjalijevom smislu: od starih proroka. Ali to nije bilo zapisano u spisima. Jevreji su ga
ubili ne znajui ta su uradili. Zato je Isus rekao u poslednjem trenutku kada je bio na krstu:
"Boe, oprosti im, jer ne znaju ta rade. Oni izvravaju samoubistvo. Oni ubijaju sebe, jer
prekidaju vezu sa svojim vlastitim majstorima."
I to se dogodilo. Ubistvo Isusa je postalo najvea nesrea za Jevreje, i ve dve hiljade
godina oni pate jer nemaju kontakt. Oni ive sa spisima; oni su ljudi koji su najvie
orijentisani na spise u svetu. Talmud, Tora - oni ive sa spisima i kad god je nainjen napor iz
vieg izvora izvan vremena i prostora, oni nisu sluali.
To se dogodilo mnogo puta. Tako je roena nova religija. Nepotrebno - nije bilo
potrebe! Ali stari ljudi nisu sluali. Oni su rekli: "Gde je to zapisano?" To nije zapisano. To je
nova instrukcija, novi spis. I ako ne sluate, onda e taj novi spis, nove instrukcije postati
nova religija. I vidite, uvek nova religija izgleda snanija od stare. Zato to ima poslednje
instrukcije, moe vie pomoi ljudima.
168
Jevreji su ostali isti. Hriani su se rairili na pola sveta; sada je polovina sveta
hrianska. aini su ostali u Indiji, vrlo neznatna manjina jer i oni nisu eleli sluati. Oni
nemaju nijednog ivog majstora. Imaju mnogo sadhua, monaha - mnogo, jer oni mogu to
priutiti - oni su bogata zajednica - ali nemaju nijednog ivog majstora. Nikakve instrukcije ne
mogu im biti date kroz vie izvore. Ovo je bilo jedno od najveih otkria Teozofa u Indiji - u
ovom dobu, svuda u svetu - da majstori neprekidno nastavljaju da poduavaju. Patanjali kae
da je ovo trea kategorija majstora: majstor majstora. To je ono to kod njega znai re Bog.
Budui da je izvan ogranienja vremena, on je majstor majstora.
ta je vreme i kako ovek odlazi izvan vremena? Pokuajte da razumete. Vreme je
elja, jer za elju potrebno je vreme. Vreme je tvorevina elje. Ako nemate vreme, kako
moete eleti? Ne postoji prostor za kretanje elje. elji je potrebna budunost. Zbog toga se
ljudi koji ive s milionima elja boje smrti. Zato se boje smrti? Jer smrt odmah preseca
vreme. Vie nema vremena, vi imate milione elja, a sada dolazi smrt.
Smrt znai da sada vie nema budunosti; smrt znai da sada vie nema vremena. Sat
moe nastaviti da otkucava, ali vi neete "kucati". elji treba vreme da se ispuni - budunost.
Vi ne moete eleti u sadanjosti; ne postoji elja u sadanjosti. Moete li eleti ita u
sadanjosti? Kako ete eleti to? Jer ako poelite odmah je budunost ula. Sutra je dolo u
sledeem trenutku. Kako sada i ovde moete eleti, u ovom trenutku?
elja je nemogua bez vremena - vreme je takoe nemogue bez elje - oni se uvek
javljaju zajedno, kao dva aspekta istog novia. Kada ovek postane beeljan, on postaje
bezvremen. Budunost se zaustavlja, prolost se zaustavlja. Samo sadanjost je tu. Kada se
elja zaustavi to je slino kao kada sat nastavlja da otkucava a kazaljke su uklonjene. Upravo
zamislite sat koji nastavlja da otkucava, a nema kazaljki, tako da ne moete rei koliko je sati.
ovek bez elja je kao asovnik koji otkucava bez kazaljki. To je stanje Bude. U telu,
on ivi, asovnik nastavlja da otkucava, jer telo ima svoj vlastiti bioloki proces koji se
nastavlja. Ono e biti gladno, ono e traiti hranu. Ono e biti edno i traie da pije. Osetie
pospanost i otii e da spava. Telo e imati potrebe, zato ono otkucava. Ali unutarnje bie
nema vreme; asovnik je bez kazaljki.
Zbog tela vi ste usidreni u svetu - u svetu vremena. Vae telo ima teinu, a zbog te
teine gravitacija jo deluje na vas. Kada je telo ostavljeno, kada Buda ostavi telo, onda se
otkucavanje smo zaustavlja. Onda je on ista svest: nema tela, nema gladi, nema zasienosti;
nema tela, nema ei; nema tela, onda nema potreba.
Zapamtite ovo - elja i potreba - ove dve rei. elja je od uma; potreba je od tela. elja
i potreba, onda ste vi sat sa kazaljkama. Kada postoji samo potreba, a nema elje, onda ste vi
sat bez kazaljki, a kada se potreba takoe ostavi, otili ste izvan vremena. To je venost; izvan
vremena je venost.
Na primer: ako ne gledam u sat - i ako moram da gledam neprekidno celog dana - ako
ne gledam u sat, ja ne znam koje je vreme. ak i ako sam video pre pet minuta, opet moram
pogledati jer ne znam tano, jer sada - unutra nema vremena - samo telo otkucava.
Svesnost nema vreme. Vreme se stvara kada svest eli neto: odmah se vreme stvara.
U egzistenciji ne postoji vreme. Ako ovek nije na zemlji, vreme e ieznuti odmah. Drvee
otkucava, kamenje otkucava. Sunce e se dii i mesec e zai, i sve e se nastaviti kako jeste,
ali nee biti vremena jer vreme ne dolazi sa sadanjou, ono dolazi seanjem na prolost i
zamiljanjem budunosti.
Buda nema prolost. On je zavrio s tim, on je ne nosi. Buda nema budunost. On je
zavrio s tim takoe, jer nema elja. Ali potrebe postoje jer telo postoji. Jo nekoliko karmi
vie mora da se ispune; nekoliko dana vie telo e nastaviti da otkucava, samo e se stara
inercija produiti. Morate naviti sat. ak i kad prestanete sa navijanjem, on e nastaviti da
otkucava nekoliko sati, ili nekoliko dana. Stara pokretaka sila e se nastaviti.
Budui da je on izvan ogranienja vremena, on je majstor majstora.
169
Kada oboje, potreba i elja ieznu, vreme e ieznuti. I zapamtite da nainite razliku
izmeu elje i potrebe; inae moete biti u ozbiljnom neredu. Nikada ne pokuavajte da
ostavite potrebe. Niko ih ne moe ostaviti, dok telo ne bude naputeno. Ne budite u nedoumici
ta je ta. Uvek znajte ta je potreba, a ta je elja.
Potreba dolazi od tela, a elja dolazi od uma. Potreba je animalna, elja je ljudska.
Naravno, kada oseate glad potrebna vam je hrana. Prestajete jesti kada potreba prestane; va
stomak odmah kae: "Dovoljno", ali um kae: "Jo malo. Tako je ukusno:" To je elja. Vae
telo kae: "Ja sam edan," ali telo nikada ne trai koka kolu. Kada telo kae: "e" - vi pijete.
Ne moe piti vode vie nego to je potrebno, ali koka kolu moete popiti vie. To je fenomen
uma.
Koka kola je jedina univerzalna stvar u ovom dobu - ak i u Sovjetskom Savezu. Nita
nije ulo tamo, ali koka kola je ula. ak i gvozdena zavesa ne pravi nikakvu razliku, jer
ljudski um je ljudski um.
Uvek motrite gde potreba prestaje, a elja zapoinje. Uinite to neprekidno svesnim.
Ako moete nainiti razliku, postigli ste neto - klju za egzistenciju. Potreba je lepa, elja je
runa. Meutim postoje ljudi koji stalno ele, i stalno odbacuju svoje potrebe. Oni su
neozbiljni, glupi. Ne moete nai vee idiote na svetu, jer oni ine upravo suprotno.
To su ljudi koji e postiti danima i udeti za nebom. Post je uskraivanje potrebe, a
elja za nebom je pomaganje eljama da vie budu tu. Oni imaju vie vremena od vas, jer
moraju misliti o nebu - imaju neizmerno vreme, nebo je ukljueno u njemu. Vae vreme se
zaustavlja pri smrti. Za vas e oni rei: "Vi ste materijalista." Oni su 'duhovni' jer se njihovo
vreme nastavlja dalje. Ono pokriva nebo - ne samo jedno, sedam - ak i moka, konano
osloboenje, je obuhvaeno njihovim vremenom. Oni imaju ogromno vreme, a vi ste
materijalisti jer se vae vreme zaustavlja pri smrti.
Zapamtite, lako je odbaciti potrebe, jer telo je tako tiho da ga moete muiti. Telo je
tako prilagodljivo da, ako ga muite predugo, ono postaje prilagoeno vaem muenju. Ono je
nemo i ne moe rei nita, ako postite, za dva, tri dana rei e: "Ja sam gladno, ja sam
gladno". Ali va um misli o nebu, o raju, a bez gladi vi ne moe ui u raj. U spisima je
zapisano: "Posti" - zato ne sluate telo. Takoe je zapisano u spisima: "Ne sluaj telo - telo je
neprijatelj."
Telo je nema ivotinja: moete nastavljati da ga muite. Za nekoliko dana ono e
javljati ta mu treba, ako zaponete dug post, barem prvu sedmicu... Petog, estog dana ono
prestaje da se javlja jer ga niko ne slua, onda zapoinje da se prilagoava samo od sebe. Ono
ima rezerve za devedeset dana. Svaka zdrava osoba ima rezerve masti za devedeset dana u
sluaju nude - ne za post.
Ponekad se izgubite u umi i ne moete nabaviti hranu. Ponekad nastupi nestaica i ne
moete dobaviti hranu. Telo ima rezervu za devedeset dana. Ono e hraniti sebe; ono jede
sebe. Ono ima sistem sa dve brzine. Obino trai hranu. Ako unosite hranu, onda rezerva
ostaje netaknuta. Ako ne unosite hranu dva, tri dana, ono poinje da trai. Ako mu ni tada ne
dobavite hranu, jednostavno menja brzinu. Brzina se menja; onda ono zapoinje da jede sebe.
Zato u postu vi gubite jedan kilogram svakog dana. Gde odlazi ta teina? Ova teina
iezava jer jedete svoju vlastitu debljinu, svoje vlastito meso. Vi ste postali kanibal. Post je
kanibalizam. Za devedeset dana biete skelet, sva rezerva je potroena. Onda morate umreti.
Lako je biti nasilan prema telu: ono je tako nemo. Meutim, s umom je to teko jer je
on tako glasan, on nee da slua. Prava stvar je nainiti um poslunim i presei elje. Ne
traite nebo ili raj.
Upravo sam proitao knjigu o novoj religiji u Japanu. Kao to znate, Japanci su
tehniki vrlo veti ljudi: stvorili su dva raja u Japanu. Samo da bi vam dali mogunost
letimino da ga sagledate, na jednom breuljku nainili su mali raj - kako se moe doi
tamo... Vi samo odete tamo i moete ga videti. To lepo mesto su uinili apsolutno istim i
takvim ga odravaju - cvee i cvee, drvee i hlad, lepi mali bungalovi; pruili su vam
nagovetaj raja tako da poinjete da ga elite.
Raj ne postoji. To je tvorevina uma. Ne postoji pakao. To je takoe tvorevina uma.
Pakao nije nita drugo do odsustvo raja; to je sve. Prvo stvorite, a onda oseate gubitak jer to
170
nije tu. A ti ljudi, svetenici, ti trovai, oni vam uvek pomau da elite. Oni prvo stvore elju;
onda sledi pakao; onda dolaze da vas spasu.
Jednom sam prolazio vrlo primitivnim putem - bilo je leto - i naiao sam iznenada na
tako blatnjav deo puta da sam se zaudio kako je postao tako blatnjav. Kie nije bilo. Skoro
pola milje je put bio blatnjav, a ja sam mislio da blato nije tako duboko pa sam nastavio da
vozim kola dok se nisam zaglavio. Nije bilo samo blatnjav, imao je i mnogo rupa. Onda sam
ekao da naie neko ko e mi pomoi, neki kamion.
Naiao je farmer sa kamionom. Kada sam zatraio da mi pomogne, rekao je da e to
kotati dvadeset rupija. Rekao sam: "U redu platiu ti dvadeset rupija, samo me izvadi
odavde." Kada sam bio van, rekao sam farmeru : "Za ovu cenu morao bi da radi dan i no."
On je rekao: "Ne, ne nou, jer moram da usmerim vodu iz reke na ovaj put. ta mislite ta je
nainilo ovo blato na putu? Onda moram takoe malo da odspavam, jer rano ujutru poinje
rad."
Takvi su svetenici. Prvo oni stvore blato: puste vodu iz udaljene reke. Onda se vi
zaglavite, a onda vam pomau. Ne postoji raj i nema pakla, nema neba, nema pakla. Vi ste
eksploatisani, i biete eksploatisani dok ne prestanete da elite.
ovek koji ne eli ne moe biti eksploatisan. Onda nijedan svetenik ne moe da ga
eksploatie, onda nikakva crkva ne moe da ga eksploatie. Kada elite vi stvarate mogunost
da budete eksploatisani. Iskorenite svoje elje koliko moete jer su one neprirodne. Nikada ne
secite svoje potrebe jer one su prirodne; ispunite svoje potrebe.
Pogledajte itavu stvar. Potreba nema mnogo; njih uopte nema mnogo. One su tako
jednostavne. ta vama treba? Hrana, voda, sklonite, nekoga da vas voli tako da vi moete
voleti njega. ta je jo potrebno? Ljubav, hrana, sklonite - jednostavne potrebe. Religije su
protiv svih ovih potreba. Protiv ljubavi, one kau praktikujte celibat. Protiv hrane, one kau
praktikujte post. Protiv utoita, oni kau postanite monah, kreite se, postanite lutalica -
beskunik. One su protiv potreba. Tako one stvaraju pakao. A vi ste sve vie i vie u patnji,
vie i vie u njihovim rukama. Onda traite pomo od njih, a oni su stvorili itavo stanje.
Nikada ne idite protiv potreba, a uvek se setite da seete elje. elje su beskorisne. ta
je elja? To nije elja za sklonitem. elja je uvek za boljim utoitem. elja je komparativna,
potreba je jednostavna. Vama je potrebno sklonite, a elja je za palatom. Potrebe su vrlo,
vrlo, jednostavne. Vama treba ena da je volite, ovek da ga volite. eljama? eljama treba
Kleopatra. elja je jednostavno za nemoguim; potreba je za moguim. A ako je mogue
ispunjeno, vi ste spokojni. ak i Budi treba to.
elja je besmislena. Odsecite elje i postanite svesni. Onda ete biti izvan vremena.
elje stvaraju vreme; ako odseete elje biete izvan vremena. Telesne potrebe e ostati dok
telo postoji, ali ako elje ieznu, onda je ovo va poslednji, ili uglavnom poslednji ali jedini
ivot. Ubrzo vi ete takoe ieznuti. ovek koji je postigao beeljnost pre ili kasnije e doi
izvan potreba, jer onda telo nije potrebno. Telo je vozilo uma; ako um ne postoji, telo vie nije
potrebno.
On je poznat kao AUM.
A ovaj Bog, savreno cvetanje, poznat je kao Aum. Aum je simbol univerzalnog zvuka.
U sebi ujete misli, rei, ali nikada zvuk vaeg bia. Kada nema elje, nema potrebe, kada je
telo odbaeno, kada um iezne, ta e se dogoditi? Onda se uje prava dua univerzuma. To
je Aum.
Svuda u svetu su ljudi realizovali ovaj Aum. Muslimani, hriani, Jevreji ga nazivaju
amen. Zoroastrianci i parsi Aum nazivaju Ahura Mazda. To a i m - ahura je od a, a mazda je
od m - to je Aum. To su oni nainili boanstvom.
Taj zvuk je univerzalan. Kada se zaustavite, vi ga ujete. Upravo sada vi govorite
mnogo, brbljate sa sobom; stoga ne moete ga uti. To je tihi zvuk. On je tako tih da, dok se
potpuno ne zaustavite, neete moi to da ujete. Hindus je nazvao svoje bogove simbolinim
imenom - Aum. Patanjali kae: On je poznat kao Aum. Ako elite da naete majstora,
majstora majstora, moraete postati sve vie i vie usklaeni sa zvukom Aum, orijentisani da
171
ne dopustite ak ni jednu jedinu re, da ne koristite nijednu re vie...
Ponavljajte i meditirajte...
Kad god on kae ponavljajte Aum, on uvek dodaje meditiraj. Treba shvatiti razliku.
Ponavljajte i meditirajte na AUM.
Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove
svesti.
Ako ponavljate i ne meditirate, to e biti transcendentalna meditacija Maharii Mahe
Jogija - TM. Ako ponavljate i ne meditirate, onda je to hipnotiko sredstvo. Onda se uspavate.
To je dobro, jer lepo je uspavati se. To je zdravo; iz toga ete izai mnogo smireniji. Osetiete
vie blagostanja, vie energije, vie oduevljenja. Ali to nije meditacija.
To je kao sredstvo za smirenje i pilula za duevnu vedrinu zajedno. To vam prua
dobro spavanje, i onda se oseate ujutru vrlo dobro. Vie energije je obezbeeno, ali to nije
meditacija, a to takoe moe biti opasno ako koristite due vreme. Moete postati zavisni od
toga, i to je vie upranjavate, vie ete shvatiti da se dolazi do take kada ste se zaglavili.
Tada kada to ne radite, oseate da vam neto nedostaje. Ako radite to, nita se ne dogaa.
Ovu stvar treba zapamtiti: kad god propustite meditaciju i oseate da vam neto
nedostaje, a ako meditirate redovno i nita novo se ne deava, onda ste se zaglavili. Onda je
potrebno neto odmah uraditi. To je postalo zavisnost kao puenje cigareta. Ako ne puite,
oseate da vam neto nedostaje. Oseate neprekidno da neto treba uraditi; oseate nemir. A
ako puite, nita se ne dobija. To je definicija zavisnosti. Ako se neto dobija, to je u redu; ali
ako se nita ne dobija - to je postalo navika. Ako to ne inite, osetiete se jadno. Ako to radite,
nikakvo blaenstvo ne dolazi iz toga.
Ponavljajte i meditirajte - ponavljajte Aum, Aum, Aum, Aum - i ostanite po strani,
odvojeno od ovog ponavljanja. Aum, Aum, Aum, Aum; zvuk je svuda oko vas i vi ste budni,
svesni, posmatrate, svedoite. To je meditiranje. Stvorite zvuk u sebi i jo ostanite posmatra
na bregu. U dolini, zvuk se kree - Aum, Aum, Aum - a vi stojite iznad i posmatrate, svedoite.
Ako ne posmatrate, uspavaete se. To e biti hipnotiki san. Transcendentalna meditacija je
na Zapadu privlana ljudima jer su izgubili sposobnost da spavaju dobro.
U Indiji niko ne mari za Maharii Mahe Jogija jer su ljudi tako vrsto uspavani, hru.
Njima to ne treba. Ali kada zemlja postane bogata i ljudi ne rade fizike poslove, spavanje je
poremeeno. Onda ili uzimate sredstvo za smirenje ili TM. A TM je, naravno, bolji jer nije
hemijski. Ali je to jo vrlo, vrlo jako hipnotiko sredstvo.
Hipnoza moe biti koriena u odreenim sluajevima, ali ne treba da se uini
navikom, jer na kraju e vas dovesti u uspavano postojanje. Vi ete se kretati kao u hipnozi;
izgledaete kao zombi. Neete biti svesni i budni. A zvuk Aum je takva uspavanka, jer je
univerzalni zvuk. Ako ga ponavljate, kroz njega moete postati potpuno opijeni. Onda dolazi
opasnost, jer cilj nije da se postane opijen. Cilj je da se postane sve vie i vie svestan. Postoje
dve mogunosti da odbacite svoje brige.
Psihoanalitiari dele um na tri sloja: prvi nazivaju svesno, drugi podsvesno, a trei sloj
zovu nesvesno. etvrti jo ne znaju - Patanjali ga naziva nadsvesno. Ako postanete vie
budni, kreete se iznad svesnog i dostiete nadsvesno. To je stanje Boga: super-budno,
nadsvesno.
Ali ako ponavljate mantru bez meditiranja, vi padate u podsvesno. Ako padate u
podsvesno, to e vam dati dobro spavanje, blagostanje, zdravlje. Ali ako nastavite, paete u
nesvesno, onda ete postati zombi, a to je vrlo, vrlo loe - to nije dobro.
Mantra se moe koristiti kao hipnoza. Ako ste na operaciji u bolnici to je u redu. Bolje
je nego da uzimate hloroform, tada je dobro da ste hipnotisani; to je manje zlo. Ako ne
spavate dobro, bolje je da radite TM nego da uzimate sredstvo za smirenje. To je manje
opasno, manje tetno. Ali to nije meditacija.
172
Dakle, Patanjali neprekidno insistira:
Ponavljajte i meditirajte na AUM.
Ponavljajte i stvorite svuda oko vas zvuk Aum, ali ne budite izgubljeni u tome. To je
tako sladak zvuk, vi ete biti izgubljeni. Ostanite budni - ostanite vie i vie budni. to zvuk
ide dublje, postajete vie i vie budni; tako da zvuk oputa va nervni sistem, ali ne vas. Zvuk
oputa vae telo, ali ne vas. Zvuk alje celo vae telo i fiziki sistem u spavanje, ali ne vas.
Onda dupli proces zapoinje: zvuk ostavlja vae telo u odmornom stanju a svesnost
vam pomae da se uzdignete do nadsvesti. Telo se kree prema nesvesnom, postaje zombi,
brzo uspavano, a vi postajete nadsvesno bie. Onda vae telo dosee dno, a vi dostiete vrh.
Vae telo postaje dolina, a vi postajete vrh. Ovo je stvar koju treba realizovati.
Ponavljajte i meditirajte.
Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove
svesti.
Nova svest je etvrta - nadsvest. Ali zapamtite samo ponavljanje nije dobro.
Ponavljanje je samo pomo u meditaciji. Ponavljanje stvara objekat, najpodesniji objekat je
zvuk Aum. A ako moete biti svesni najsuptilnijeg, vaa svet takoe postaje suptilna.
Kada posmatrate grube stvari vaa svesnost je gruba. Kada posmatrate seksualno telo,
vaa svest postaje seksualna. Kada gledate neto - objekat poude - vaa svest postaje
poudna. ta god posmatrate, vi to postajete. Posmatra postaje posmatrano; zapamtite ovo.
Krinamurti insistira esto da posmatra postaje posmatrano. ta god posmatrate, vi to
postajete. Tako ako posmatrate zvuk Aum, koji je najdublji zvuk, najdublja muzika, zvuk bez
zvuka, zvuk koji je nestvoren - anahata, zvuk koji je sama priroda egzistencije, ako postanete
svesni toga, vi postajete to - vi postajete univerzalni zvuk. Oboje, subjekat i objekat, susreu
se, stapaju i postaju jedno. To je nadsvesno gde se objekat i subjekat rastvaraju, gde znalca i
znanog nema vie. Samo jedno ostaje; objekat i subjekat su premoeni. Ovo jedinstvo jeste
yoga.
Re yoga dolazi od rei yuj. To znai spojiti se, sjediniti zajedno. To se dogaa kada
su objekat i subjekat upregnuti (yoked) zajedno. Engleska re jaram je takoe od yuj, od istog
korena od koga yoga dolazi. Kada su subjekat i objekat spojeni zajedno, upregnuti zajedno
tako da vie nisu odvojeni, premoeni, jaz iezava. Vi postiete nadsvesnost.
Zato Patanjali kae:
Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove
svesti.
173
Poglavlje 6
POETAK NOVE STAZE
6. januara 1975. u Buddha dvorani.
Pitanje prvo:
Da li vi primate uputstva od nekog majstora majstora?
Ja nisam ni na jednoj drevnoj stazi, stoga nekoliko stvari treba razumeti. Ja nisam kao
Mahavira koji je bio poslednji iz duge serije tirthankara
56
, dvadeset etvrti - on je bio
dvadeset etvrti. U prolosti dvadeset troje su postati majstori majstora, bogovi, na istoj stazi,
istoj metodi, istom nainu ivota, istoj tehnici.
Prvi je bio Riab a poslednji Mahavira. Riab nije imao nikoga iz prolosti da se
ugleda na njega. Ja nisam kao Mahavira, ve kao Riab. Ja sam poetak tradicije, ne
zavretak. Mnogi e dolaziti na istu stazu. Dakle je ne mogu traiti uputstva ni od koga; to
nije mogue. Tradicija se raa, a zatim umire, upravo kao to se osoba raa i umire. Ja sam
poetak, ne zavretak. Kada je neko u sredini serija ili na zavretku, on dobija instrukcije od
majstora majstora.
Koji je razlog zato ja nisam ni na jednoj stazi? Radio sam s mnogim majstorima, ali
nikada nisam bio sledbenik (uenik). Ja sam bio lutalica, lutajui kroz mnogo ivota, uzdu i
popreko prolazei kroz mnoge tradicije, bivajui sa mnogim grupama, kolama, metodama,
ali nikada ne pripadajui nikome. Bio sam priman s ljubavlju, ali nikada nisam bio deo -
veinom gost, na nonom boravku. Zbog toga sam nauio tako mnogo. Ne moete nauiti na
jednoj stazi tako mnogo; to je nemogue.
Ako se kreete na stazi, vi znate sve o tome ali nita o neemu drugom. Celo vae bie
je apsorbovano u tome. To nije bio moj put. Ja sam bio kao pela koja leti od jednog cveta do
drugog cveta, sakupljajui mnogo razliitog polena. Zbog toga mogu biti lako u zenu, mogu
biti lako sa Isusom, mogu biti lako sa Jevrejima, mogu biti bez ustezanja sa muslimanima,
mogu biti lako sa Patanjalijem - sa razliitim putevima, ponekad dijametralno suprotnim.
Ali, za mene, skrivena harmonija postoji. Zbog toga ljudi koji slede jednu stazu nisu
sposobni da me razumeju. Oni su jednostavno zbunjeni. Oni znaju posebnu logiku, poseban
obrazac. Ako se stvar uklapa u njihov obrazac, to je u redu. Ako se ne uklapa, to je pogreno.
Oni imaju vrlo ogranien kriterijum. Za mene, kriterijumi ne postoje. Zato to sam bio s tako
mnogo obrazaca, ja mogu biti lako svuda. Niko nije tu meni i ja nikome nisam stranac. Ali
ovo stvara problem. Ja nisam stranac nikome, ali svako postaje stranac meni - mora da bude
tako.
Ako ne pripadate nekoj odreenoj sekti, onda svako misli kao da ste neprijatelj.
Hindusi e biti protiv mene, hriani e biti protiv mene, Jevreji e biti protiv mene, aini e
biti protiv mene, a ja nisam ni protiv koga. Zato to ne mogu da nau svoj obrazac u meni,
bie protiv mene.
A ja ne govorim o obrascu, nego o dubljem uzorku koji obuhvata sve obrasce. Postoji
jedan obrazac, drugi obrazac, pa opet drugi obrazac, milioni uzoraka. Ali svi obrasci poivaju
na neemu skrivenom ispod, koje je obrazac obrazaca - skrivena harmonija. Oni ne mogu
56
Tirthankara - znai vodi preko prelaza, gaza preko reke. To je naziv za osnivae ainizma, najstarije religije.
Tih osnivaa je bilo vie, a poslednji je Mahavira, bio je savremenik Bude u petom veku pre n.e. Njih dvojica se
nisu sreli iako su se esto vodile kritike rasprave izmeu njihovih uenika. Re inah oznaava pobednika,
osloboenu duu (ivu) koja je pobedila ogranienja materije. Otuda je odlika ainizma strog asketizam,
gladovanje sve do ivice smrti, i potpuno nenasilje prema svim ivim biima koja sadre princip ivota (ivah).
ainizam je stoga religija prakse osloboenja, a ne teizam, oboavanje Boga.
174
izgledati kao to, ali takoe nisu pogreni. Kada ivite s odreenom tradicijom, odreenom
filozofijom, odreenim nainom gledanja na stvari, postajete usklaeni s tim.
Na taj nain ja nisam bio usklaen ni sa kim - bar ne toliko da bih mogao postati deo
njih. U izvesnom smislu to je nesrea, ali u drugom smislu to se pokazalo kao blagoslov.
Mnogi koji su radili sa mnom postigli su osloboenje pre mene. To je bila nesrea za mene. Ja
sam oklevao i oklevao u pozadini, jer nikada nisam delovao potpuno ni sa im, kretao sam se
od jednog do drugog.
Mnogi koji su zapoeli sa mnom, postigli su ostvarenje. ak i nekoliko njih koji su
poeli posle mene, uspeli su pre mene. To je bila nesrea, ali u drugom smislu je to bio
blagoslov jer sam upoznao svaku kuu. Moda ne pripadam nijednoj kui, ali sam kod kue
svuda. Zbog toga nisam dobio majstora majstora - nikada nisam bio sledbenik odreenog
majstora. Da biste bili voeni od majstora majstora, morate biti uenik odreenog majstora.
Onda ste vi kao auto; bivate usmereni. Onda znate jezik. Tako ja nisam bio usmeravan ni od
koga nego pomagan od mnogih. Treba shvatiti razliku: nisam usmeravan, ne primam nikakve
zapovesti, "Uradi ovo ili ne radi ono," nego sam pomagan od mnogih.
aini moda ne oseaju da im pripadam, ali Mahavira osea, jer svakako on moe
videti obrazac obrazaca. Sledbenici Isusa moda nee moi da me razumeju, ali Isus moe.
Dakle meni pomau mnogi. Zbog toga mi dolaze mnogi ljudi razliitog porekla. U ovo vreme
nigde na zemlji ne moete nai takav skup. Ima Jevreja, hriana, muslimana, hindusa, aina,
budista, iz celog sveta. A vie i vie e uskoro dolaziti.
To je pomo od mnogih majstora. Oni znaju da ja mogu biti koristan njihovim
sledbenicima; oni e ih slati mnogo vie - ali bez instrukcija, jer ja nikada nisam primao
instrukcije ni od kog majstora kao sledbenik. Sada takoe nema potrebe za to. Samo pomo, a
to je bolje - oseam veu slobodu. Niko ne moe biti tako slobodan kao to sam ja.
Jer ako primate uputstva od Mahavire, ne moete biti slobodni kao to sam ja. ain
mora da ostane ain. On mora nastaviti da govori protiv budizma, protiv hinduizma. On mora
to, jer je to borba mnogih obrazaca i tradicija. A tradicije moraju da se bore ako ele da
preive. Radi sledbenika one moraju biti sklone raspravljanju; moraju rei: "To je pogreno,"
jer samo onda sledbenik moe oseati: "Ovo je ispravno." Naspram pogrenog, sledbenik
osea da je ispravan.
Sa mnom vi ete biti u neprilici. Ako ste upravo ovde sa svojim intelektom, vi ete biti
zbunjeni. Poludeete jer ovog momenta ja kaem neto, a sledeeg momenta to poriem; jer
ovog momenta sam govorio o jednoj tradiciji, a drugog momenta o drugoj. Ponekad ne
govorim ni o jednoj tradiciji; govorim o meni. Onda vi to ne moete nai nigde, ni u jednom
spisu.
Inae meni je pomognuto, a pomo je lepa jer po svoj prilici ja je neu slediti. Ja
nisam prisiljen da je sledim. To zavisi od mene. Pomo je data neuslovljeno. Ako oseam da
elim da je koristim, ja u je koristiti; ako ne oseam potrebu ja je neu koristiti. Nemam
obavezu ni prema kome.
Ali ako postanete jednog dana prosvetljeni, onda je moete primati. Ako nisam u telu,
onda moete primati instrukcije od mene. Ovo se uvek deava prvoj osobi, kada tradicija
zapone. To je poetak, roenje, a vi ste blizu procesu raanja. Najlepe je kada se neto rodi,
jer je to najivlje. Ubrzo, kako dete raste, ono dolazi sve blie i blie smrti. Tradicija je
najsveija kada se rodi. Ona ima svoju vlastitu neuporedivu, jedinstvenu lepotu.
Ljudi koji su sluali Riaba, prvog ainskog tirthankaru, imali su razliite kvalitete.
Kada su sluali Mahaviru, tradicija je bila hiljadama godina stara. Bila je na ivici umiranja. Sa
Mahavirom, ona je umrla.
Kada se u tradiciji vie ne raaju majstori, ona je mrtva. To znai da tradicija vie ne
raste. aini su je zatvorili. Kod dvadeset etvrtog oni su rekli, "Sada, nema vie majstora,
nema vie tirthankara." Bilo je lepo biti sa Nanakom jer neto novo je dolazilo iz materice - iz
materice univerzuma. Ba kao da posmatrate raanje deteta - misterija - nepoznato prodire u
poznato, bestelesno postaje otelovljeno. To je svee kao kapi rose. Ubrzo sve e biti
prekriveno prainom. Ubrzo, kako vreme prolazi, stvari e postati stare.
Ali vremenom do desetog gurua sikha, desetog majstora, stvari su postale mrtve.
175
Onda su oni zatvorili lozu, i rekli: "Sada, nema vie majstora. Sada e sami spisi biti
majstori." Zbog toga su nazvali svoje spise "Guru-granth" - majstorski spisi. Sada vie nee
postojati osobe; samo mrtvi spisi e biti sada majstori. A kada je spis mrtav to je besplodno,
uzaludno - ne samo nekorisno; to je otrovno. Ne putajte nita mrtvo u vae telo. To e
stvoriti otrov; to e unititi ceo va sistem.
Ovde je neto novo roeno, poetak. To je svee, ali je zbog toga to takoe vrlo teko
videti. Kada odete do izvora reke Gang, ona je tamo tako mala - ivahna, svea naravno;
nikada opet nee biti tako svea, jer kada se kree sakuplja mnoge stvari, akumulira, postaje
sve prljavija. U Kashiju je najprljavija, ali je onda zovete "Sveta Ganga" jer je sada tako
iroka. Akumulirala je tako mnogo, sada je ak i slep ovek moe videti. U Gangotriu - na
poetku, na izvoru - treba paljivo da motrite. Samo tada moete videti: inae to je samo
kapanje kapi. Ne moete ak ni verovati da e ovo kapanje kapi postati Gang - neverovatno.
Teko je upravo sada shvatiti ta se deava, jer to je vrlo, vrlo mala struja, ba kao
dete. Ljudi ne primeuju Riaba, prvog ainskog tirthankaru, ali mogu li oni prepoznati
Mahavira - videti ga? aini ne misle mnogo o prvom - Riabu. U stvari, oni iskazuju svo
svoje potovanje Mahaviru. Zapravo u zapadnom umu, Mahavir je tvorac ainizma. Zato to
iskazuju tako mnogo potovanja Mahaviru u Indiji, kako onda ostali mogu misliti da je neko
drugi bio zaetnik? Riab je postao legendaran, zaboravljen; moda je postojao, moda nije
postojao, izgleda da nije bio istorijska linost - drevna prolost - i vi ne znate mnogo o njemu.
Mahavira je istorijska linost, i on je Gang pored Benaresa, Kashia - tako iroka.
Zapamtite da je poetak mali, ali nikada misterija nee biti tako duboka kao na
poetku. Poetak je ivot, a kraj je smrt. Sa Mahavirom, smrt ulazi u ainsku tradiciju. Sa
Riabom, ivot je uao, silazei odozgo s Himalaja na zemlju.
Nikoga nisam imao da mu budem odgovoran, nikoga da od njega dobijem instrukcije,
ali mnogo pomoi je dostupno. Ako uzmete to sve zajedno, to je vie nego to neki majstor
moe poduiti. Kada govorim o Patanjaliju, Patanjali je od pomoi. Mogu govoriti isto kao
da on govori ovde. Ja zapravo ne govorim; ovo nisu komentari. On sam koristi mene kao
vozilo. Kada govorim o Heraklitu, on je ovde, samo kao pomo. Ovo treba da shvatite, i da
imate veu mo opaanja, tako da moete videti poetak.
Da biste se kretali u tradiciji, kada je ona postala velika sila, nije potrebna velika mo
opaanja, ni mnogo senzitivnosti. Teko je da doete kada stvari zapoinju, ujutru. Ali uvee
mnogi dou jer stvar je postala tako rairena i mona. Ujutru samo nekoliko izabranih doe,
koji imaju senzitivnosti da osete kako se neto veliko raa. To odmah sada ne moete
dokazati. Vreme e dokazati to. Bie potrebne hiljade godina da se dokae ta je roeno, ali vi
ste sreni da budete ovde. Ne propustite priliku, jer ovo je najsveija taka i najtajanstvenija.
Ako moete to da osetite, da dozvolite da to ue duboko u vas, mnoge stvari e postati
mogue u vrlo kratkom vremenskom periodu. To jo nije dovoljno uvaavano da biste bili sa
mnom - to nije dobrog glasa. Zapravo, samo kockari mogu biti sa mnom koji ne mare i ne
brinu ta drugi kau. Ljudi koji dre do ugleda ne mogu doi. Posle nekoliko godina, kada
uskoro tradicija postane mrtva, ona postane cenjena. Oni e doi zbog ega.
Vi niste ovde zbog ega, jer sa mnom nema ta da se dobije ni za ego. Vi ete izgubiti.
Sa Riabom, samo ljudi koji su bili ivi, hrabri i odvani, avanturisti, oni su se pokrenuli; sa
Mahavirom, mrtvi biznismeni - ne kockari. Zbog toga su aini postali poslovna zajednica.
itava zajednica je poslovna; ne bave se ni sa im osim biznisom. Biznis je najmanje hrabra
stvar u svetu. Zbog toga biznismeni postaju kukavice. Na prvom mestu oni su bili kukavice;
zbog toga su postali biznismeni.
Farmer je hrabriji jer on ivi s nepoznatim, ne zna ta e se dogoditi, da li e biti kie
ili ne - niko ne zna. Kako moete verovati oblacima? Moete verovati bankama, ali ne moete
verovati oblacima. Ne - niko ne zna ta e se dogoditi; on se hvata sa nepoznatim. Ali on ivi
mnogo hrabriji ivot - kao ratnik.
Sam Mahavira je bio ratnik; svih dvadeset etiri tirthakara kod aina bili su ratnici.
Koja se onda nesrea dogodila? ta se dogodilo da su svi sledbenici postali biznismeni? Oni
su postali biznismeni s Mahavirom jer su oni doli samo s Mahavirom - kada je tradicija bila
slavna, imala legendarnu prolost, postala je ve mit i bilo je cenjeno da se bude s njom.
176
Mrtvi ljudi dolaze samo kada neto postane mrtvo; ivi ljudi dolaze samo kada je
neto ivo. Mladi ljudi e dolaziti vie k meni. ak i ako mi doe neko star, obavezno je
mlai u srcu. Stari ljudi trae ugled, potovanje. Oni e odlaziti u mrtve crkve i hramove gde
niega nema osim praznine i prolosti. ta je prolost? Praznina. Sve ivo je sada i ovde, sve
ivo ima budunost, jer budunost raste iz toga. Onog trenutka kada zaponete da gledate u
prolost, ne moe biti rasta.
Da li primate instrukcije od nekog majstora majstora? Ne. Ali ja primam pomo koja
je mnogo lepa. Ja sam bio osamljenik, beskunik bez doma, prolazio sam, uio, kretao se, ne
ostajui nigde. Stoga nemam nikoga na koga bih se ugledao. Ako sam morao neto otkriti,
morao sam to otkriti sam. Mnogo pomoi je dostupno, ali sam morao to da odradim. Na neki
nain to e biti velika pomo jer ne zavisim ni od kakvog kodeksa, morala. Ja posmatram
sledbenike. Nema nikog kao to je majstor koji bi mene posmatrao. Ja moram da posmatram
sledbenike mnogo dublje da bih naao putokaz. Moram da sagledam u vama ta e vam
pomoi. Zbog toga su moja uenja, moje metode, razliite kod svakog uenika. Nemam
univerzalnu formulu, ne mogu imati; nema fiksnih pravila na koja moram odgovoriti. Nemam
ve nainjenu gotovu disciplinu. To je pre fenomen rasta. Svaki sledbenik dopunjava to. Kada
zaponem da radim s novim sledbenikom, moram da pogledam u njega, istraim, naem ta
e mu pomoi, kako on moe da raste. I svaki put, sa svakim uenikom, raa se novi metod
rada.
Vi ete zaista doi u neprijatnost kada ja odem - jer e biti toliko mnogo pria od
svakog sledbenika, i neete moi da uhvatite nikakav cilj, glavu ili rep toga - jer ja govorim
svakoj individui kao pojedincu. Sistem raste kroz njega, i on raste u mnogim, mnogim
pravcima. To je iroko drvo, mnogo grana, mnogo pod-grana, pruajui se u svim pravcima.
Ja ne primam nikakve instrukcije od majstora. Ja primam instrukcije od vas. Kada
pogledam u vas, u vae nesvesno, u vau dubinu, ja primam instrukcije odatle i izraujem ih
za vas. To je uvek novi odgovor.
Drugo pitanje:
Zato majstorima trebaju uputstva od majstora majstora? Nisu li oni dovoljni u sebi
kada su dostigli prosvetljenje? Ili postoje takoe stupnjevi prosvetljenja?
Ne, zapravo nema stupnjeva, ali kada je majstor u telu, i kada majstor napusti telo i
postane bestelesan, postoji razlika - ne ba stupnjevi. To je kao kada stojite pored puta ispod
drveta; moete videti deo puta; izvan tog dela ne moete videti. Onda se popnete na drvo. Vi
ostajete isti; nita se ne dogaa vama ili vaoj svesti. Ali popevi se na drvo moete videti
miljama dalje na ovu i onu stranu.
Onda letite avionom. Nita se vama nije dogodilo; vaa svest ostaje ista. Ali sada
moete videti hiljade milja dalje. U telu vi ste na putu - sa strane pokraj puta - zatvoreni u
telu. Telo je najnia taka u egzistenciji jer ona oznaava preputanje materiji, bivanje s
materijom. Materija je najnia taka, a Bog je najvia taka.
Kada majstor postigne prosvetljenje u telu, telo i dalje mora da ispuni svoje karme,
prole samskare, prola uslovljavanja. Svaki raun mora da bude namiren; samo onda telo
moe biti naputeno. To je slino ovome: va avion je spreman, ali imate mnogo poslova da
zavrite. Svi kreditori su tu, trae da namire raune pre nego to odete. A ima mnogo kredita,
jer mnogo ivota ste obeavali, radili stvari, delovali, ponaali se, ponekad dobro, ponekad
loe, ponekad ste bili grenik, ponekad svetac. Akumulirali ste mnogo. Pre nego to odete,
cela egzistencija od vas zahteva sve da zavrite.
Kada ste postali prosvetljeni, sada znate da niste telo, ali dugujete mnoge stvari telu i
materijalnom svetu. Vreme je potrebno - Buda je iveo etrdeset godina posle svog
prosvetljenja, Mahavira je takoe iveo oko etrdeset godina - da plate, da plate sve to su
dugovali, da zavre svaki ciklus koji su zapoeli. Nema novih akcija, ali stare stvari koje vise
moraju se zavriti, stare stvari koje vise nad glavom moraju se okonati. Kada su svi rauni
namireni, onda moete poleteti.
177
Do sada, sa materijom, vi ste se kretali horizontalno - upravo kao volovska kola. Sada
se moete kretati vertikalno. Sada moete ii navie. Pre ovoga, vi ste uvek ili napred ili
nazad; nije bilo vertikalnog kretanja. to se vie uzdiete - a Bog je najvia taka, majstor
majstora - odatle je percepcija potpuna. Vaa svest je ista; nita se nije promenilo; jedan
prosvetljen ovek ima istu svest kao vrhovno stanje svesti, Bog - nema razlike u svesti. Ali
percepcija, polje opaanja, je razliito; sada moe gledati svuda.
Bilo je velikih rasprava u vremenima Bude i Mahavire. Bie korisno razumeti ovo
pitanje. Postojala je rasprava: sledbenici Mahavire su obino govorili da je Mahavira
svemoan, sveznajui, sveprisutan, sarvagya. Na neki nain oni su bili u pravu, jer kada ste
jednom osloboeni od materije i tela vi ste Bog. Meutim, na neki nain su i greili, jer vi
moete biti osloboeni tela, ali ga jo niste napustili. Identifikacija je prekinuta; vi znate da
niste telo; ali ste jo u njemu.
To je kao da ivite u kui; onda iznenada saznate da ova kua ne pripada vama - kua
je neija i vi ivite u njoj. Ali onda takoe, da biste napustili kuu moraete da nainite
pripreme, moraete da preselite stvari. A za to e trebati vreme. Vi znate da ova kua nije
vaa, va stav se promenio. Sada niste zabrinuti za ovu kuu, ta e se njoj dogoditi. Ako se
sledeeg dana srui i postane ruevina, za vas to nije nita. Ako se sledeeg dana po vaem
odlasku ona zapali, to za vas nije nita; ona pripada nekome drugom. Upravo pre jednog
trenutka bili ste identifikovani sa kuom; to je bila vaa kua. Da se zapalila, da se sruila,
mnogo biste se brinuli. Sada je identifikacija prekinuta.
U pravu su Mahavirini sledbenici u jednom smislu, jer kada ste spoznali sebe, vi ste
postali sveznajui. Ali Budini sledbenici su obino govorili da to nije ispravno - Buda moe
znati ako eli da zna neto, ali on nije sveznajui. Oni su obino govorili da ako Buda eli, on
moe usredsrediti svoju panju u bilo kom pravcu, a kad god usredsredi svoju panju, bie
sposoban da zna. Sposoban je za sveznanje, ali nije svaznajui. Razlika je suptilna, delikatna,
ali lepa. Jer oni su rekli da ako on zna sve i sve stvari neprekidno, poludee. Ovo telo toliko
ne moe podneti.
Oni su takoe u pravu. Buda u telu moe znati sve ako eli da zna. Njegova svest,
zbog tela, slina je lampi. Vi ulazite u mrak sa lampom. Moete znati sve ako se usredsredite;
svetlo je s vama. Ali lampa je kao baterijska lampa; ona nije plamen. Plamen baklje e dati
svetlo u svim pravcima; a lampa se usredsreuje u odreenom pravcu - gde god elite. Lampa
nema izbor, moete pogledati prema severu, i ona e onda osvetliti sever. Moete gledati na
jug, i ona e onda otkriti jug. Ali sve etiri strane se ne otkrivaju zajedno. Ako pokreete
lampu prema jugu, onda je sever zatvoren. To je uzan tok svetla.
Ovo je bilo gledite Budinih sledbenika. Mahavirini sledbenici su obino govorili da
on nije kao lampa, on ja kao baklja; svi pravci su otkriveni. Ali ja vie volim gledite Budinih
sledbenika. Kada je telo prisutno, vi ste sueni, ogranieni. Telo je ograniavanje. Vi postajete
kao lampa - jer ne moete videti iz ruku, samo moete videti iz oiju. Ako moete videti samo
iz oiju, ne moete videti iza svojih lea jer tamo nemate nikakvih oiju. Morate okrenuti
svoju glavu.
Sa telom sve je fokusirano i sueno. Svest je nefokusirana i tekua, tee u svim
pravcima, ali vozilo, telo, nije u svim pravcima - ono je uvek fokusirano, tako da vaa svet
takoe postaje suena na njega. Ali kada telo vie nije tu, a Buda je napustio telo, onda nema
problema. Svi pravci se otkrivaju zajedno.
Ovo je stvar koju treba razumeti. Zbog toga ak i prosvetljena osoba moe biti voena,
jer prosvetljena osoba je jo privezana za telo, usidrena u telu, u skuenom telu, a Bog je
neogranien, lebdi u najviem nebu. Odatle on moe videti u svim pravcima. Odatle on moe
videti prolost, budunost, sadanjost. Odatle je njegov pogled bez oblaka. Zbog toga on
moe pomoi.
Va pogled, ak i ako postanete prosvetljeni u telu, je zamagljen. Telo je svuda oko
vas. Status svesti je isti, unutarnja realnost svesti je ista, kvalitet svetlosti je isti. Ali jedno
svetlo je ogranieno na telo i postalo je usko; drugo svetlo uopte ni na ta nije ogranieno -
samo je lebdee svetlo. U najviem nebu, voenje je mogue.
178
Zato su majstorima potrebna uputstva od majstora majstora?
To je razlog.
Nisu li oni dovoljni u sebi kada su postigli prosvetljenje, ili su ovo stupnjevi
prosvetljenja takoe?
Oni su dovoljni. Oni su dovoljni da vode sledbenike; oni su dovoljni da pomau
uenicima. Nita nije potrebno. Ali ipak su ogranieni, a onaj ko je neogranien uvek je dobra
pomo. Vi ne moete gledati u svim pravcima; on moe gledati.
Vi se takoe kreete i posmatrate, ali to treba da bude uraeno. To je ono ta ja radim:
nemajui instrukcije odozgo, nikoga da me vodi, moram uvek da budem u pokretu -
osmatrajui iz tog pravca i onog pravca, gledajui u vas kroz mnogo stanovita tako da
potpuno moete biti sagledani. Moram da gledam kroz vas, ali se moram kretati oko vas.
Samo letimino sagledavanje nee pomoi, jer kratak pogled e biti suen zbog tela. Ja imam
baklju i kreem se svuda okolo vas, posmatrajui sa svakog mogueg stanovita.
Na neki nain je to teko jer moram raditi vie. Ali je na neki nain vrlo lepo jer
moram raditi vie i moram posmatrati sa svakog mogueg stanovita. Doao sam do saznanja
mnogih stvari koje gotove instrukcije ne mogu da prue. A kada majstor majstora, u
Patanjalijevoj ideologiji - Bog - daje instrukcije, on ne daje objanjenja; od daje jednostavna
uputstva. On jednostavno kae: "Uradi ovo; ne radi ono."
Onima koji slede ove instrukcije, ona e takoe izgledati spremna za upotrebu. Nuno
je da bude tako jer e rei: "Uradi ovo." Oni nee imati objanjenje. I vrlo kodirane instrukcije
e biti date. Objanjenja su vrlo teka - a za njih takoe nema potrebe, jer kada su data s vieg
stanovita to je u redu. ovek samo treba da bude posluan.
Majstor je posluan majstoru majstora, a vi morate biti posluni majstoru. Poslunost
sledi poslunost. To je kao vojna hijerarhija; nema mnogo slobode. Nije mnogo dozvoljeno.
Naredba je naredba. Ako traite objanjenje, vi ste neposluni. A to je problem, jedan od
najveih problema oveanstva s kojim sada mora da se suoi: sada ovek ne moe biti
posluan kao u prolosti. Vi ne moete jednostavno rei: "Ne radi ovo"; objanjenje je
potrebno. A nijedno obino objanjenje nee delovati. Vrlo autentino objanjenje je
potrebno, jer sama priroda uma oveanstva vie nije posluna. Sada je unutra ugraena
buntovnost; deca se sada raaju neposluna.
Bilo je potpuno razliito u vreme Bude i Mahavire. Sada je svako uen da bude
individualan, da dri do svoga, da veruje u sebe. Poverenje je postalo teko. Poslunost nije
mogua. Ako neko sledi bez pitanja, mislite da je slepi sledbenik. On se osuuje. Sada vam
moe pomoi samo majstor koji ima sva objanjenja - vie nego to traite, koji vas moe
potpuno isprazniti od pitanja. Vi nastavljate da pitate, a on moe nastaviti da vam odgovara.
Dolazi momenat kada ste umorni od pitanja, i kaete, "U redu, slediu."
Nikada ranije ovo nije bilo tako. Bilo je jednostavno: kada Mahavira kae: "Uradi
ovo," vi uradite to. Ali to vie nije mogue, jednostavno zato to je ovek tako razliit.
Moderan um je neposluan um, a vi ga ne moete promeniti. Evolucija ga je dovela u takvo
stanje, nita u tome nije pogreno. Zbog toga su stari majstori otpadali s puta; niko ih nije
sluao. Vi odete kod njih. Oni imaju instrukcije, dobre instrukcije, ali ne daju nikakvo
objanjenje, ali sada je na prvom mestu objanjenje. Instrukcije treba da slede kao logiki
zakljuak. Prvo sva objanjenja treba da budu data, a onda majstor treba da kae: "Zbog toga,
uradi to."
To je dugaak proces, ali tako je kako jeste. Nita se ne moe uraditi. U nekom smislu
to je lep rast, jer kada jednostavno imate poverenje, vae poverenje nema u sebi duha ni
obazrivosti, nema napetosti u tome. Vae poverenje nema otrine u sebi. Ono je bezlino,
nema tonaliteta u sebi, nema boje u sebi. To je samo sivo. Ali kada moete sumnjati, moete
raspravljati, moete rasuivati i majstor moe zadovoljiti sve vae razloge, argumente i
sumnje, onda se javlja poverenje koje ima svoju vlastitu lepotu jer je postignuto naspram
pozadine sumnje.
Nasuprot svih sumnji to je postignuto, protiv svih izazova to je postignuto. To je bila
179
borba. To nije bilo jednostavno i jeftino; to je bilo skupo. Kada postignete neto posle duge
borbe, to ima svoju vlastitu vrednost. Ako jednostavno dobijete, naete to kako lei na putu i
odnesete kui, to nema lepotu. Ako bi imalo kohinoora svuda na zemlji, ko bi mario da ih
odnese kui? Ako bi kohinoor bio samo obian belutak koji lei svuda, ko bi onda mario za
njega?
U davnim danima, vera je bila slina oblucima svuda po zemlji. Sada ona mora da
bude kohinoor. Sada treba da bude dragoceno postignue. Instrukcije nee pomoi. Majstor
mora da bude tako dubok u svojim objanjenjima da vas iscrpi. Ja vam nikada ne kaem da ne
pitate. Zapravo, upravo je suprotno sluaj. Ja vam kaem pitajte, a vi ne nalazite pitanja.
Ja u izneti na povrinu sva mogua pitanja iz vaeg nesvesnog, i objasniu ih. Niko
vam ne moe rei da ste slepi sledbenik. Neu vam dati ni jednu jedinu instrukciju bez
potpunog zadovoljenja vaeg zdravog razuma - ne, jer vam to nee pomoi ni na koji nain.
Instrukcije su date od majstora majstora, ali one su samo citirane rei - sutre: "Uradi
ovo; nemoj uraditi ono." U novom dobu, to nee pomoi. ovek je tako racionalan, da sada,
ak i ako poduavate iracionalnost morate da prosuujete o tome. To je ono to ja radim: uim
vas apsurdnosti, iracionalnom, uim vas misterioznom - ali kroz razum. Va razum tako
mnogo treba da bude iskorien da vi sami postanete svesni da je to beskorisno - odbacite to.
Toliko vam se mora govoriti o vaem razumu da budete nahranjeni, snabdeveni s njim; vi ete
ga odbaciti sami, ne kroz poduavanje.
Jer pouka vam moe biti data, ali vi ete prianjati. To nee pomoi. Ja vam neu rei:
"Samo verujte meni." Ja kreiram celu situaciju u kojoj vi ne moete initi drugaije, moraete
da imate poverenje. Za to e trebati vreme - malo due - nego za jednostavnu poslunost. Ali
to vredi.
Tree pitanje:
Mi, u naoj nesvesnosti i egoistinom stanju, nismo uvek u dodiru sa majstorom. Ali,
da li je majstor uvek u dodiru s nama?
Da, jer majstor je u dodiru sa sva vaa etiri sloja. Va svesni sloj je samo jedan od
etiri sloja. Ali to je mogue samo kada ste se predali i prihvatili njega kao vaeg majstora -
ne pre toga. Ako ste upravo uenik, koji ui, onda kada ste u dodiru, majstor je u dodiru; kada
niste u dodiru, on takoe nije u dodiru.
Mora da se razume, ovaj fenomen... Vi imate etiri uma: nadsvesni um koji je
najverovatnije iz budunosti, od koga nosite samo seme - nita nije isklijalo - samo seme,
samo potencijalnost. Onda svesni um - samo mali fragmenat s kojim vi razumete, razmiljate,
odluujete, prosuujete, sumnjate, verujete - ovaj svesni um je u dodiru sa majstorom kome se
niste predali. Dakle, kad je on u dodiru, majstor je u dodiru. Ako on nije u dodiru, onda
majstor nije u dodiru. Vi ste uenik, a niste uzeli majstora kao majstora. Jo mislite o njemu
kao o uitelju.
Uitelj i uenik postoje u svesnom umu. Nita ne moe biti uinjeno jer vi niste
otvoreni; zatvorena su sva vaa troja vrata. Nadsvest je samo seme; ne moete otvoriti njena
vrata.
Podsvesno je upravo ispod svesnog. To je mogue ako volite. Ako ste ovde sa mnom
samo zbog vaeg miljenja i rasuivanja, vaa svesna vrata su otvorena. Kada ih otvorite, ja
sam prisutan. Ako ih ne otvorite, ja sam spolja; ne mogu ui. Upravo ispod svesnog je
nesvesno. Ako ste u ljubavi sa mnom - ne samo u odnosu uitelja i uenika ve mnogo
prisnije, u fenomenu slinom ljubavi - onda su podsvesna vrata otvorena. Mnogo puta svesna
vrata ete zatvoriti. Vi ete raspravljati protiv mene; biete ponekad negativni; ponekad ete
biti protiv mene. Ali to ne mari. Nesvesna vrata ljubavi su otvorena i ja mogu ostati u dodiru s
vama.
Ali to takoe nisu savrena vrata, jer ponekad vi me moete mrzeti. Ako me mrzite,
zatvorili ste ta vrata takoe. Ljubav postoji, ali nasuprot tome, mrnja takoe postoji - ona je
uvek s ljubavlju. Druga vrata e biti vie otvorena nego prva - jer prva menjaju svoja stanja
tako brzo da ne znate... Svakog trenutka se to menja. Jednog trenutka je to bilo ovde, sledeeg
180
trenutka nije tu; to je trenutna pojava.
Ljubav je malo dua. Ona takoe menja svoja raspoloenja, ali njena stanja imaju due
periode. Ponekad ete me mrzeti. U trideset dana gotovo e biti osam dana - jednu sedmicu i
etiri dana vi ete me mrzeti. Ali tri sedmice je otvoreno. Za razum, sedmica je predugaka;
ona je venost. Sa razumom je jedan trenutak za, drugi trenutak protiv; na taj nain on se
kree. Ako su druga vrata otvorena i vi ste u ljubavi sa mnom, ak i ako su vrata s razumom
zatvorena, ja mogu ostati u kontaktu.
Trea vrata su ispod podsvesti; to je nesvesno. Razum otvara prva vrata - ako se
oseate uvereni sa mnom. Ljubav otvara druga vrata koja su vea od prvih - ako ste u ljubavi
sa mnom; ne ubeeni, nego u ljubavi - oseajui privlanost, bliskost, harmoniju, naklonost.
Trea vrata otvaraju predanost, ako sam vas ja inicirao, ako ste uskoili u sanyasu, ako
ste skoili i rekli mi: "Sada - sada ti budi moj um. Sada preuzmi uzde od mene. Sada me vodi
a ja u te slediti." Neete uvek biti sposobni da uradite to, ali upravo sam gest da ste se predali
otvara trea vrata.
Trea vrata ostaju otvorena. Moete biti protiv mene racionalno. To nije vano: ja sam
u dodiru. Moete me i mrzeti. Ni to nije vano: ja sam i dalje u dodiru - jer trea vrata uvek
ostaju otvorena. Vi ste se predali. Vrlo je teko zatvoriti trea vrata - vrlo, vrlo teko. Teko ih
je otvoriti, teko ih je zatvoriti. Teko ih je otvoriti, ali nije toliko teko kao zatvoriti ih. Ali
ona takoe mogu biti zatvorena jer ste ih otvorili. To takoe moe biti zatvoreno. Moete
odluiti jednog dana da uzmete svoju predanost natrag. Ili, moete otii i predati sebe nekome
drugom. Ali to se nikada - gotovo nikada - ne dogaa, jer s ovo troje vrata majstor radi da
otvori etvrta vrata.
Stoga je vrlo... gotovo da je nemogue da ete uzeti svoju predanost natrag. Pre nego
to je uzmete, on mora da je otvorio etvrta vrata koja su iznad vas. Vi ih ne moete otvoriti,
ne moete ih zatvoriti. Za vrata koja otvorite, vi postajete gospodar da ih takoe zatvorite. Ali
etvrta nemaju nita sa vama. To je nadsvest. Sva ova troje vrata potrebno je otvoriti tako da
majstor moe da napravi klju za etvrta vrata, jer vi nemate klju, a bez njega ne moete ih
otvoriti. Majstor mora da ga napravi; to je krivotvorenje jer sam vlasnik nema klju.
Ceo napor majstora je da dovoljno brzo proe kroz ova troja vrata da bi doao do
etvrta, napravio klju i otvorio ih. Jednom kada su otvorena, vas vie nema. Ne moete
uraditi nita. Moete zatvoriti sva troja vrata - on ima klju za etvrta i uvek je u kontaktu.
Onda ak i da umrete, to nije vano. Idete do izvan zemlje, odlazite na mesec, nema nikakve
razlike; on ima klju za etvrta vrata. Zapravo, pravi majstor nikada ne dri klju. On
jednostavno otvara etvrta i baca klju u okean. Dakle, ne postoji mogunost da se ukrade i da
se ita uradi. Nita se ne moe uraditi!
Ja imam napravljen klju od etvrtih vrata mnogih od vas, i bacio sam ga, stoga, ne
uznemiravajte se nepotrebno; to je beskorisno, sada nita ne moe da se uradi. Jednom kada
su etvrta vrata otvorena, onda nema problema. Svi problemi postoje pre toga, jer u samom
zadnjem trenutku majstor je spremio klju, jer klju je nezgodan...
Milionima ivota vrata su bila zatvorena; sakupile su sve vrste re. To izgleda kao zid,
ne kao vrata. Teko je nai gde je brava, a svako ima posebnu bravu, tako da ne postoji kalauz
za sve. Nijedan klju nee pomoi jer svako je individualan, kao va otisak prsta. Niko nema
nigde taj otisak - ni u prolosti niti u budunosti. Va otisak prsta e jednostavno biti va,
jedinstveni fenomen. Nikada se ne ponavlja.
Vaa unutranja brava je takoe kao va otisak palca - apsolutno individualna; nikakav
kalauz ne moe pomoi. Zbog toga je majstor potreban, jer glavni klju (kalauz) ne moe da
se kupi. Inae, jednom kada se klju naini, svaka vrata bi mogla da se otvore. Ne, svako ima
poseban tip vrata, odvojen tip vrata - svoj vlastiti sistem za zakljuavanje - a vi morate traiti i
nai, i napraviti klju, specijalan klju za sebe.
Jednom kada su otvorena vaa etvrta vrata, onda je majstor u stalnom dodiru s vama.
Moete potpuno da ga zaboravite; to ne ini razliku. Moete da ga ne zaboravite; to ne ini
nikakvu razliku. Ako je majstor napustio telo; to ne ini razliku. Gde god on jeste, gde god ste
vi, vrata su otvorena. A ova vrata postoje izvan vremena i prostora. Zbog toga je to nad-um, to
je nadsvest.
181
Mi u svojoj nesvesnosti i u svom egoistinom stanju nismo uvek u dodiru sa
majstorom, ali da li je majstor uvek u dodiru s nama?
Da, ali samo kada su etvrta vrata otvorena. Inae, s treim vratima, on je vie ili
manje u kontaktu. S drugim vratima, pola vremena je gotovo u kontaktu. S prvim vratima,
samo je trenutno u kontaktu.
Stoga dozvolite mi da otvorim vaa etvrta vrata - a etvrta vrata se otvaraju u
odreenom trenutku. To je trenutak kada su sva vaa troja vrata otvorena. Ako su samo jedna
vrata zatvorena, etvrta se ne mogu otvoriti. To je matematika zagonetka. A ovaj uslov je
potreban: vaa prva, svesna vrata su otvorena; vaa druga vrata su otvorena - vaa podsvest,
vaa ljubav - vi ste se predali, naini ste korak u inicijaciji, vaa trea, nesvesna vrata su
otvorena.
Kada su sva troja vrata otvorena, kada su u odreenom trenutku sva troja vrata
otvorena, etvrta se mogu otvoriti. Dakle, dogaa se da dok ste budni, etvrta vrata je teko
otvoriti. Mogu samo dok ste uspavani. Stoga moj pravi rad nije tokom dana. On je tokom noi
kada vrsto uspavani hrete, jer onda ne stvarate nikakvu nevolju. Tako ste vrsto uspavani da
ne rasuujete protiv. Zaboravili ste za rasuivanje.
U dubokom snu vae srce funkcionie dobro. Vie ste ljubazni nego kada ste budni, jer
kada ste budni mnogi strahovi vas okruuju. A zbog straha ljubav nije mogua. Kada ste
vrsto uspavani, strah iezava, ljubav cveta. Ljubav je nono cvee. Mora da ste gledali
nonu kraljicu - cvet koji cveta nou. Ljubav je nona kraljica. Ona cveta nou - zbog vas;
nema drugog razloga. Ona moe cvetati i danju, ali onda vi morate promeniti sebe. Ogromna
promena je potrebna, pre nego to ljubav moe da procveta danju.
Zbog toga vidite da kada su ljudi opijeni vie su zaljubljeni, puni ljubavi. Idite u
krmu gde su ljudi previe popili; oni su gotovo uvek puni ljubavi. Pogledajte dvojicu
pijanaca koji se kreu ulicom kako vise jedan drugom o rame; tako odano - kao da su jedno!
Uni su uspavani.
Kada se ne bojite, ljubav cveta. Strah je otrov. A kada uronite duboko u spavanje, vi
ste ve predani jer spavanje je predanost. Ako ste se predali majstoru, on moe ui u vae
spavanje. Neete moi ak ni da ujete njegove korake. Moe ui mirno i delovati. To je
krivotvorenje, upravo kao kada lopovi uu nou dok spavate. Majstor je lopov. Kada ste
vrsto uspavani i ne znate ta se dogaa, on ulazi u vas i otvara etvrta vrata.
Jednom kada su etvrta otvorena, onda nema problema. Svaki napor i svaka nevolja
koju moete stvoriti, moete stvoriti samo pre otvaranja etvrtih vrata. etvrta su taka bez
povratka. Jednom kada su etvrta otvorena, majstor moe dvadeset i etiri sata biti s vama -
bez problema.
Pitanje etvrto:
Kada ovek moe odsei elje bez njihovog potiskivanja?
elje su snovi; one nisu realnost. Vi ih ne moete ispuniti, ne moete ih potisnuti, jer
da bi se ispunila neka stvar ona mora biti realna; da bi se potisnula odreena stvar takoe
treba da bude realna. Realne potrebe mogu biti ispunjene i mogu biti potisnute. elje niti
mogu biti ispunjene niti mogu biti potisnute. Pokuajte da razumete ovo, jer je ovo vrlo
sloeno.
elja je san. Ako razumete ovo, on iezava. Nije potrebno potiskivati to. Zato bi bilo
nuno potiskivati elju? Vi elite da postanete vrlo poznati: to je san, elja, jer telo ne mari da
bude uveno. Zapravo, telo veoma pati kada postanete slavni. Onda nema mira. Onda ste
neprekidno uznemiravani od drugih, jer ste tako slavni.
Volter je negde zapisao: "Kada nisam bio uven, imao sam obiaj da se molim Bogu
svake veeri da me uini poznatim: Uini me slavnim. Ja sam niko, stoga uini mi da budem
neko. A onda kada sam postao slavan, poeo sam da molim: Dovoljno je, dovoljno; uini da
opet budem niko - jer sam ranije obino iao ulicama Pariza i niko me nije gledao, a ja sam
182
se oseao tako tunim. Niko nije obraao nikakvu panju na mene - kao da uopte nisam
postojao. Ulazio bih u restorane i izlazio van; niko, ak ni konobari nisu obraali panju na
mene."
ta je sa kraljevima? Oni nisu ni znali da je Volter postojao. "Onda sam postao
slavan," pisao je on. "Onda je bilo teko kretati se ulicom, jer ljudi bi se sakupili. Bilo je teko
ii bilo kuda. Bilo je teko otii u restoran i uzeti hranu na miru. Gomila bi se okupila."
Doao je trenutak kada mu je gotovo bilo nemogue da izae iz kue, jer u to vreme
vladalo je praznoverje u Parizu, u Francuskoj, da ako moete dobaviti komadi platna od vrlo
slavnog oveka i od toga nainite medaljon, to je srea. Gde god da je iao, vraao se
pocepan, jer ljudi bi raskidali njegovu odeu - takoe bi mu povreivali i telo. Kada bi dolazio
iz nekog drugog grada u Pariz ili odlazio iz njega, bila je nuna policija da ga dovede kui.
Stoga je on imao obiaj da moli: "Nisam bio u pravu. Uini da jednostavno opet
budem niko, jer ne mogu otii da posmatram reku. Ne mogu izai van da posmatram raanje
sunca, ne mogu se popeti na brdo, ne mogu se kretati. Postao sam zatvorenik."
Oni koji su slavni uvek su zatvorenici. Telu ne treba da bude slavno; telo je tako
apsolutno u redu; njemu ne treba nita slino takvim besmislenim stvarima. Ono trai
jednostavne stvari - hranu; treba mu voda da pije; treba mu sklonite kada je previe toplo, da
se skloni u hlad; njegove potrebe su vrlo, vrlo jednostavne. Svet je lud zbog svojih elja, ne
zbog potreba. I ljudi su poludeli. Stalno odbacuju svoje potrebe, a rastu i uveavaju se njihove
elje. Ima ljudi koji su sveli svoju ishranu na jedan obrok dnevno, ali ne mogu ostaviti svoje
novine, ne mogu prestati da idu u bioskop, ne mogu prestati da pue. Mogu ostaviti hranu -
potrebe se mogu ostaviti - elje ne mogu. Um je postao tiranin.
Telo je uvek lepo; zapamtite to. Ovo je jedno od osnovnih pravila koje vam dajem
neuslovljeno, istinito pravilo, apsolutno istinito, kategorino istinito: telo je uvek lepo, um je
ruan. Nije telo to koje treba da se menja. Nema niega da se menja u njemu. To je um. A um
stvara elje. Telo ima potrebe, ali telesne potrebe su stvarne potrebe.
Ako elite da ivite, vama treba hrana. Slava nije potrebna za ivot, potovanje nije
nuno da se bude iv. Vama ne treba da budete vrlo velik ovek, ili vrlo veliki slikar - slavan,
poznat celom svetu. Vama ne treba da budete dobitnik Nobelove nagrade, jer Nobelova
nagrada ne ispunjava nijednu potrebu u telu.
Ako elite da odbacite potrebe, moraete da ih suzbijete - jer one su realne. Ako
postite moraete da potisnete glad. Onda postoji potiskivanje, svako potiskivanje je pogreno
jer potiskivanje je unutarnja borba, vi elite da ubijete telo, a telo je vae sidro, va brod koji
e vas odvesti do druge obale. Telo dri blago, seme boanskog u vama, zatieno. Hrana je
potrebna za tu zatitu, voda je potrebna, sklonite je potrebno, udobnost je potrebna - za telo,
jer um ne eli nikakvu udobnost.
Pogledajte moderan nametaj, on uopte nije udoban, ali um kae: "Ovo je moderno, a
ta vi radite sedei u staroj stolici? Svet se promenio i moderan nametaj je doao." Moderan
nametaj je zaista udan. Oseate se neudobno u njemu, ne moete sedeti dugo u njemu. Ali je
moderan. Um kae moderno mora biti tu, jer kako moete biti izvan vremena. Budite dorasli
vremenu.
Moderna odea je neudobna, ali je savremena, i um kae da morate pratiti modu. Ljudi
su nainili toliko mnogo runih stvari zbog mode. Telu to nije potrebno; to su potrebe uma, a
vi ih ne moete ispuniti - nikada, jer su nerealne. Samo nerealno ne moe biti ispunjeno. Kako
moete ispuniti nerealnu potrebu koja zapravo ne postoji? Od kakve je potrebe slava? Samo
meditirajte na tome. Zatvorite svoje oi i pogledajte. Gde je ta potreba u telu? Kako e vam to
pomoi ako ste poznati? Hoete li biti zdraviji ako ste uveni? Hoete li biti tii, smireniji,
ako ste slavni? ta ete iz toga dobiti?
Neka vam telo bude kriterijum. Kad god um kae neto, pitajte telo: "ta ti kae?"
Ako telo kae: "Besmisleno je", odbacite to. Tada to nije potiskivanje jer je to jedna nerealna
stvar. Kako moete potisnuti jednu nerealnu stvar? Ujutru ustanete iz kreveta i seate se sna.
Morate li da ga potisnete, ili morate da ga ispunite? A u tom snu ste sanjali da ste postali
vladar celoga sveta. Dakle ta da se radi? Treba li da pokuate? Inae javlja se pitanje: "Ako
ne pokuamo, onda je to potiskivanje." Meutim, san je san. Kako moete potisnuti san? San
183
iezava sam. Treba da budete samo budni. Morate samo znati da je to san. Kada je san samo
san i spoznat je kao takav, on nestaje.
Pokuajte da otkrijete ta je elja, a ta potreba. Potreba je orijentisana na telo, elja
nema orjentaciju na telo. Ona nema korena. Ona samo lebdi u umu. Gotovo uvek potrebe
vaeg tela dolaze iz vaeg tela, a potrebe vaeg uma dolaze od neeg drugog. Neko kupuje
lepa kola. Neko drugi je kupio lepa kola, strana kola, i sada se u vaem umu stvara potreba.
Kako moete dopustiti da taj drugi ima bolja kola?
Mula Nasrudin je vozio kola, a ja sam sedeo s njim. Onog momenta kada smo uli u
susedstvo - bio je vrlo topao letnji dan - odmah je zatvorio prozore na kolima. Pitao sam: "ta
radi?" On je odgovorio: "ta misli? Treba li da dozvolim mojim susedima da saznaju da
nemam klimu u autu?"
Znojio se, ja sam se znojio takoe s njim. Bilo je kao u penici, vrelo, ali kako moete
dopustiti da susedi znaju da nemate kola sa klimom? To je potreba uma. Telo kae: "Odbaci
to, jesi li lud?" To je znojenje. Ono kae: "Ne." Sluajte telo; nemojte sluati um. Potrebe uma
su stvorili drugi svuda oko vas; oni su nepromiljeni, tupi, blesavi.
Potrebe tela su lepe, jednostavne. Zadovoljite potrebe tela; nemojte ih suzbijati. Ako
ih suzbijate, postaete sve vie i vie bolesni, oboleli. Nikada se ne brinite o potrebama uma;
jednom kada saznate da je ovo potreba uma... a ima li ikakvih tekoe da se to zna? U emu je
tekoa? Tako je jednostavno saznati da je ovo potreba uma. Jednostavno pitajte telo;
istraujte u telu; naite koren. Da li je tu koren toga?
Izgledaete luckasto. Svi vai kraljevi i vladari su budalasti. Oni su klovnovi; samo
pogledajte. Odeveni sa hiljadu medalja, izgledaju luckasto. ta oni rade? A za to su patili
dugo. Da postignu to, proli su kroz tako mnogo bede i jo uvek su jadni. Moraju biti jadni.
Um predstavlja vrata za pakao, a ta vrata nisu nita drugo do elje. Ubijte elju. Neete nai
nimalo krvi u njima, jer elje su beskrvne.
Ali ako ubijete potrebe, poiniete krvoprolie. Ubijanjem potreba postepeno ete
umirati. Ubijanjem elje neete umreti. Naprotiv, postaete slobodniji. Vie slobode e doi iz
odbacivanja elja. Ako moete postati ovek potreba, a ne elja, vi ste ve na stazi i nebo nije
daleko.
184
Poglavlje 7
PREPREKE ZA MEDITACIJU
Izlaganje 7. januara 1975. u dvorani Buda.
I, 30: vyadhistyana samaya pramadalasya viratibhranti darana
labhabhumikatvanavastihitatvani cittavikepdste 'ntarayah.
Humoralni poremeaji (vyadhi), malodunost, sumnjiavost, nehaj, tromost,
nezajaljivost, pomuenost uvianja (bhrantidarana), nemo da se napreduje [na putu
ka konanom cilju], nesposobnost da se [ono dostignuto] odri - [sve to] su [oblici]
duevne neusredsreenosti (cittavikepa). To su te smetnje [o kojima je re u
prethodnom aforizmu].
I, 31: duhkha daurmana syanga mejayatva vasapravasa vikepa sahabhuvah.
Opta nelagodnost (duhkha), nezadovoljstvo, uznemirenost, neuravnoteenost
udaha i izdaha prate pomenutu neusredsreenost.
I, 32: tatpratiedharthamekatattvabhyasah.
Da bi otklonio ove [prepreke joginu se preporuuje] praktikovanje
[unutranjeg] objedinjavanja (ekatattvabhyasa).
Patanjali veruje - i ne samo da veruje, on takoe zna - da je zvuk osnovni element
egzistencije. Isto kao to fiziari kau da je elektricitet osnovni elemenat, yogini kau da je
zvuk osnovni elemenat. Oni se slau jedni s drugima na suptilan nain.
Fiziari kau da zvuk nije nita do modifikacija elektriciteta, a yogini kau da
elektricitet nije nita drugo do modifikacija zvuka. Onda su i jedni i drugi u pravu. Zvuk i
elektricitet su dva oblika jedne pojave i, po meni, taj fenomen jo nije poznat i nee ikada biti
poznat. Bilo ta da znamo to e biti samo modifikacija toga. To moete nazvati elektricitetom,
moete to zvati zvukom, moete to nazvati vatrom kao Heraklit, moete to nazvati vodom kao
Lao Ce; to zavisi od vas. Ali to su sve modifikacije - oblici bezoblinog. To bezoblino e
uvek ostati nepoznato.
Kako moete znati bezoblino? Znanje je mogue samo kada postoji oblik. Kada neto
postane vidljivo, onda to moete znati. Kako moete nevidljivo nainiti objektom saznanja?
Sama priroda nevidljivosti je da on ne moe biti opredmeen. Ne moete ga oznaiti, ni gde
je, ni ta je. Samo neto vidljivo moe postati objekt saznanja.
Dakle, kad god je neto znano, to e biti samo modifikacija nepoznatog. Nepoznato
ostaje nepoznato. To je nesaznatljivo. Dakle, od vas zavisi ta nazivate time, i zavisi od
namene koju ete tome dati. Za yogina elektricitet nije relevantan. On deluje u unutranjoj
laboratoriji bia. Tamo je zvuk mnogo vaniji, jer kroz zvuk on moe promeniti unutra mnoge
pojave i, kroz zvuk, moe takoe promeniti unutranji elektricitet. Yogini to nazivaju pranom
- unutranjom bioenergijom ili bio-elektricitetom. Kroz zvuk to moe odmah biti promenjeno.
Zbog toga, kada sluate klasinu muziku oseate da vas izvesna tiina okruuje:
185
unutranja energija vaeg tela je promenjena. Sluajte ludog oveka i vi ete osetiti da takoe
postajete ludi: jer je telesni elektricitet ludog oveka u haosu a njegove rei i zvukovi prenose
taj elektricitet vama. Ako sedite sa prosvetljenim ovekom, odjednom ete osetiti da se unutra
u vama sve dogaa u ritmu. Iznenada ete osetiti kako se javlja u vama drugaiji kvalitet
energije.
Zbog toga Patanjali kae da ponavljanje Aum i meditacija na Aum unitava sve
prepreke. ta su prepreke? Sada on opisuje svaku prepreku, i kako se one mogu unititi
ponavljanjem zvuka Aum i meditirajui na njemu; to emo mi morati paljivo da prouimo.
Bolest, malaksalost, sumnja, nemar, lenjost, senzualnost, obmana, nemo i
nestabilnost, prepreke su koje remete um.
Uzeemo svaku od njih; na primer bolest. Za Patanjalija bolest (disease) znai "dis-
ease." To je ne-ritmiki tok vae unutranje bio-energije. Oseate se neudobno. Ako se ova
neudobnost, ova bolest nastavi, pre ili docnije obuzee vae telo. Patanjali se sasvim slae sa
akupunkturom, a u Sovjetskoj Rusiji ovek po imenu Kirlian apsolutno bi se sloio sa
Patanjalijem. Sva tri pravca... Akupunktura nije zainteresovana za prosvetljenje, ali joj je
vano kako telo postaje bolesno, kako dolazi do bolesti. Ona je ustanovila sedam stotina
taaka na telu, gde unutranja bioenergija dodiruje fiziko telo - te dodirne take - njih sedam
stotina svuda su po telu.
Kad god elektricitet ne krui u ovih sedam stotina taaka - ima nekih prekida, nekoliko
taaka vie ne funkcionie, kroz nekoliko taaka elektricitet se vie ne kree, postoje blokade,
elektricitet je preseen, ne krui - onda dolazi do bolesti. Tako akupunktura veruje da bez
ikakvih lekova, bez ikakvog tretmana, ako dozvolite bioenergiji da tee u krugu, bolest
iezava. A za pet hiljada godina... akupunktura je roena priblino kada je Patanjali bio iv.
Kao to sam vam rekao, pre dve hiljade i pet stotina godina nastupio je vrhunac
ljudske svesti. To se dogodilo u vreme Bude; u Kini Lao Ce, uang Ce, Konfuije; u Indiji
Buda, Mahavira i drugi; u Grkoj Heraklit, Platon i Sokrat; u Iranu Zaratustra: tada se desio
vrhunski fenomen. Sve religije koje sada vidite u svetu potiu iz tog trenutka ljudske svesti. Iz
tog vrha, tog Himalaja, reke svih religija su potekle za ove dve hiljade petsto godina.
Pored toga, dve hiljade petsto godina pre Bude, desio se isti vrhunski fenomen.
Patanjali, Riab - zaetnik ainizma - Vede, Upanishade, akupunktura u Kini, yoga u Indiji i
tantra; sve se to dogodilo. Oni su dostigli vrhunac. Nikada taj vrhunac nije prevazien. Iz te
davne prolosti, pet hiljada godina unatrag, yoga, tantra, akupunktura su potekli kao reke.
Postoji odreena pojava koju Jung zove "sinhronicitet". Kada odreeni princip
nastane, ne postaje samo jedna osoba svesna toga - ve mnogi na zemlji, kao da je cela zemlja
spremna to da primi. Pria se da je Ajntajn rekao: "Da ja nisam otkrio teoriju relativiteta, za
jednu godinu neko drugi bi je otkrio." Zato? Jer mnogi su ljudi u svetu radili u istom pravcu.
Kada je Darvin otkrio teoriju evolucije da se ovek razvio od majmuna, da postoji
neprekidna borba za preivljavanje jaeg, drugi ovek - Wallace Russell - isto je to otkrio. On
je bio na Filipinima, i bili su takoe prijatelji, ali za mnogo godina nisu znali na emu drugi
radi. Darvin je radio dvadeset godina neprekidno, ali je on bio lenj ovek. Imao je mnoge
fragmente i sve je bilo spremno, ali od toga nije nainio knjigu koju bi predstavio naunom
drutvu tog vremena.
Prijatelji su govorili: "Uradi to. Inae neko drugi e to uraditi." Onda je jednog dana
primio pismo sa Filipina u kome je Rasel izloio celu teoriju. On mu je bio prijatelj, ali su
obojica radili odvojeno. Nikada nisu znali da obojica rade na istom istraivanju. Tada se
uplaio, ta da radi! Zato to moe postati pronalaza, a ve dvadeset godina zna princip
istraivanja. Pourio je, na neki nain rukovoen tom situacijom da napie izvetaj, da
predstavi istraivanje naunom drutvu.
Posle tri meseca, svi su postali svesni da je Rasel to takoe otkrio. Rasel je takoe bio
veoma divna osoba. Objavio je da otkrie pripada Darvinu, budui da je dvadeset godina
istraivao, bez obzira da li to prezentirao ili ne... Ipak on je pronalaza.
A to se deava mnogo puta. Iznenada misao postaje vrlo upadljiva, znaajna, kao da
186
misao pokuava negde da stvori zametak. A obiaj je prirode, da nikada ne preuzima rizik.
Jedan ovek moe da ne uspe, da ne postigne cilj; onda mnogi ljudi moraju pokuati. Priroda
nikada ne rizikuje. Drvo e baciti milione semenki. Jedna semenka moe da ne uspe, moda
nee pasti na pravo tle, moe biti unitena, ali milioni semenki - ne postoji mogunost da sve
semenke budu unitene.
Kada vodite ljubav, u jednoj ejakulaciji milione semena ovek izbaci - jedno od njih
e stii do jajeta ene - ali od miliona. Gotovo u svakoj ejakulaciji ovek ispusti onoliko
semena koliko je upravo sada ljudi na zemlji. Jedan ovek iz jedne ejakulacije moe dovesti
do roenja cele zemlje, populaciju cele zemlje. Priroda ne rizikuje. Ona pokuava na mnogo
naina. Jedan moe da ne uspe, dvoje mogu da ne uspeju, milioni mogu da ne postignu cilj;
ali sa milionima, barem jedan e stici i ostati u ivotu.
Jung je otkrio princip koji se zove "sinhronicitet". To je retka stvar. Mi znamo jedan
princip uzroka i posledice: uzrok proizvodi posledicu. Sinhronicitet kae da kad god se neto
dogodi, paralelno s tim mnoge sline stvari se dogode. Ali mi ne znamo zato se to deava, jer
to nije pojava uzroka i posledice. Oni nisu povezani jedan s drugim kao uzrok i posledica.
Kako moete povezati Budu i Heraklita? Samo po istom principu. Buda nikada nije
uo o Heraklitu; ne moemo ak ni zamisliti da je Heraklit znao o Budi. Oni su iveli u
odvojenim svetovima. Nije bilo komunikacije. Ali isti tok principa, egzistencija slina reci,
trenutno je obojicu dala svetu. Oni nisu prouzrokovali jedno drugo. Oni su paralelni.
Sinhronicitet postoji kao da cela egzistencija u tom momentu eli da proizvede odreen
princip i eli da ga manifestuje - i manifestuje ga a to nee zavisiti samo od Bude ili samo od
Heraklita; mnogi e to pokuati. Bilo je takoe i drugih koji su otili u zaborav; nisu bili tako
poznati. Buda i Heraklit postali su najistaknutiji. Oni su bili najmoniji majstori.
U danima Patanjalija, nastao je princip. Moete ga nazvati principom prane -
bioenergije. U Kini to je uzelo formu akupunkture, u Indiji je uzelo oblik itavog sistema
yoge. Kako se to deava, kada telesna energija ne tee ispravno, da se vi oseate neudobno?
Jer procep postoji u vama, odsustvo, oseate da neto nedostaje. Ovo je zapoinjanje bolesti.
Prvo e se osetiti u umu. Kao to sam vam rekao, osetie se prvo u nesvesnom.
Ne morate biti svesni toga; to e prvo doi u vaim snovima, u vaim snovima
videete bolest, bolesno stanje, neko umire, neto je nepovoljno. None more e se javiti u
vaem nesvesnom, jer nesvesno je najblie telu i najblie prirodi. Iz nesvesnog to e doi do
podsvesnog; onda ete biti razdraeni. Osetiete da zvezde gree, sve to inite odvija se
pogreno. eleli biste da volite neku osobu, i pokuavate, ali ne moete. eleli biste da
pomognete nekome, ali samo smetate. Sve ide pogreno.
Vi mislite o nekom loem uticaju, od neke zvezde na nebu - ne - neto u podsvesnom,
neto neudobno, i vi postajete iritirani, ljuti, a uzrok je negde u nesvesnom. Vi nalazite uzrok
negde drugde. Onda uzrok dolazi do svesnog. Onda poinjete da oseate da ste bolesni, onda
se to pobudi, prenese i pokrene u telu. To se uvek prenese na telo, i odjednom osetite da ste
bolesni.
U Rusiji je neobian naunik, fotograf Kirlian, otkrio da pre nego to osoba postane
bolesna, est meseci pre, bolest moe da se fotografie. To e biti jedno od najveih otkria u
svetu dvadesetog veka. To e preobraziti itav koncept o oveku, bolesti, medicini, svemu. To
je revolucionaran koncept. On je radio na tome trideset godina i gotovo je sve nauno
dokazao, da kada bolest doe u telo, prvo doe u elektrinu auru oko tela. Procep dolazi do...
Vi ete moda imati tumor u stomaku posle est meseci. Sada odmah ne postoji
osnova. Nijedan naunik ne moe nai nita pogreno u vaem stomaku; sve je u redu, nema
problema. Moete biti paljivo ispitani i vi ste u redu. Ali Kirlian je fotografisao telo na vrlo
osetljivoj fotografskoj ploi; on je razvio najosetljivije foto ploe. Na toj fotografskoj ploi ne
fotografie se samo vae telo, nego i aura svetla koju uvek nosite oko tela. A u toj auri, pored
stomaka postoji upljina u auri - ne tano u fizikom telu, ali neto je poremeeno.
Onda se na osnovu toga moe predvideti da e za oko est meseci nastati tumor. Posle
est meseci kada se tumor pojavi u telu, x-zraci pokazuju istu sliku kao to je on nainio pre
est meseci. Dakle Kirlian kae da se bolest moe predvideti a da se ne bude bolestan - i da se
moe izleiti pre nego to se pojavi u telu, ako je aura tela u veem opticaju. On ne zna kako
187
se to moe izleiti; akupunktura zna, Patanjali zna kako se to moe izleiti.
Za Patanjalija bolest u telu jeste smetnja u auri tela, u prani, u bioenergiji, u
elektricitetu vaeg tela. Zbog toga kroz Aum moe da se izlei. Ponekad sedite usamljeni u
hramu. Idite u neki stari hram gde niko ne odlazi, ispod kupole - kupola je kruna samo da bi
odraavala zvuk - dakle sednite ispod nje, pevajte glasno Aum i meditirajte na njemu. Pustite
da se zvuk odbija natrag i pada na vas kao kia, i odjednom ete posle nekoliko minuta osetiti
da vam telo postaje smireno, mirno, utiano; telesna energija se smirila, staloila.
Prva stvar je bolest. Ako ste vi bolesni u svojoj prana energiji, ne moete otii daleko.
Kako moete otii daleko sa boleu koja visi oko vas kao oblak? Ne moete ui u dublja
podruja. Potrebno je odreeno zdravlje. Indijska re za zdravlje vrlo je sadrajna: to je
swasthya. Sama re znai "biti svoj sopstven." Re zdravlje na sanskritu znai biti sopstven,
biti usredsreen. Engleska re za zdravlje takoe je lepa. Dolazi od iste rei, istog korena,
odakle dolazi svetost i celina (health - holy + whole). Kada ste celoviti onda ste zdravi, i kada
ste celoviti vi ste takoe sveti.
Uvek je dobro doi do korena rei jer on budi dugo iskustvo oveanstva. Rei nisu
dole sluajno. Kada osoba osea celo svoje telo energija tee u krugu. Krug je najsavrenija
stvar na svetu. Savreni krug je simbol Boga. Energija ne biva izgubljena, neiskoriena. Ona
stalno krui; nastavlja da se okree kao toak; ona neprekidno odrava sebe.
Kada ste celoviti vi ste zdravi, a kada ste zdravi vi ste takoe sveti, jer ta re 'sveto'
takoe dolazi iz 'celine'. Savreno zdrava osoba je sveta, ali onda e biti problema. Ako odete
u manastire nai ete tamo sve tipove bolesnih ljudi. Zapravo, bolesni ljudi samo tamo idu.
Pitaete ta bi zdrava osoba radila u manastiru. Bolesni ljudi odlaze tamo, nenormalni ljudi
idu tamo. Kod njih je neto pogreno u osnovi. Zbog toga oni bee iz sveta i odlaze tamo.
Patanjalijevo prvo pravilo je da morate biti zdravi, jer ako niste zdravi ne moete
dospeti daleko. Vae bolesti, vaa neudobnost, va prekinuti krug unutranje energije, bie
kamen o vaem vratu. Kada biste hteli da meditirate oseali biste muku ili teinu umesto mira
i spokojstvu. Kada biste eleli da molite, ne moete moliti, eleli bi da se odmarate. Postojao
bi nizak nivo energije. A sa niskom energijom kako moete otii daleko? I da dostignete
Boga? A za Patanjalija Bog je najudaljenija taka; mnogo energije je potrebno. Potrebno je
zdravo telo, zdrav um, zdravo bie. Bolest je bolesno stanje - oboljenje u telesnoj energiji.
Aum e pomoi, a i druge stvari emo takoe razmatrati. Inae ovde Patanjali govori o tome
kako vamAum, sam zvuk, pomae unutra da postanete celoviti.
Za Patanjalija i za mnoge druge, koji su duboko istraivali ljudsku energiju, jedna
injenica je postala vrlo sigurna - vi morate znati o tome - a to je, to ste vie bolesni, vie ste
ulni. Kada ste savreno zdravi, niste ulni ni pohotni. Obino mislimo upravo suprotno - da
zdrav ovek mora biti senzualan, seksualan, ovo i ono: on mora da uiva u svetu i u telu. To
nije sluaj. Kada ste bolesni, onda vas spopada vie ulnosti, vie seksa. Kada ste savreno
zdravi, seks i ulnost nestaju.
ta se to deava? Deava se to da, kada ste savreno zdravi, vi ste tako sreni sa sobom
da vam drugi ne treba. Kada ste bolesni, tako ste nesreni sa sobom da vam treba drugi. A to
je paradoks: kada ste bolesni trebaju vam drugi, a drugima ste takoe potrebni vi kada su oni
bolesni. A kada se dve bolesne osobe sastanu, bolest se ne udvostruava, ona se umnoava.
To je ono to se deava u braku: susretom dve bolesne osobe umnoavaju bolest i
onda cela stvar postaje runa i paklena. Bolesnoj osobi trebaju drugi, a oni su upravo osobe
koje e stvoriti nevolju kada se poveu. Zdravoj osobi to ne treba. Inae ako zdrava osoba
voli, to nije potreba, to je deljenje. Cela pojava se menja. Njoj niko ne treba. Ona ima toliko
mnogo da moe deliti.
Samo jednoj bolesnoj osobi treba seks, zdrava osoba voli, i ljubav je totalno razliita
stvar. I kada se dve zdrave osobe sretnu, zdravlje se umnoava. Onda one mogu postati
pomagai jedna drugoj za ono najvie. One mogu ii zajedno prema najviem, pomaui
jedna drugu. Meutim, potreba iezava. Nema vie potrebe, nema vie zavisnosti.
Kad god se oseate neugodno sa sobom, ne pokuavajte da to utopite u seks i ulnost.
Bolje pokuajte da postanete zdraviji. Joga asane e pomoi. Istraivaemo njih kasnije kada
Patanjali bude govorio o njima. Upravo sada, on kae, ako pevate Aum i meditirate na tome,
188
bolest e nestati. I on je u pravu. Ne samo da e nestati prisutna bolest, nego i bolest koja bi
dola u budunosti, takoe e nestati.
Ako ovek moe da postigne savrenstvo pevanja tako da je peva potpuno izgubljen -
samo ista svest, plamen svetla svuda okolo, pevajui - energija se sliva u krug, postaje krug.
A onda imate jedan od najushienijih, najpoletnijih trenutaka u ivotu. Kada se energija slije u
krug, postaje harmonija, nema nesklada, nema konflikta, vi ste postali jedno. Inae obino,
bolest bi takoe bila prepreka. Ako ste bolesni, vama je potrebno leenje.
Patanjalijev yoga sistem i sistem hindu medicine, ayurveda, razvili su se
istovremeno, zajedno. Ayurveda je totalno razliita od alopatije. Alopatija je suzbijanje
bolesti. Alopatija se razvila uporedo sa hrianstvom; ona je nusproizvod hrianstva. Zato to
je hrianstvo sklono potiskivanju, alopatija je sklona potiskivanju. Ako ste bolesni, alopatija
odmah suzbija bolest. Tada bolest pokuava da se pojavi na nekoj drugoj slaboj taki. Onda s
nekog drugog mesta bukne. Tada je vi suzbijate tamo, da bi se odnekud drugde pojavila. Na
taj nain sa alopatijom, idete od jedne bolesti do druge, od jedne do druge, to je proces koji se
nikada ne zavrava.
Ayurveda ima potpuno razliit koncept. Bolest ne treba da bude suzbijana: ona treba
da bude otputena. Katarza je potrebna. Dakle, ayurvedski lek se daje bolesnoj osobi tako da
se bolest ispolji i bude izbaena; katarza. Dakle ayurvedska medicina vas u poetku moe
uiniti vie bolesnim, i trai due vreme, jer ona nije suzbijanje. Ona ne moe delovati
odmah; ona je dug proces. Bolest mora da bude odbaena, a vaa unutranja energija mora biti
u harmoniji tako da zdravlje doe iznutra. Lek e izbaciti bolest van, a sila isceljenja e je
zameniti iz vaeg vlastitog bia.
Oni su razvili ayurvedu i yogu zajedno. Ako radite yoga asane, ako sledite
Patanjalija, nemojte nikada ii kod alopatskog doktora. Ako ne sledite Patanjalija, onda
nema problema. Ali ako sledite yoga sistem i radite sa svojom telesnom energijom, onda
nikada ne ulazite u alopatiju, jer oni su opreni. Onda traite ayurvedskog doktora ili
homeopatu ili naturopatu - sve to pomae katarzu.
Inae ako postoji bolest, prvo se suoite s njom. Ne kreite se s njom. S mnogim
metodama vrlo je lako osloboditi se bolesti. Patanjalijeva metoda Aum-a, pojanja i
meditiranja vrlo je blaga. Ali u njegovo vreme, bila je dovoljno jaka, jer ljudi su bili
jednostavni, iveli su sa prirodom. Bolest je bila retka; zdravlje je bilo uobiajeno. Sada je
sasvim suprotan sluaj: zdravlje je retko, bolest je uobiajena, a ljudi su vrlo kompleksni, ne
ive blisko s prirodom.
U Londonu je sprovedeno ispitivanje. Milion deaka i devojica nisu videli kravu.
Videli su samo sliku krave. Postepeno smo se prepustili svetu koji je nainio ovek;
betonskim zgradama, asfaltnim putevima, ljudskoj tehnologiji, velikoj maineriji,
automobilima. Priroda je odbaena negde u tamu, a priroda je isceljujua sila. A onda je
ovek postao sve kompleksniji. On ne slua svoju prirodu; on slua zahteve civilizacije,
potrebe drutva. Potpuno je izvan kontakta sa njegovim vlastitim unutranjim biem.
Onda Patanjalijeve blage metode ne pomau mnogo. Bolje su moje dinamike,
haotine metode - jer vi ste gotovo ludi, pa vam trebaju lude metode koje mogu izneti sve to
je potisnuto u vama i izbaciti to napolje. Meutim, zdravlje je nuno. ovek koji odlazi na
dugo putovanje mora pripaziti da bude zdrav. Bolesnom, prikovanom za krevet, teko je da se
kree.
Druga prepreka je mlitavost: iznemoglost znai da ovek ima vrlo malo snage za
istraivanje. On eli da traga i istrauje - ali sa vrlo niskom energijom potrage - bez poleta,
mlako. On eli da se proisti, ali to nije mogue. Takav ovek uvek govori o Bogu, mokshi,
yogi, ovo i ono, ali samo govori. Sa niskim nivoom energije moete govoriti; to je sve to
moete uiniti. Ako elite neto da uinite, potrebna je snaga jake energije.
Jednom se dogodilo da je Mula otiao sa svojim konjem i koijom u neki grad. Bio je
vreo letnji dan; Mula se znojio. Iznenada se na putu konj zaustavio, pogledao natrag u Mulu i
rekao: "Sveca mu, ba je pretoplo!" Mula nije mogao da veruje. Mislio je da je poludeo usled
toplote, jer kako konj moe govoriti?
Pogledao je okolo da li je neko jo uo, ali nije bilo nikog izuzev njegovog psa koji je
189
sedeo u koiji. Ne naavi nikoga, da bi se samo oslobodio misli, pitao je psa: "Jesi li uo ta
je on rekao?" Pas je odgovorio: "Ma on je kao i svi drugi - uvek govori o vremenu i ne radi
nita."
To je mlitav ovek, uvek govori o Bogu, ne radei nita. On uvek govori o velikim
stvarima, a to ini samo da bi sakrio svoju ranjivost. Govori tako da bi mogao zaboraviti da ne
ini nita u vezi s tim. Kroz oblak govora on pobegne. Govorei stalno o tome, on misli da
ini neto, ali govorenje nije delovanje. Moete stalno da govorite o vremenu, moete stalno
da govorite o Bogu. Ako ne inite nita, jednostavno traite svoju energiju.
Takav tip osobe moe postati ministar, svetenik, pandit. Ovo su ljudi niske energije.
Oni su postali vrlo veti u govorenju - tako veti da mogu obmanuti, jer uvek govore o
velikim i lepim stvarima. Drugi sluaju i bivaju zavedeni; filozofi - to su mlitavi ljudi.
Patanjali nije filozof. On sam jeste naunik, i on trai od drugih da budu naunici. Mnogo je
energije potrebno.
Kroz pevanje Aum-a i meditiranje na njemu, nizak nivo vae energije e se podii.
Kako se to dogaa? Zato ste uvek na nivou niske energije, oseajui uvek iscrpljenost, umor?
ak i ujutru kada ustanete vi ste umorni. ta vam se deava? Negde u vaem sistemu postoji
curenje; vama istie energija. Vi niste svesni, ali ste kao vedro sa rupama. Svakog dana punite
vedro, ali uvek vidite da je prazno, postaje prazno. Ovo oticanje treba da se zaustavi.
Koliko energije iscuri iz tela? Ovo su ozbiljni problemi za bioenergetiku. Iz tela istie
energija kroz prste ruku, nogu, kroz oi. Energija ne moe istei kroz glavu: ona je okrugla.
Sve to je kruno pomae telu da se ouva. Zbog toga su yoga poloaji - siddhasana,
padmasana - oni ine itavo telo krunim.
Osoba koja sedi u siddhasani dri obe svoje ruke zajedno jer telesna energija istie
kroz prste. Kada su obe ruke spojene zajedno, jedna preko druge, energija se kree iz jedne
ruke u drugu. To postaje krug. Stopala, noge, takoe su poloeni jedno na drugo tako da se
energija kree u vaem telu i ne istie.
Oi su zatvorene, jer one isputaju gotovo osamdeset posto vae bioenergije. Zbog
toga, kada putujete, ako neprekidno gledate iz voza ili kola, oseate se tako umorni. Ako
putujete sa zatvorenim oima, neete se oseati tako umorni. A vi stalno gledate u nepotrebne
stvari, ak itate reklame na zidovima. Previe koristite svoje oi, a kada su oi umorne itavo
telo je umorno. Oi pokazuju kada je dosta.
Jogin pokuava da ostane sa zatvorenim oima koliko je vie mogue, s prekrtenim
rukama i nogama, tako da energija krui unutra. On sedi sa uspravnom kimom. Ako sedite s
uspravnom kimom, ouvaete vie energije nego na bilo koji drugi nain, jer kada je kima
uspravna, gravitacija zemlje ne moe iznuditi mnogo energije iz vas, jer ona dodiruje samo
jednu taku kime. Zbog toga, kada sedite u kakvom naslonjenom poloaju, nakrivljeno,
mislite da se odmarate. Ali Patanjali kae da vam istie energija, jer je vei deo vaeg tela
pod uticajem gravitacije.
To nee pomoi. Uspravne kime, sa zatvorenim rukama i nogama, sa zatvorenim
oima, postali ste kruenje: to kruenje je predstavljeno pomou shivalinge. Mora da ste
videli shivalingu - falusni simbol, kao to je poznat na Zapadu. Zapravo, to je unutranji krug
bioenergije, kao pravilno oblikovano jaje.
Kada vaa telesna energija tee pravilno, to postaje kao jaje: oblik je slian jajetu,
tano kao jaje. A to je simbolizovano u shivalingi. Vi postajete iva. Kada energija nadolazi
u vama stalno, ne izlazei napolje, onda mlitavost nestaje. Mlitavost nee nestati prianjem;
nee nestati itanjem spisa, niti filozofiranjem. Ona e nestati samo kada vaa energija ne
istie.
Pokuajte da je ouvate. to vie je ouvate, bolje je. Ali na Zapadu se ui upravo
neto suprotno - da je dobro otpustiti energiju kroz seks, kroz ovo i ono - izbaciti energiju.
Dobro je ako je ne koristite ni na koji drugi nain; inae ete poludeti. Kad god ima previe
energije, bolje je otpustiti je kroz seks. Seks je najjednostavniji metod da se ona izbaci.
Ali ona moe da se iskoristi, moe biti uinjena kreativnom. Ona vam moe dati
ponovno roenje, vaskrsenje. Moete upoznati milione euforinih stanja kroz nju; moete se
uzdizati sve vie i vie kroz nju. Ona predstavlja lestve za dostizanje Boga. Ako je izbacujete
190
svakog dana, nikada neete imati tako izgraenu energiju da biste makar preduzeli prvi korak
prema Boanskom. Sauvajte je.
Patanjali je protiv seksa, a to je razlika izmeu Patanjalija i tantre. Tantra koristi
seks kao metodu; Patanjali eli da to zaobiete. Ima osoba, gotovo pedeset procenata, kojima
e tantra odgovarati; a pedeset posto kojima e yoga odgovarati. ovek mora da otkrije ta e
mu odgovarati. Obe metode se mogu koristiti, i kroz obe ljudi dostiu. A nisu ni pogrene, ni
ispravne. To zavisi od vas. Jedna e biti ispravna za vas, a pogrena za drugog, ali zapamtite,
ni za vas to nije jedna apsolutna kategorina instrukcija.
Neto moe biti ispravno za vas, a pogreno za nekog drugog. A oba sistema su
nastala zajedno, tantra i yoga - blizanaki sistemi, tano u isto vreme - to je sinhronicitet. Kao
to ovek i ena trebaju jedno drugo, tantra i yoga trebaju jedno drugo; oni postaju kompletna
stvar. Ako postoji samo yoga, onda je samo pedeset posto ljudi moe postii; pedeset posto
ljudi e biti u nevolji. Ako ima samo tantre, onda je pedeset posto ljudi moe postii; drugih
pedeset posto e biti u nevolji. A to dogodilo.
Ponekad ne znajui gde se kreete, ta radite, ako nastavite bez majstora, ne znajui ko
ste i ta e vam odgovarati... Moete biti ena odevena kao mukarac, a mislite da ste
mukarac - onda ete biti u nevolji. Moete biti mukarac odeven kao ena, pa mislite da ste
ena - biete u nevolji.
Nevolja uvek nastaje kad god ne shvatate ko ste. Majstor je potreban da vam jasno
ukae na preicu koja je za vas. Stoga zapamtite: kad god neto kaem, da je ovo za vas, ne
irite to drugima, jer je to izriito reeno vama. Ljudi su radoznali. Ako im kaete, oni e
probati. Moda to nije za njih. Moe biti ak tetno. Zapamtite, ako nije korisno, to e biti
tetno. Nema izmeu, neto je ili korisno ili tetno.
Malaksalost ili mlitavost najvea je od prepreka, ali ona iezava kroz pojanje Aum-a.
Aum stvara u vama shivalingu, jajoliko oblikovani krug energije. Kada postanete sposobni da
imate veu mo opaanja, to ak moete i videti. Ako sa zatvorenim oima pevate Aum za
nekoliko meseci meditirajui, moete videti unutar sebe da vae telo nestaje. Tamo e biti
samo bioenergija, elektrini fenomen, i izgledae u obliku shivalinge.
Onog momenta kada vam se to dogodi, malaksalost iezava. Sada sve puni energije.
Sada moete pomerati planine. Osetitiete da govor nije dovoljan - neto mora da se uradi.
Nivo energije je tako visok, da sada neto moe da se uradi. Ljudi mi dolaze i pitaju ta da
rade, ali ja ih pogledam i vidim da im curi energija; ne mogu uiniti nita. Prva stvar je da se
obustavi ovo isticanje. Samo kada imate energiju, onda pitajte ta moe da se uradi.
"Sumnja" - sanskrit ima mnogo rei za sumnju, engleski ima samo jednu re. Prema
tome pokuajte da razumete, ja u vam objasniti. Postoji sumnja nasuprot poverenju. U
sanskritu to se naziva shanka - sumnja nasuprot poverenju, jedan par. Onda postoji sumnja
zvana sanshaya - Patanjali sada govori o sanshayi - sumnja naspram sigurnosti, prema
odlunosti. Nesiguran ovek, ovek koji nije odluan, on je u sanshayi - u sumnji. Ovo nije
protiv poverenja jer poverenje je poverenje u nekoga. Ovo je protiv samo-poverenja; vi ne
verujete sebi. To je razliita stvar.
Dakle ta god da radite, niste sigurni da li elite da radite ili ne elite to da radite, da li
e to biti dobro raditi ili ne - jedna neodlunost. S neodlunim umom, ne moete ii stazom -
ne stazom Patanjalija. Morate biti odluni. Morate doneti odluku. To je teko jer uvek jedan
deo vas nastavlja da govori ne. Onda kako da donesete odluku? Razmiljajte koliko moete,
dajte tome onoliko vremena koliko moete. Razmislite o svim mogunostima, o svim
alternativama i onda odluite. A jednom kada odluite, onda odbacite svu sumnju.
Pre toga, koristite to; uradite sve to moete uraditi sa sumnjom. Razmislite o svim
mogunostima a onda izaberite. Naravno to nee biti totalna odluka; u poetku to nije
mogue. To e biti znaajna odluka, preteni deo vaeg uma e rei 'da'. Jednom kada
odluite, onda nikada ne sumnjajte. Sumnja e podii svoju glavu. Vi jednostavno kaite: "Ja
sam odluio - zavreno. To nije totalna odluka; sve sumnje nisu odbaene. Ali ta god je
moglo da se uradi, ja sam uradio. Razmislio sam potpuno, koliko je bilo mogue, i izabrao
sam."
Jednom kada izaberete onda ne pruajte sumnji opet nikakvu saradnju, jer sumnja
191
postoji u vama kroz vau saradnju. Nastavljate da joj dajete energiju i stalno poinjete da
mislite o tome. Onda se stvara neodlunost. Neodlunost je vrlo loe stanje stvari - vi ste u
vrlo loem stanju. Ako ne moete nita odluiti, kako moete raditi? Kako moete delovati?
Kako e Aum - zvuk i meditacija - pomoi? Oni pomau, jer kada jednom postanete
tihi, smireni, odluivanje postaje lake. Onda vie niste natrpani, niste haos: kada mnogi
glasovi govore zajedno, a vi ne znate koji je glas va. Aum, pevate, meditirate na njemu -
glasovi postaju smireni. Mnogi glasovi - kako moete znati da nisu vai. Vaa majka govori,
va otac govori, vaa braa, vai uitelji, oni nisu vai. Moete ih odbaciti lako jer njima ne
treba nikakva panja.
Kada postanete smireni pevanjem Aum-a, vi ste zatieni, smireni, tihi, sabrani. U toj
sabranosti, moete uvideti koji je stvarni glas koji dolazi od vas, koji je autentian. To je kao
da stojite na trgu, i mnogi ljudi razgovaraju, mnoge stvari se odvijaju, a vi ne moete odluiti
ta se deava. To je kao na berzi, ljudi viu - oni znaju njihov jezik - vi ne moete razumeti ta
se dogaa, da li su poludeli ili ne.
Onda se prenesete u himalajsko utoite. Sedite u peini, jednostavno pevate.
Jednostavno se smirite, sva nervoza iezava, postanete jedinstveni, sabrani. U tom trenutku,
odlunost je mogua. I onda odluite, i ne gledajte unatrag. Onda zaboravite - to je reeno
jasno i nedvosmisleno. Sada nema povratka natrag. Tada idete napred.
Ponekad e uslediti sumnja, ona laje na vas kao pas. Ali ako ne sluate, ne obraate
panju, ubrzo se zaustavlja. Dajte joj priliku, razmislite o svemu to je mogue, a jednom
kada odluite, odbacite je, a aumkar (pevanje Aum-a) e vam pomoi da doete do odlunosti.
Ovde sumnja oznaava neodlunost, nemar. Sanskritska re je pramad. Pramad znai kao da
ovek hoda u snu. Nemar je deo toga; taan prevod e biti: "Ne budite zombi; ne hodajte kao
hipnotisani."
Ali ivite u hipnozi, uopte ne znajui to. Celo drutvo pokuava da vas hipnotie za
odreene stvari, a to stvara pramad: to stvara pospanost u vama. ta se deava? Vi niste
svesni, inae iznenadili biste se ta se deava. To je tako dobro poznato. Zbog toga ne
postajete svesni. Vueni ste od mnogih manipulatora, a njihove metode manipulisanja u vama
stvaraju hipnozu.
Na primer, na svakom radiju, na svakom TV ekranu, u svakom filmu, u svakim
novinama, magazinima, oni stalno oglaavaju odreene stvari - "Toaletni sapun Lux". Vi
mislite da to ne utie na vas, ali svakog dana sluate: "Lux, toaletni sapun; lux, toaletni sapun;
lux, toaletni sapun." To je pojanje. Tokom noi, na ulici neonska svetla oglaavaju "lux,
toaletni sapun." Sada su otkrili da je svetlucanje svetlosti mnogo upeatljivije. Neprekidno se
nastavlja s tim, pali se i gasi; onda to ostavlja jo vei utisak, jer opet morate itati: "Lux,
toaletni sapun." Onda se svetlost nastavlja, dolazi ponovo, pa opet morate itati: "Lux, toaletni
sapun."
Vi pevate Aum. To sve dublje ulazi u vau podsvest. Mislite da niste uznemireni ni
zabrinuti, mislite da niste obmanuti od ovih ljudi - sve ove lepe nage ene koje stoje pored
toaletnog lux sapuna i govore: "Zato sam ja lepa? Zato je moje lice lepo? Zbog toaletnog
sapuna Lux." Vi mislite da niste, ali ste dirnuti time. Iznenada, jednog dana odete u
prodavnicu, odete da kupujete, i traite toaletni sapun. Prodavac pita: "Koji sapun?" Onda
iznenada iz vas izbije: "Toaletni sapun lux."
Vas su hipnotisali biznismeni, politiki lideri, uitelji, svetenici, jer svako je neto
investirao u vama ako ste hipnotisani. Onda moete biti korieni. Politiari stalno govore:
"Ova zemlja je vaa majka, a ako je majka zemlja u nevolji, idite u rat; postanite muenici."
Kakva besmislica. Cela Zemlja je vaa majka. Da li je zemlja podeljena na Indiju,
Pakistan, Nemaku, Englesku, ili je jedna? Ali politiari neprekidno kuju va um da je samo
ovaj deo zemlje vaa majka; morate da je spasete. ak i ako izgubite ivot, to je vrlo dobro. I
oni nastavljaju sa oboavanjem zemlje, nacionalizmom, patriotizmom - svim besmislenim
izrazima, jer ako vas neprekidno obasipaju time, vi postajete hipnotisani. Onda moete
rtvovati sebe.
Vi rtvujete svoj ivot u hipnotisanom stanju zbog slogana, parola. Zastava, iako
obian komad platna, postaje vana kroz hipnozu. Ovo je "naa nacionalna zastava" - milioni
192
mogu umreti za nju. Ako ima bia na drugim planetama i pogledaju ponekad zemlju, mislie:
"Ovi ljudi su jednostavno ludi." Zbog platna - zbog jedne krpe - jer su uvredili "nau zastavu",
a to se ne moe tolerisati...
Religije stalno propovedaju: vi ste hrianin, hindu, musliman, ovo i ono, i one ine da
oseate da ste hrianin, a onda ste u krstakom ratu: "Ubijte druge koji nisu hriani. To je
vaa dunost." Ue vas takvim apsurdnim stvarima, ali vi jo verujete, jer oni vam stalno to
govore. Adolf Hitler kae u svojoj autobiografiji "Moja borba" da ako neprekidno ponavljate
la ona postaje istina. A on zna. Niko ne zna tako dobro kao on jer je to ponavljao sam i
stvorio udo.
Pramad znai stanje hipnoze, manipulisano, pospano kretanje. Onda nemar nuno
dolazi jer vi niste svoji. Onda inite sve bez ikakve brige. Kreete se i greite. U odnosima sa
stvarima, sa ljudima, stalno se sapliete i greite, ne idete nikuda, vi ste kao pijanica.
Meutim, i svi drugi su kao vi, tako da nemate mogunosti da osetite da ste pijanica.
Budite paljivi. Kako e vam Aum pomoi da budete paljivi? Odbacie hipnozu.
Zapravo, ako vi jednostavno pevate Aum bez meditiranja, to e takoe postati hipnoza: to je
razlika izmeu obinog pevanja mantre i Patanjalijevog naina. Pevajte je i ostanite svesni.
Ako pevate Aum i ostanete svesni, ovaj Aum i njegovo pevanje e postati sila koja
uklanja hipnotisanost. Unitie sve hipnoze koje postoje oko vas, i stvorene su u vama od
strane drutva, manipulatora, politiara. To e biti oduzimanje hipnotisanosti.
Neko je u Americi pitao Vivekanandu: "Kakva je razlika izmeu obine hipnoze i
vaeg pojanja Aum-a?" On je rekao: "Pevanje Aum-a je uklanjanje hipnotisanosti; to je
kretanje u suprotnom pravcu." Proces izgleda da je isti, ali je kretanje suprotno. Kako postaje
obrnuto? Ako meditirate takoe, onda ubrzo postajete tako smireni i svesni, tako paljivi, da
vas niko ne moe hipnotisati. Sada ste izvan dohvata svetenika i politiara - niste vie njihov
zatvorenik. Sada ste po prvi put individua, a onda postajete paljivi. Onda se kreete s
panjom, svaki korak inite paljivo, jer oko vas su milioni zamki.
"Lenjost" - alasya; u vama ima mnogo akumulirane lenjosti. Ona dolazi iz odreenog
razloga - jer vi ne vidite svrhu u injenju iega. Ako i radite, nita ne postiete. Ako ne radite,
nita se ne gubi. Onda se lenjost nastanjuje u srcu. Lenjost jednostavno oznaava da ste
izgubili udnju za ivotom.
Deca nisu lenja. Ona kipte energijom. Morate ih prisiliti da odu na spavanje; morate ih
prinuditi da budu tiha; morate ih prisiliti da sednu na nekoliko minuta kako bi se opustila. Ona
nisu napeta; to je vaa ideja. Deca su puna energije - tako nena bia s toliko mnogo energije.
Odakle ta energija dolazi? Oni jo nisu frustrirani. Ne znaju da se u ovom ivotu, ta god
inili, nita ne postie. Oni su nesvesni, neobaveteni - blaeno nesvesni; zbog toga su s tako
mnogo energije.
Vi ste radili mnoge stvari i nita niste postigli - lenjost se uselila. To je kao praina
koja se nastanjuje u vama - od svih neuspeha, frustracija, svaki san postaje mrzak, gorak. To
se naseljava. Onda vi postajete lenji. Ujutru mislite: "Zato da ustajem? Zbog ega?" Nema
odgovora. Morate ustati jer hleb nekako treba da se zaradi. Imate enu, imate decu i uhvaeni
ste u klopku. Odlazite nekako na posao, vraate se nekako natrag. Nema zadovoljstva. Vuete
se, niste sreni radei bilo ta.
Kako e pomoi pojanje Aum-a i meditiranje na njemu? To pomae - sigurno pomae,
jer kada prvi put pevate Aum, posmatrate i meditirate, prvi napor u vaem ivotu izgleda da
donosi ispunjenje. Oseate se tako sreni pojui Aum, oseate se blaeno, to je prvi napor koji
je uspeo.
Sada se budi novi polet. Praina je odbaena. Nova hrabrost, novo poverenje se
postie. Sada mislite da moete uraditi neto, takoe moete postii neto. Nije sve neuspeh.
Moda je spoljanje putovanje neuspeno, ali unutranje putovanje nije neuspeno. ak i prvi
korak donosi tako mnogo cvetova. Sada se javlja nada, poverenje se opet nastanjuje. Vi ste
opet dete - iz unutranjeg sveta... novo roenje. Ponovo se moete smejati, trati, igrati.
Ponovo ste roeni.
To je ono to hindusi nazivaju drugim roenjem. To je sledee roenje, drugo roenje.
Prvo roenje je bilo u spoljanjem svetu. Ono se pokazalo neuspenim; zbog toga se oseate
193
tako letargino. Vremenom kada bude u etrdesetoj, ovek poinje da misli o smrti - kako da
umre, kako da bude dokrajen.
Ako ljudi ne poine samoubistvo, ne znai da su sreni. To je stoga to ne vide
nikakvu nadu ak ni u smrti. ak i smrt izgleda beznadeno. Nije da ne izvravaju
samoubistvo zato to vole ivot - ne, oni su tako frustrirani da znaju da ak ni smrt nee dati
nita. Stoga zato nepotrebno poiniti samoubistvo? Zato praviti nevolju? Stoga neka idu
dalje stvari kakve jesu.
"Senzualnost": Zato se oseate senzualno, seksualno? Oseate se seksualno jer
akumulirate energiju, neiskorienu energiju, a ne znate ta da radite s njom. Stoga, prirodno,
ona se akumulira u prvom centru, u seksu. A vi ne znate nijedan drugi centar, ne znate kako
ona moe da tee navie.
To je kao da dobijete avion, ali ne znate ta je to, tako da ga istraujete, a onda mislite:
"Ima tokove, dakle mora da je neka vrsta vozila." Onda upregnete konje u njega i koristite ga
kao zaprena kola. On se i tako moe iskoristiti. Onda jednog dana, sluajno, otkrijete da
konji nisu potrebni. On u sebi ima nekakav motor, pa ga moete koristiti kao motorno vozilo.
Onda ga istraujete sve dublje i ozbiljnije. Zatim se zapitate emu ova krila? I jednog dana ga
koristite kao to bi trebalo da se koristi - kao avion.
Kada se kreete unutar sebe, otkrivate mnoge stvari. Ali ako se ne kreete, tada postoji
samo seksualnost. Vi sakupite energiju, ta onda da radite s njom? Ne znate nita o tome da
moete poleteti navie. Postajete volovska zaprega: seks je ponaati se kao volovska zaprega.
Sakupite energiju. Jedete hranu, pijete vodu, energija se time stvara, energija je tu; ako je ne
koristite, vi ete poludeti. Onda energija krui unutar vas. Ona vas ini ludim. Treba neto da
uradite. Ako neto ne uradite, poludeete; eksplodiraete. Seks je najlaki sigurnosni ventil -
energija se vraa natrag u prirodu.
Ovo je besmisleno jer energija dolazi iz prirode. Jedete hranu: jedete prirodu. Pijete
vodu: pijete prirodu. Sunate se: upijate sunce. Neprekidno jedete prirodu, a onda je
izbacujete natrag prirodi. Cela stvar izgleda bez osnove, beskorisna, beznaajna. Kakva je
korist od toga? Tako postajete letargini, ravnoduni.
Energija mora ii navie. Morate postati transformator: kroz vas priroda mora postati
nadpriroda; samo onda ima smisao, znaaj. Kroz vas materija mora postati um; um mora
postati nad-um. Kroz vas priroda mora dostii nadprirodu; najnie mora postati najvie. Samo
onda postoji svrha - osea se smisao.
Onda va ivot ima dublje, ozbiljno znaenje. Niste bezvredni; niste neko smee. Vi
ste Bog. Kada preobrazite kroz sebe prirodu do nadprirode, postajete Bog. Patanjali je Bog.
Vi postajete majstor majstora.
Inae obino ulnost znai da se energija skupila, i vi morate da je izbacite van. Ne
znate ta da radite s njom. Prvo je skupite: prvo odlazite da traite hranu, ulaui veliki napor
da zaradite hranu. Onda apsorbujete hranu i stvarate energiju, jer seksualna energija je
najfinija energija u vaem telu, najplemenitija. A onda je izbacite van, i dalje opet kreete se u
krugu.
To je zaarani krug. Kada je izbacite van, telu treba energija. Vi jedete, skupite je,
onda je izbacite: kako moete oseati da to ima neki smisao? Izgleda da ste u koloteini koja
ne vodi nigde. Kako e pomoi Aum? Kako e pomoi meditiranje na njemu? Jednom kada
zaponete da meditirate na Aum-u, drugi centri poinju da funkcioniu.
Kada energija tee, unutar vas nastaje krug. Onda seksualni centar nije jedini centar
koji funkcionie. itavo vae telo postaje krug. Iz seksualnog centra on raste do drugog, do
treeg, etvrtog, petog, estog i sedmog centra; onda iznova dalje do estog, petog, etvrtog,
treeg, drugog, prvog. Energija postaje jedan unutranji krug i prolazi kroz druge centre.
Upravo zato to je energija akumulirana, ona se penje visoko, nivo energije ide navie,
kao kod brane: voda nastavlja da pritie iz reke, a nasip joj ne dozvoljava da izae van. Voda
se uzdie naive, i drugi centri, druge akre u telu poinju da se otvaraju - jer kada energija
tee, one postaju dinamike sile, generatori. One zapoinju da funkcioniu.
To je kao kada vodopad i generator zaponu da funkcioniu; vodopad presahne i
dinamo se ne moe pokrenuti. Kada energija tee navie, vae najvie akre zaponu da rade,
194
da funkcioniu. Na taj nain Aum pomae. ini vas smirenim, sabranim, jedinstvenim.
Energija se uzdie visoko; pouda iezava. Seks postaje beznaajan, detinjast, jo nije
nestao, ali postaje detinjast. Vi se ne oseate poudno; nemate podsticaj za tim.
Seks je jo tu. Ako niste paljivi, opet e vas epati. Moete opet pasti, jer to nije
najvie ostvarenje. Vi jo niste kristalisani, ali letimian uvid je nastupio, tako da vam
energija moe dati unutranja ekstatina stanja. A seks je najnia ekstaza. Mogue su vie
ekstaze. Kada vie postane mogue, nie automatski iezava. Ne treba vam da se odriete
seksa. Ako se odreknete, onda se vaa energija ne kree visoko. Ako se energija kree visoko,
nije potrebno da se odriete seksa. To jednostavno postaje beskorisno. Jednostavno samo
otpada. Ako to ne funkcionie tako, to se pokazuje kao samoobmana.
Psihoanalitiari kau da, ovakvi kakvi jeste, ako prestanete da sanjate, vi ete poludeti.
Snovi su potrebni jer su vaem stanju uma potrebne obmane. Opsene, varke, iluzije, snovi,
potrebni su jer ste uspavani, a u spavanju, snovi su neminovnost.
U Americi su vreni eksperimenti koji su pokazali da ako vam se ne dozvoli sedam
dana da sanjate, odmah zapoinjete da tripujete iluzije: s otvorenim oima poinjete da vidite
stvari kojih nema. Poinjete da govorite s osobama kojih nema, poinjete da vidite vizije. Vi
ste ludi. Samo sedam dana bez sanjanja i postajete samoobmanuti. Poinju da se dogaaju
halucinacije. Vai snovi su proiavajui - unutranja katarza, tako svake noi vi zavaravate
sebe. Do jutra ste malo otrenjeni - ali do veeri opet sakupite mnogo energije. Tokom noi
morate sanjati i izbaciti je napolje.
Ovo se deava vozaima, i mnoge nesree se dogaaju zbog ovoga. Nou, nesree se
deavaju oko etiri sata ujutru, jer voza je vozio celu no. Nije sanjao; tada se energija sna
akumulirala. On vozi otvorenih oiju i poinje da vidi varke. "Put je prav" kae on. "Nema
nikoga, nijedan kamion ne dolazi." I s otvorenim oima on ide u kamion. Ili vidi da kamion
dolazi, a da bi ga izbegao on tresne u drvo - a nije bilo kamiona.
Mnoga istraivanja su izvrena zato se toliko nesrea deava oko etiri. Zapravo oko
etiri vi sanjate najvie. Od etiri do pet, do est vi najvie sanjate. To je stanje sanjanja.
Spavali ste dobro; vie nema potrebe za spavanjem (dubokim snom bez snova), sada moete
sanjati. Ujutru sanjate, a u to vreme ako ne sanjate, ako vam nije doputeno da sanjate vi
stvarate privienja. Sanjaete sa otvorenim oima.
Privienje znai sanjanje sa otvorenim oima, inae svako sanja na taj nain. Vidite
enu i mislite ona je sasvim lepa. To moda nee biti sluaj. Vi moda na nju projektujete
obmanu. Moda ste seksualno izgladneli. Onda postoji energija i vi ste zavedeni. Posle dva
dana, tri dana, ena izgleda obino. Vi mislite da ste bili zavedeni, obmanuti. Niko vas ne
obmanjuje; vi sebe... Ali zavedeni ste. Ljubavnici zavode jedno drugo. Oni sanjaju sa
otvorenim oima, a onda su razoarani. Niko drugi nije kriv - samo vae stanje.
Patanjali kae, obmana e ieznuti ako paljivo pevate Aum. Kako e se to dogoditi?
Zato to obmana oznaava stanje sanjanja, kada ste izgubljeni. Vie niste tu; samo san je tu.
Ako meditirate na Aum stvarate zvuk Aum i svedok ste, vi ste tu. Vae prisustvo ne moe
dopustiti nikakvom snu da se dogodi. Kad god vi jeste, nema sanjanja. Kad god postoji san, vi
niste. Vi oboje ne moete biti zajedno. Ako ste vi tu, san e ieznuti. Ili ete vi morati da
ieznete. Oboje zajedno ne moete biti. San i svest nikada se ne susreu. Zbog toga obmana
iezava svedoenjem zvuka Aum.
"Nemo" je takoe tu prisutna, neprekidno se osea. Vi se sami oseate bespomono;
to je nemo. Oseate da ne moete uiniti nita, bezvredni ste, beskorisni. Moete se
pretvarati da ste neko, ali vaa pretvaranje takoe pokazuje da duboko ispod oseate
nitavnost. Moete se pretvarati da ste vrlo moni, ali vae pretvaranje nije nita do skrivanje.
Kad god uete u okraj, poinjete oseati nemonost i bespomonost. ovek je nemoan jer
samo celina moe biti snana - ne ovek. Deo ne moe biti jak. Samo Bog je jak, ovek je
nemoan.
Kada pevate aumkar, Aum, po prvi put oseate da vie niste neko ostrvo. Postajete deo
itavog univerzalnog zvuka. Po prvi put se oseate snanim, ali sada ova snaga ne treba da
bude nasilna, ne treba da bude agresivna. Zapravo, moan ovek nikada nije agresivan. Samo
nemoni ljudi postaju agresivni da dokau sebi da su moni.
195
...nestabilnosti su prepreke koje ometaju um: Vi poinjete jednu stvar i onda stajete -
s vremena na vreme krenete napred i stanete - ponovo ponete i onda stanete. Nita nije
mogue s ovom nestabilnou. ovek mora da istraje, mora nastaviti da kopa jamu, na istom
mestu neprekidno. Ako ostavite svoj trud, va um je takav da ete posle nekoliko dana morati
opet da zaponete od ABC (od poetka); on ponovo navija (premotava) sebe, on odmotava
(odvija) sebe. Radite neto nekoliko dana, onda ostavite. Biete baeni natrag u va prvi dan
rada - opet ABC. Tako moete raditi mnogo, ali bez postizanja rezultata. Aum e vam dati
doivljaj rezultata.
Zato poinjete i stajete? Ljudi mi dolaze i kau da su meditirali jednu godinu, onda su
prestali. A ja ih pitam: "Kako ste se oseali?" Oni kau: "Vrlo, vrlo dobro smo se oseali" - ali
zato ste onda prestali? Niko ne prekida kada se osea istinski vrlo dobro. A oni kau: "Bili
smo vrlo sreni a onda smo prestali." To nije mogue. Ako ste sreni, kako moete prekinuti?
Onda bi oni rekli: "Ne sasvim sreni".
Inae oni su u nevolji. Oni se pretvaraju ak i da su sreni. Ako ste sreni u odreenoj
stvari, vi je ne prekidate. Zaustavljate se samo kada je to dosadna stvar, gnjavaa,
nezadovoljstvo. Sa Aum-om, Patanjali kae, osetiete prvi ukus upadanja u univerzalno. Taj
ukus e postati vae zadovoljstvo i nestabilnost e nestati. Zbog toga on kae da e pevanjem
Aum-a i njegovim svedoenjem sve prepreke otpasti.
alost, beznadenost, nervoza i nepravilno disanje su simptomi poremeenog uma.
Ovo su simptomi. alost, tuga: uvek uznemireno kretanje, uvek rascep, uvek
nespokojan um, uvek tuan, u oajanju, suptilni drhtaji u telu, jer kada se telesna energija ne
kree u krugu vi imate tanane drhtaje, ustreptalost, strah i nepravilno disanje. Onda vae
disanje ne moe biti ritmiko. Ne moe biti pesma; ne moe biti harmonija. Nepravilno
disanje...
Ovo su simptomi poremeenog uma, a naspram ovoga su simptomi uma koji je
usredsreen. Pojanje Aum-a e vas uiniti usredsreenim. Vae disanje e postati ritmino.
Vai drhtaji u telu e nestati; neete biti nervozni. Tuga e biti zamenjena oseanjem sree,
radosti, suptilnim blaenstvom na vaem licu, bez ikakvog razloga. Jednostavno ste sreni;
samo zato to ste ovde, vi ste sreni; jednostavno diui vi ste sreni. Ne traite mnogo, a
umesto jada bie srea.
Da biste njih uklonili, meditirajte ne jednom objektu.
Ovi simptomi rastrojenog uma mogu biti uklonjeni meditiranjem na jednom principu.
Taj jedan princip je pranava - Aum, univerzalni zvuk.
196
Poglavlje 8
OD HAOSA DO HAOSA SA AUM
Izlaganje 8. januara 1975. u Buddha dvorani.
Prvo pitanje:
Put izgleda da je ka miru i svesti. Zato je onda svako i sve oko nas u takvom haosu?
Jer ja sam haos! Jedino iz haosa je kosmos roen; nema drugog puta. Vi ste kao stara,
vrlo stara, drevna graevina; ne moete biti potpuno obnovljeni. Milionima ivota ste bili
ovde. Prvo morate biti potpuno razvaljeni, i samo onda ponovo stvoreni.
Rekonstrukcija je mogua, ali to nee dugo pomoi. Bie to samo povrinska
dekoracija. Duboko u vaim temeljima vi ete ostati stari, i cela konstrukcija e uvek ostati
klimava. Moe pasti svakog dana. Novi temelji su potrebni - sve novo. Morate biti sasvim
ponovo roeni, inae e to biti prepravka. Moete biti obojeni spolja, ali ne postoji nain da
obojite unutranje. Unutranje e ostati isto - ista stara propala stvar.
Potreban je diskontinuitet. Ne treba vam se dozvoliti da trajete. Procep... Staro
jednostavno umire, a novo izlazi iz njega - iz smrti. Postoji procep izmeu starog i novog;
inae staro bi moglo da se nastavi. Zaista sve prepravke se ine samo da spasu staro, a ja ne
prepravljam. Ako se opirete tome, haos e se za vas nastaviti. Onda to traje due vreme.
Ako dozvolite to da se dogodi, to se takoe moe desiti i za jedan trenutak. Ako
dozvolite da se to dogodi, staro iezava, a novo bie nastaje. To novo e biti boansko jer
nee doi iz prolosti, nee doi iz vremena. To e biti bezvremeno - izvan vremena. Nee
doi iz vas; neete biti otac i majka toga. To e doi iznenada ni iz ega.
Zbog toga Buda uporno tvrdi da to uvek dolazi iz niega. Vi ste neto; to je patnja. ta
ste vi zapravo? Samo prolost. Stalno akumulirate prolost; zato ste postali kao ruevina - vrlo
drevna ruevina. Samo shvatite poentu i ne pokuavajte da nastavite staro. Ostavite to.
Otuda, oko mene e uvek biti haos, jer ja neprekidno razvaljujem. Ja sam destruktivan
jer je to jedini nain da se bude kreativan. Ja sam kao smrt jer samo onda moete biti roeni
kroz mene. To je tano: ovde je haos. Neprekidno e trajati jer novi ljudi e dolaziti. Nikada
oko mene neete nai utvrenu odreenu ustanovu. Novi ljudi e dolaziti i ja u ih ruiti,
razvaljivati.
To se moe zaustaviti za vas individualno; ako mi dopustite da vas unitim potpuno,
za vas e haos ieznuti. Vi ete postati kosmos, skrivena harmonija; duboki red. Za vas e
haos ieznuti, ali oko mene e se nastaviti jer novi ljudi e dolaziti. Ovo mora da bude tako;
uvek je bilo tako.
Niste me vi to pitali prvi put. Isto su pitali Budu; isto su pitali Lao Ce-a; isto e se opet
pitati, jer gde god ima majstora, to znai da on koristi smrt kao sredstvo za uskrsnue. Morate
umreti; samo onda se ponovo moete roditi.
Haos je lep jer je to materica, a va takozvani red je ruan jer titi samo izumrlo,
mrtvilo. Smrt je lepa; mrtvilo nije lepo - zapamtite razliku. Smrt je lepa, ponavljam, jer smrt
je ivotna sila. Izumrlo nije lepo, jer mrtvo je ono mesto odakle je ivot ve premeten. To je
samo razvalina. Ne budite mrtav ovek; ne nosite prolost. Odbacite je, i proite kroz smrt. Vi
se bojite smrti, a ne bojite se mrtvila.
Isus je pozvao dva ribara da ga slede, i onog momenta kada su izlazili iz grada jedan
ovek je dotrao i pitao ribara: "Kuda ide? Tvoj otac je umro. Vrati se natrag." Oni su pitali<