Anda di halaman 1dari 30

Lampiran 12c

LAPORAN PERTANGGUNGJAWABAN KEGIATAN PENDIDIKAN


KESEHATANTENTANG SENAMASAM URAT PADA LANSIA
DI LINGKUNGAN PLALANGAN KELURAHAN BINTORO
KECAMATAN PATRANG KABUPATEN
JEMBER 2013




Disusun Untuk Memenuhi Tugas Program Pendidikan Profesi Ners (P3N)
Stase Keperawatan Komunitas










oleh:

Muhammad Ulul Amri, S.Kep
NIM 082311101059











KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN
UNIVERSITAS JEMBER
PROGRAM STUDI ILMU KEPERAWATAN
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

Jl. Kalimantan 37 Kampus Tegal Boto Jember Telp. /Fax (0331) 323450
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

BAB I. PENDAHULUAN

1.1 Analisis Situasi
WHO mendata penderita gangguan sendi di Indonesia mencapai 81% dari
populasi, hanya 24% yang pergi ke dokter, sedangkan 71% nya cenderung
langsung mengkonsumsi obat-obatan pereda nyeri yang dijual bebas. Angka ini
menempatkan Indonesia sebagai negara yang paling tinggi menderita gangguan
sendi jika dibandingkan dengan negara di Asia lainnya seperti Hongkong,
Malaysia, Singapura dan Taiwan. Penyakit sendi secara nasional prevalensinya
berdasarkan wawancara sebesar 30,3% dan prevalensi berdasarkan diagnosis
tenaga kesehatan adalah 14% (Riskesdas 2007-2008). Faktor-faktor yang
mempengaruhi penyakit sendi adalah umur, jenis kelamin, genetik, obesitas dan
penyakit metabolik, cedera sendi, pekerjaan dan olah raga (Rabea, 2009).
Penyakit gout merupakan salah satu penyakit degeneratif. Salah satu tanda
dari penyakit gout adalah adanya kenaikan kadar asam urat dalam darah
(hiperurisemia). Faktor-faktor yang berhubungan dengan kejadian hiperurisemia
adalah jenis kelamin, IMT, asupan karbohidrat dan asupan purin. Asupan purin
merupakan faktor risiko paling kuat yang berhubungan dengan kejadian
hiperurisemia (Setyoningsih, 2009).
Hiperurisemia yang merupakan kondisi predisposisi untuk gout, sangat
berhubungan erat dengan sindrom metabolik seperti : hipertensi, intoleransi
glukosa, dislipidemia, obesitas truncal, dan peningkatan resiko penyakit
kardiovaskular. Didapatkan bukti bahwa hiperurisemia sendiri mungkin
merupakan faktor risiko independen untuk penyakit kardiovaskular. Insiden dan
prevalensi gout di seluruh dunia tampaknya meningkat karena berbagai alasan,
termasuk yang iatrogenik. Gout memengaruhi minimal 1% dari populasi di
negara-negara Barat dan merupakan penyakit yang paling umum bersama
inflamasi pada pria lebih tua dari 40 tahun (Andrew, 2005). Satu survei
epidemiologik yang dilakukan di Bandungan, Jawa Tengah atas kerjasama WHO
COPCORD terhadap 4.683 sampel berusia antara 15 45 tahun didapatkan bahwa
prevalensi hiperurisemia sebesar 24,3 % pada laki-laki dan 11,7% pada wanita
(Purwaningsih, 2010).
Sebagian besar kasus gout dan hiperurisemia termasuk hiperurisemia
asimptomatik, mempunyai latar belakang penyebab primer, sehingga memerlukan
pengendalian kadar asam urat jangka panjang. Perlu komunikasi yang baik
dengan pasien untuk mencapai tujuan terapi. Hal itu dapat diperoleh dengan
edukasi dan diet rendah purin yang menjadi tatalaksana (Hidayat, 2009).
Pencegahan lainnya berupa penurunan konsumsi alkohol dan penurunan berat
badan (Misnadiarly, 2007)
Gejala dari gout berupa serangan nyeri sendi yang bersifat akut, biasanya
menyerang satu sendi disertai demam, kemudian keluhan membaik dan disusul
masa tanpa keluhan yang mungkin berlanjut dengan nyeri sendi kronis. Hampir
85-90% penderita yang mengalami serangan pertama biasanya mengenai satu
persendian dan umumnya pada sendi antara ruas tulang telapak kaki dengan jari
kaki. (Yatim, 2006). Dari uraian di atas, jelaslah bahwa gout arthritis disebabkan
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

oleh multifaktor beberapa diantaranya adalah kurangnya pengetahuan masyarakat
mengenai gout arthritis dan tindakan preventif terhadap faktor resiko.
Berdasarkan hasil pengkajian pada sampel jumlah penduduk di Kelurahan
Bintoro didapatkan hasil bahwa jumlah lansia yang terdata di Kelurahan Bintoro
adalah sebanyak 130 lansia. Lansia dalam kondisi sehat sebanyak 127 lansia
(97,7%) dan 3 lansia (2,3%) dalam kondisi sakit. Sebagian besar yaitu 73 lansia
(56,2%) merokok, dan sisanya yaitu 57 lansia (43,8%) tidak merokok. Sebagian
besar yaitu sebanyak 87 lansia (66,9%) tetap bekerja, 40 lansia (30,8%) tidak
bekerja, dan 3 lansia (2,3%) hanya mengasuh cucu dalam kegiatan kesehariannya.
3 masalah kesehatan yang banyak dialami oleh lansia yaitu hipertensi sebanyak 40
lansia (30,6%), pusing sebanyak 30 lansia (23,1%), dan linu-linu sebanyak 27
lansia (20,8%). Data tersebut menunjukkan semakin kompleksnya masalah
dialami seorang lansia, sehingga perlu adanya suatu latihan senam asam urat
lansia untuk mengurangi rasa nyeri akibat penyakit asam urat.


1.2 Rumusan Masalah
Apakah dengan pemberian pelatihan senam asam urat mampu menurunkan
dan meringankan rasa nyeri akibat penyakit asam urat pada kelompok lansia yang
memiliki penyakit asam urat?


























Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

BAB II. TUJUAN DAN MANFAAT

1.1 Tujuan
1.1.1 Tujuan Umum
Setelah diberikan pendidikan kesehatan senam asam urat diharapkan
kelompok lansia di Lingkungan Plalangan Kelurahan Bintoro
Kecamatan Patrang mengetahui dan mempraktekkan pentingnya senam
asam urat untuk meringankan dan menurunkan rasa nyeri akibat
penyakit asam urat.

1.1.2 Tujuan Khusus
a. Lansia mengetahui manfaat latihan senam asam urat;
b. Lansia mampu menyebutkan prinsip senam asam urat dengan
benar;
c. Lansia mampu mengikuti gerakan latihan senam asam urat;
d. Lansia mampu mendemonstrasikan gerakan dalam latihan senam
asam urat;
e. Lansia mampu melakukan senam asam urat secara rutin.

1.1 Manfaat
Setelah diberikan pelatihan senam asam urat lansia, diharapkan :
a. Senam asam urat dilakukan secara rutin dan teratur oleh lansia untuk
meringankan rasa nyeri akibat penyakit asam urat;
b. Sebagai upaya pencegahan lansia agar terhindar dari penyakit asam urat.


BAB III. KERANGKA PENYELESAIAN MASALAH

3.1 Dasar Pemikiran
Lanjut usia adalah bagian dari proses tumbuh kembang. Menurut Undang-
Undang Nomor 13 Tahun 1998 tentang kesejahteraan lanjut usia, yang dimaksud
lanjut usia adalah seseorang yang mencapai usia 60 tahun ke atas (Azizah, 2011).
Menurut Surini & Utomo (2003, dalam Azizah, 2011), lanjut usia bukanlah suatu
penyakit, namun merupakan tahap lanjut dari suatu proses kehidupan yang akan
dijalani semua individu, ditandai dengan penurunan kemampuan tubuh untuk
beradaptasi dengan stres lingkungan
Usia lanjut atau lansia lebih diidentikkan sebagai masa dimana terjadi
perubahan atau penurunan status kesehatan pada tubuh. Lansia dapat menghadapi
tantangan yang berkaitan dengan usia melalui realisme dan pengembangan
pengetahuan tentang kebutuhan kesehatan mereka, serta tentang sumber yang
tersedia untuk membantu lansia dalam mengelola kesehatan lansia sendiri.
Promosi kesehatan lansia difokuskan pada pencegahan terhadap semua penurunan
fungsi tubuh serta mempertahankan kemampuan lansia untuk tetap mandiri. Unsur
penting dalam perawatan preventif pada lansia adalah memastikan penggunaan
layanan kesehatan yang ada secara optimal, dan organisasi institusi layanan
kesehatan. Program pemeliharaan kesehatan harus berdasar pada pemahaman
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

yang jelas tentang sumber tersedia untuk pencegahan primer, sekunder, dan tersier
(Maas et al, 2011).
Hal terpenting dalam upaya meningkatkan derajat kesehatan lansia yaitu
dengan upaya pencegahan primer. Pencegahan primer lebih menekankan
pentingnya latihan fisik ataupun upaya-upaya yang harus dilakukan dalam
mencegah munculnya berbagai masalah kesehatan, termasuk pemberian
pengetahuan lansia tentang pola hidup sehat saat usia lanjut. Lansia harus
diberikan pemahaman serta motivasi untuk melakukan latihan fisik yang rutin
setiap hari namun tidak berat serta melakukan pola hidup sehat. Lansia yang
merokok harus diberikan informasi bahwa mereka dapat meningkatkan derajat
kesehatannya dan mencegah berbagai penyakit jika berhenti merokok, selain itu
lansia harus diingatkan tentang dampak negatif kebiasaan makan yang berlebihan,
ataupun penggunaan alkohol terhadap peningkatan angka kesakitan pada lansia
(Williams, 1995, dalam Maas et al, 2011).


3.2 Kerangka Penyelesaian Masalah
Penuaan adalah proses normal dengan perubahan fisik dan tingkah laku yang
dapat terjadi pada semua orang pada saat mereka mencapai usia tahap
perkembangan kronologis tertentu. Penuaan merupakan fenomena yang kompleks
dan multidimensional yang dapat diobservasi di dalam satu sel dan berkembang
sampai pada keseluruhan sistem (Stanley & Beare, 2006). Proses penuaan
merupakan akumulasi secara progresif dari berbagai perubahan fisiologi organ
tubuh yang berlangsung seiring berlalunya waktu. Proses penuaan akan
meningkatkan kemungkinan terserang penyakit bahkan kematian (Azizah, 2011)
Adanya penuaan didalam suatu populasi telah diperhatikan oleh the Public Health
Service dan the Institute of Medicine. Dalam laporan terbaru dari bagian bedah
umum yang berjudul Healthy People 2000: Citizens Chart the Course, perhatian
utama diberikan untuk peningkatan kesehatan dan pencegahan penyakit yang
diperlukan lansia. Perawat membagi tanggung jawab dengan anggota masyarakat
lain untuk memulai dan mendukung tindakan dalam rangka memenuhi kebutuhan
kesehatan dan sosial masyarakat. Tanggung jawab tersebut telah ditunjukkan
dalam International Council of Nurses Code for Nurses (ICN), yang
menyarankanagar perawat berkolaborasi dengan anggota profesi dan anggota
masyarakat lainnya dalam promosi upaya komunitas dan nasional untuk
memenuhi kebutuhan kesehatan masyarakat khususnya pada kelompok usia lansia
(Stanley, 2006). Di samping itu para lansia perlu diberikan motivasi untuk
mempertahankan pola hidup sehat yakni dengan mengkonsumsi makanan yang
bergizi seimbang, melakukan aktivitas fisik/olahraga secara benar dan teratur,
tidak merokok, hindari faktor resiko penyakit degeneratif, memeriksakan
kesehatan secara teratur, terus menyalurkan hobby dan kebiasaan dan aktivitas
yang bermanfaat(Kemenkes RI, 2010).
Senam hipertensi adalah bagian dari usaha untuk mengurangi berat badan dan
mengelola stress-dua faktor yang mempertinggi resiko hipertensi. Dengan
melakukan gerakan / senam hipertensi yang tepat selama 30-40 menit atau lebih
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

sebanyak 3-4 hari per minggu, dapat menurunkan tekanan darah sebanyak 10
mmHg pada bacaan sistolik dan diastolik (Vitahealth, 2010)


BAB IV. RENCANA PELAKSANAAN KEGIATAN

4.3 Realisasi Penyelesaian Masalah
Realisasi dari hasil kegiatan ini adalah lansia mampu mengetahui dan
mempraktekkan senam asam urat lansia untuk meringankan rasa nyeri dan
sebagi upaya untuk mencegah terjadinya penyakit asam urat pada lansia.

4.4 Khalayak Sasaran
Khalayak sasaran dari kegiatan ini adalah kelompok lansia di Lingkungan
PlalanganKelurahan Bintoro Kabupaten Jember.

4.5 Metode yang Digunakan
Metode yang digunakan dalam kegiatan ini adalah dengan pelatihan senam
asam urat pada kelompok lansia di Lingkungan Plalangan Kelurahan Bintoro
Kecamatan Patrang Kabupaten Jember.



BAB V. HASIL KEGIATAN

5.1 Analisis Evaluasi dan Hasil Kegiatan
5.1.1 Evaluasi Struktur
a. Kegiatan pendidikan kesehatan tentang senam asam urat dilakukan
pada hari Sabtu, tanggal 21 Desember 2013 pukul 16.00-17.00
WIB.
b. Pemateri dan rekan menuju tempat dilakukannya pendidikan
kesehatan tentang senam asam urat lansiapada acara pengajian di
Musholladi Lingkungan Plalangan pada pukul 16.00 WIB. Acara
dimulai pada mulai pukul 16.00 WIB
c. Persiapan lain yang dilakukan adalah menyiapkan ruang dan
perlengkapan untuk senam misalnya mic dan sound.
d. Persiapan kegiatan pendidikan kesehatan tentang senam asam urat
lansiayang terdiri dari preplanning (Bab I-IV), SAP, SOP, leaflet,
lembar daftar hadir dan berita acara.
e. Pemateri mampu menyiapkan diri untuk bersikap empati, netral,
menghargai dan caring pada lansia.
f. Pemateri telah melakukan pengkajian yang akurat dari berbagai
sumber (klien, masyarakat) sebagai data dasar sebelum memulai
proses pendidikan kesehatan tentang senam asam urat lansia.
g. Lansia menyatakan bersedia mengikuti proses pendidikan
kesehatan tentang senam asam urat.
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

h. Telah terbina mutual relationship dan trust relationship antara
lansia dan pemateri.
5.1.2 Evaluasi Proses
Selama proses kegiatan berjalan dengan lancar dan dengan durasi
waktu yang lebih singkat dari perencanaan awal yaitu 15 menit,
dimana pada perencanaan awal waktunya 30 menit. Hal tersebut
disebabkan karena peserta kooperatif dan adanya bantuan rekan
sebagai fasilitator saat kegiatan senam sangat membantu
memperlancar jalannya kegiatan pendidikan kesehatan tentang senam
asam urat lansia. Adanya peran rekan sebagai fasilitator cukup optimal
untuk membantu lansia apabila kesulitan dalam menirukan gerakan
yang dicontohkan oleh pemateri.
5.1.3 Evaluasi Hasil
a. Kegiatan pendidikan kesehatan tentang senam asam urat
lansiadihadiri oleh20orang yang terdiri dari 15 lansia dan
5mahasiswa P3N Universitas Jember.
b. Lansia tampak antusias mengikuti gerakan senam asam urat
lansiayang didemonstrasikan.
c. Lansia mengikuti semua rangkaian gerakan senam asam urat
lansia mulai dari awal sampai akhir.
d. Lansia aktifmenjawab dan mempraktekkan ulang gerakan senam
asam urat lansiayang telah diajarkan saat dilakukan posttest.

5.2 Faktor Pendorong
5.2.1 Dukungandarikaderdanbidandesa, yang
menyambutbaikdanmemberikanizindenganadanyapendidikankesehata
ntentangsenam asam urat lansiapadalansia di
LingkunganPlalanganKelurahanBintoroKecamatanPatrangKabupatenJ
ember.
5.2.2 Kader
posyandumemfasilitasitempatuntukdiberikannyapendidikankesehatant
entangsenam asam urat lansia.
5.2.3 Lansiaantusiasuntukmengikutikegiatansenam asam urat lansia.
5.2.4 Mahasiswa P3N
lainnyamembantupelaksanaankegiatanpendidikankesehatantentangsen
am asam urat lansia, baikmenjadifasilitator, dokumentasi, presensi,
dansebagainya.

5.3 Faktor Penghambat
5.3.1 Adanya kendala bahasa antara pemateri dengan lansia yang mayoritas
bersuku Madura, sehingga membutuhkan bantuan dari mahasiswa lain
dalam memberikan instruksi saat mendemostrasikan gerakan senam
asam urat lansia.



Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013




BAB VI. KESIMPULAN DAN SARAN

6.1 Kesimpulan
Berdasarkan dari hasil evaluasi kegiatan pendidikan kesehatan tentang
senam asam urat lansiadiketahui bahwasebelumnya mayoritas lansia yang hadir
tidak mengetahui tentang senam asam urat lansia, namun setelah dilakukan
kegiatan pendidikan kesehatan tentang senam asam urat lansia, mayoritas lansia
mampu menjawab dan mempraktekkan gerakan dalam senam asam urat
lansiadengan baik.Hal ini menunjukkan bahwa pendidikan kesehatan tentang
senam asam urat lansia pada lansia dapat meningkatkan pengetahuan dan
keterampilan lansia melakukan senam asam urat lansiadalam upaya
meningkatkan derajat kesehatan lansia dan pencegahan terjadinya masalah
kesehatan yang sering terjadi pada usia lansia di Kelurahan Bintoro Kecamatan
Patrang Kabupaten Jember.

6.2 Saran
6.2.1 BagiSasaran (Lansia)
Lansiadiharapkanrutin secara mandirimelakukansenam asam urat
lansiasebagaiupayameningkatkanderajatkesehatan dan
pencegahanterjadinyamasalahkesehatan pada lansia,
misalnyadenganmelakukansenam jantung sehat lansiasenam asam urat
lansiaseminggu 3 kali.
6.2.2 BagiKeluarga
Keluargadiharapkanmampuuntukmemotivasi dan
memfasilitasilansiadalammelakukansenam asam urat lansia di rumah,
misalnyadenganmemberikanruangataumengingatkanlansiauntukmelak
ukansenam asam urat lansia secara rutin.
6.2.3 BagiMasyarakat
Saran yang dapatdiberikanpada
masyarakatyaitumasyarakatKelurahanBintoro,
khususnyakepalalingkungan, ketua RW, ketua RT, dan
kaderPosyanduPlalangan, diharapkan juga turutmemperhatikan dan
meningkatkankesadaranwarganyauntukbersediamengikutikegiatansep
ertiposyandulansia dan memeriksakankepelayanankesehatan.
6.2.4 BagiTenagaKesehatan
Bagitenagakesehatansetempatkhususnya pada
bidandesaatauperawatdiharapkanlebihmengaktifkanpelayanankesehata
nmelaluiposyandulansia di LingkunganPlalangan dan
dapatmenarikminatlansiadengan cara mengadakansenam pada
lansiaataupendidikankesehatantentangpenyakit yang
seringdialamilansiasaatposyandulansia.

Lampiran
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

1. SAPsenam asam urat lansia;
2. SOP senam asam urat lansia;
3. Materi senam asam urat lansia;
4. Media: leaflet;
5. Berita Acara;
6. Daftar Hadir;
7. Dokumentasi Kegiatan.


DAFTAR PUSTAKA

Abdullah, ginting. Konsep Hipertensi Lansia. Bandung: Media Swara
AHA, 2003. Heart and disease. www.aha.org [diakses tanggal 15 Desember 2013]
Andra, Hasbullah. Perawatan Lanjut Usia. Yogyakarta: Media Press
Andi, Bastian. Senam Jantung Sehat Untuk Lansia. Surabaya: Gita Pariwara.
Budi, prianto. 2000. Konsep Usia Lanjut. Jakarta: TIM
Gunawan, 2001. Lansia dan permasalahannya. Jakarta: Penerbit TIM
Maas, Meridean et al. 2011. Asuhan Keperawatan Geriatrik. Jakarta:EGC.
Nugroho, Wahyudi SKM, 2000, Keperawatan Gerontik (edisi 2), penerit buku
Kedokteran EGC : Jakarta
Stanley, Mickey dan Beare, Patricia. 2006. Buku Ajar Keperawatan Gerontik edisi
2. Jakarta: EGC.
Subdit Perkesmas, Perawatan Pada Usia Lanjut, Dir. Yankesmas Depkes RI,
Jakarta 1982
Vitahealth, 2010. Hipertensi Informasi Untuk Penderita dan Keluarganya.
Jakarta: General Media




















Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013






Lampiran 1

Satuan Acara Penyuluhan (SAP)


Topik/Materi : Pelatihan SenamAsamUrat
Sasaran: KelompokLansia di LingkunganPlalanganKelurahanBintoro
Hari/Tanggal :Sabtu, 21 Desember 2013
Waktu : 1 x 30 menit
Tempat :MushollaLingkunganPlalangan


A. Latar Belakang:
WHO mendata penderita gangguan sendi di Indonesia mencapai 81% dari
populasi, hanya 24% yang pergi ke dokter, sedangkan 71% nya cenderung
langsung mengkonsumsi obat-obatan pereda nyeri yang dijual bebas. Angka ini
menempatkan Indonesia sebagai negara yang paling tinggi menderita gangguan
sendi jika dibandingkan dengan negara di Asia lainnya seperti Hongkong,
Malaysia, Singapura dan Taiwan. Penyakit sendi secara nasional prevalensinya
berdasarkan wawancara sebesar 30,3% dan prevalensi berdasarkan diagnosis
tenaga kesehatan adalah 14% (Riskesdas 2007-2008). Faktor-faktor yang
mempengaruhi penyakit sendi adalah umur, jenis kelamin, genetik, obesitas dan
penyakit metabolik, cedera sendi, pekerjaan dan olah raga (Rabea, 2009).
Penyakit gout merupakan salah satu penyakit degeneratif. Salah satu tanda
dari penyakit gout adalah adanya kenaikan kadar asam urat dalam darah
(hiperurisemia). Faktor-faktor yang berhubungan dengan kejadian hiperurisemia
adalah jenis kelamin, IMT, asupan karbohidrat dan asupan purin. Asupan purin
merupakan faktor risiko paling kuat yang berhubungan dengan kejadian
hiperurisemia (Setyoningsih, 2009).
Hiperurisemia yang merupakan kondisi predisposisi untuk gout, sangat
berhubungan erat dengan sindrom metabolik seperti : hipertensi, intoleransi
glukosa, dislipidemia, obesitas truncal, dan peningkatan resiko penyakit
kardiovaskular. Didapatkan bukti bahwa hiperurisemia sendiri mungkin
merupakan faktor risiko independen untuk penyakit kardiovaskular. Insiden dan
prevalensi gout di seluruh dunia tampaknya meningkat karena berbagai alasan,
termasuk yang iatrogenik. Gout memengaruhi minimal 1% dari populasi di
negara-negara Barat dan merupakan penyakit yang paling umum bersama
inflamasi pada pria lebih tua dari 40 tahun (Andrew, 2005). Satu survei
epidemiologik yang dilakukan di Bandungan, Jawa Tengah atas kerjasama WHO
COPCORD terhadap 4.683 sampel berusia antara 15 45 tahun didapatkan bahwa
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

prevalensi hiperurisemia sebesar 24,3 % pada laki-laki dan 11,7% pada wanita
(Purwaningsih, 2010).


Sebagian besar kasus gout dan hiperurisemia termasuk hiperurisemia
asimptomatik, mempunyai latar belakang penyebab primer, sehingga memerlukan
pengendalian kadar asam urat jangka panjang. Perlu komunikasi yang baik
dengan pasien untuk mencapai tujuan terapi. Hal itu dapat diperoleh dengan
edukasi dan diet rendah purin yang menjadi tatalaksana (Hidayat, 2009).
Pencegahan lainnya berupa penurunan konsumsi alkohol dan penurunan berat
badan (Misnadiarly, 2007)
Gejala dari gout berupa serangan nyeri sendi yang bersifat akut, biasanya
menyerang satu sendi disertai demam, kemudian keluhan membaik dan disusul
masa tanpa keluhan yang mungkin berlanjut dengan nyeri sendi kronis. Hampir
85-90% penderita yang mengalami serangan pertama biasanya mengenai satu
persendian dan umumnya pada sendi antara ruas tulang telapak kaki dengan jari
kaki. (Yatim, 2006). Dari uraian di atas, jelaslah bahwa gout arthritis disebabkan
oleh multifaktor beberapa diantaranya adalah kurangnya pengetahuan masyarakat
mengenai gout arthritis dan tindakan preventif terhadap faktor resiko.
Berdasarkan hasil pengkajian pada sampel jumlah penduduk di Kelurahan
Bintoro didapatkan hasil bahwa jumlah lansia yang terdata di Kelurahan Bintoro
adalah sebanyak 130 lansia. Lansia dalam kondisi sehat sebanyak 127 lansia
(97,7%) dan 3 lansia (2,3%) dalam kondisi sakit. Sebagian besar yaitu 73 lansia
(56,2%) merokok, dan sisanya yaitu 57 lansia (43,8%) tidak merokok. Sebagian
besar yaitu sebanyak 87 lansia (66,9%) tetap bekerja, 40 lansia (30,8%) tidak
bekerja, dan 3 lansia (2,3%) hanya mengasuh cucu dalam kegiatan kesehariannya.
3 masalah kesehatan yang banyak dialami oleh lansia yaitu hipertensi sebanyak 40
lansia (30,6%), pusing sebanyak 30 lansia (23,1%), dan linu-linu sebanyak 27
lansia (20,8%). Data tersebut menunjukkan semakin kompleksnya masalah
dialami seorang lansia, sehingga perlu adanya suatu latihan senam asam urat
lansia untuk mengurangi rasa nyeri akibat penyakit asam urat.


B. Tujuan
1. Tujuan Instruksional Umum:
Setelah diberikan pelatihan senam asam urat diharapkan kelompok lansia
di Lingkungan Plalangan Kelurahan Bintoro Kecamatan Patrang mampu
memahami dan mempraktekkan pentingnya senam asam urat untuk
menurunkan rasa nyeri akibat gejala asam urat.
2. Tujuan Instruksional Khusus:
Setelah dilakukan pendidikan kesehatan tentang lansia sehat diharapkan:
a. Lansia mengetahui manfaat latihan senam asam urat;
b. Lansia mampu menyebutkan prinsip senam asam uratdengan benar;
c. Lansia mampu mengikuti gerakan latihan senam asam urat;
d. Lansia mampu mendemonstrasikan gerakan dalam latihan senam asam
urat;
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

e. Lansia mampu melakukan senam asam urat secara rutin.



C. Garis Besar Materi
1. Pengertian dan tujuan senam asam urat;
2. Indikasi dan kontraindikasi senam asam urat;
3. Langkah-langkah senam asam urat.

D. Metode:
1. Demonstrasi
2. Praktek

E. Media/Alat yang digunakan:
Leaflet

F. Proses Kegiatan
Proses
Tindakan Media dan
alat
penyuluhan
Kegiatan Penyuluhan Kegiatan Peserta
Pendahuluan
(5 menit)
1. Memberi salam,
memperkenalkan diri, dan
membuka penyuluhan.
2. Menjelaskan tentang TIU
dan TIK.
3. Menjelaskan tentang
manfaat senam anti stroke
bagi lansia
Memperhatikan dan
menjawab salam

Memperhatikan

Memperhatikan


Penyajian
(20 menit)
1. Menanyakan kepada
lansia tentang latihan yang
akan disampaikan, apakah
pernah diperoleh
sebelumnya.
2. Menerima jawaban dan
memberi komentar
terhadap jawaban keluarga
3. Menjelaskan tentang
pengertian dan tujuan
senam lansia sehat
a. Menanyakan kepada
lansia mengenai materi
yang baru disampaikan.
b. Mendiskusikan
bersama jawaban yang
diberikan.
4. Menjelaskan tentang
Memperhatikan dan
menjawab



Memberikan
sumbang saran

Memperhatikan


Memberikan
pertanyaan


Memperhatikandan
memberi tanggapan

Leaflet

















Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

indikasi dan
kontraindikasi senam
lansia sehat
a. Menanyakan kepada
lansia mengenai materi
yang baru disampaikan.
b. Mendiskusikan
bersama jawaban yang
diberikan.
5. Menjelaskan langkah-
langkah dan
mempraktikkan senam
lansia sehat
a. Mengajarkan lansia
senam asam urat.
b. Meminta lansia untuk
mempraktikkan senam
asam urat secara
mandiri.
Memperhatikan


Memberikan
pertanyaan

Memperhatikandan
memberi tanggapan

Memperhatikandan
memberi tanggapan
Memperhatikan dan
mempraktikkan













Penutup
(5 menit)
1. Memberi kesempatan
kepada lansia untuk
bertanya tentang materi
yang baru disampaikan.
2. Menampung jawaban dan
memberi komentar
tentang pendapat dari
lansia
3. Bersama-sama dengan
lansia menyimpulkan
materi yang telah dibahas.
4. Menutup pertemuan dan
memberi salam
Memberikan
pertanyaan


Memperhatikan


Memberikan
sumbang saran

Memperhatikan dan
membalas salam


G. Evaluasi:
1. Apa pengertian senam asam urat lansia?
2. Apa tujuan senam asam uratlansia?
3. Apa indikasi dan kontraindikasi senam asam uratlansia?
4. Bagaimana gerakan senam asam urat lansia?

H. Referensi:

Maas, Meridean et al. 2011. Asuhan Keperawatan Geriatrik. Jakarta:EGC.
Nugroho, Wahyudi SKM, 2000, Keperawatan Gerontik (edisi 2), penerit buku
Kedokteran EGC : Jakarta
Stanley, Mickey dan Beare, Patricia. 2006. Buku Ajar Keperawatan Gerontik edisi
2. Jakarta: EGC.
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013





Pemateri,



Muhammad UlulAmri, S.Kep.
NIM 082311101059




































Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013






PROGRAM
PENDIDIKAN
PROFESI NERS
PSIK UNEJ
JUDUL SOP
SENAM ASAM URAT PADA LANSIA
PROSEDUR
TETAP
NO DOKUMEN
:
NO REVISI : HALAMAN :
TANGGAL
TERBIT :
DITETAPKAN OLEH :
Ketua PSIK
Universitas jember
1
.
PENGERTIAN Senam asam urat adalah senam atau
rangkaian gerakan anggota tubuh
sebagai suatu upaya untuk mencegah
dan meringankan gejala-gajala asam
urat serta berfungsi sebagai terapi
tambahan terhadap pasien asam urat
atau lansia dengan asam urat . Senam
ini juga sebagai salah satu modal untuk
memandu mencegah dan memberikan
terapi terhadap gejala asam urat.
2
.

TUJUAN 1. menurunkan rasa nyeri akibat asam
urat
2. meningkatkan kesehatan dan daya
tahan tubuh secara menyeluruh
3. melatih kekuatan otot-otot
persendian pada lansia.
3
.
INDIKASI Lansia dengan penyakit asam urat
4
.
KONTRAINDIKASI Pada lansia yang menderita asam urat
dengan adanya tanda radang seperti
nyeri, bengkak, merah pada daerah
sendi atau yang mengalami gangguan
gerak.
5
.
PERSIAPAN PASIEN 1. Jelaskan prosedur yang akan
dilakukan pada lansia
2. Kaji rentang gerak lansia
6
.
PERSIAPAN ALAT 1. kursi
2. karet gelang
Lampiran 2
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

3. mat
4. bantal
7
. CARA BEKERJA
1. Tahap Pertama: Latihan Pernapasan
a. Instruksikan lansia untuk duduk dengan nyaman dan punggung
ditegakkan
b. Instruksikan untuk menarik napas melalui hidung hingga tulang
rusuk terasa terangkat dan hembuskan napas melalui mulut seperti
meniup lilin
c. Instruksikan untuk melakukannya secara kontinu, minimal 4 set
dengan istirahat antar set 1-2 menit.
2. Tahap Kedua: Pemanasan (peregangan)
a. Instruksikan lansia untuk mengangkat kedua tangan
b. Instruksikan untuk menarik tangan ke samping kanan dengan
hitungan 1 X 8
c. Instruksikan untuk melakukan hal yang sama dengan menarik
tangan ke samping kiri.
d. Instruksikan lansia untuk menyilangkan tangan kanan dan
meletakkan di bahu kiri, tangan kiri mendorong siku kanan
dengan hitungan 1 x 8.
e.
f. Instruksikan untuk melakukan hal yang sama dengan menarik
tangan kiri ke bahu kanan.
g. Instruksikan untuk meletakkan tangan pada pinggang,
kemudian miringkan kearah kanan dan kiri secara bergantian
dengan hitungan 2 X 8.
3. Tahap Ketiga: Latihan Persendian
a. Sendi Leher
1) Instruksikan lansia untuk menegakkan kepalanya.
2) Anjurkan untuk memutar kepala ke kanan perlahan lahan hingga
kembali ke posisi awal.
3) Lanjutkan dengan memutar kepala ke kiri secara perlahan-lahan
hingga kembali ke posisi awal. Lakukan secara berulang
sebanyak 2X.
b. Sendi Bahu
1) Instruksikan lansia untuk berbaring dengan nyaman dengan
posisi lengan rileks di samping tubuh lansia.
2) Selanjutnya angkat lengan kanan secara perlahan ke arah
samping menjauhi tubuh, kemudian kembalikan pada posisi
semula. Ulangi gerakan yang sama untuk lengan kiri Anda.
Lakukan secara bergantian antara lengan kiri dan kanan.
Lakukan sebanyak 3X untuk masing-masing lengan.
3) Instruksikan lansia untuk menekuk siku ke arah samping dan
posisi telapak tangan menyentuh bahu.
4) Kemudian gerakkan kedua siku ke arah depan, hingga kedua
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

siku saling menyentuh. Lanjutkan dengan menggerakkan siku
kembali ke posisi awal hingga dada merasa tertarik ketika
menarik siku kembali ke posisi awal.

Senam Asam urat atau Sakit Sendi (Bahu)
c. Sendi Pinggul
1) Instruksikan lansia untuk berbaring dengan nyaman dengan
posisi ujung tumit menempel.
2) Kemudian jauhkan kaki kanan secara perlahan dari tubuh, lalu
kembalikkan ke posisi awal. Lakukan secara bergantian antara
kaki kanan dan kiri. Lakukan sebanyak 3X untuk masing-masing
kaki.

Senam Asam urat atau Sakit Sendi (Pinggul)
d. Pergelangan Kaki
1) Instruksikan lansia untuk memutar pergelangan kaki kanan
searah jarum jam secara perlahan kemudian lakukan arah
sebaliknya (berlawanan jarum jam).
2) Lakukan secara bergantian antara pergelangan kaki kanan dan
kiri dengan hitungan 1 X 8

Senam Asam urat atau Sakit Sendi (Pergelangan Kaki)

e. Pergelangan Tangan
1) Instruksikan lansia untuk menekuk jarijari tangan.
2) Kemudian putar pergelangan tangan searah jarum jam dan
kemudian berlawanan dengan jarum jam.
3) Lakukan secara bergantian antara pergelangan tangan kanan dan
kiri dengan hitungan 1 X 8

Senam Asam urat atau Sakit Sendi (Pergelangan Tangan)

f. Ruas Jari
1) Instruksikan lansia untuk menyentuh tiap jari-jari tangan dengan
ibu jari. Ulangi hingga 5 kali.
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

2) Lakukan secara bergantian antara jari tangan kanan dan kiri.

Senam Asam urat atau Sakit Sendi (Ruas Jari)

4. Tahap Kelima: Latihan Kardio
Instruksikan lansia untuk jalan di tempat selama 3-5 menit

5. Tahap Keenam: Peregangan (pendinginan)
1) Instruksikan lansia untuk memutar badan ke kanan dan ke kiri
sebanyak 2 X 8
2) Instruksikan lansia untuk menarik nafas dalam-dalam melalui
hidung dan menghembuskannya melalui mulut secara perlahan-
lahan.

8
.
EVALUASI
1. Tanyakan lansia bagaimana perasaannya
2. Kaji nyeri lansia dengan PQRST
3. Kaji kesulitan gerak pada sendi dengan cara menggerak-
menggerakkan sendi
4. Observasi adanya peradangan pada sendi
5. Kaji perubahan rentang gerak lansia
















Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


Lampiran 3


ASAM URAT

A. Pengertian
Gout arthritis sering dikenal dengan asam urat, yang sudah dikenal
sejak 2.000 tahun yang lalu dan menjadi salah satu penyakit tertua yang
dikenal manusia. Dulu, penyakit ini juga disebut "penyakit para raja" karena
penyakit ini diasosiasikan dengan kebiasaan mengonsumsi makanan dan
minuman yang enak-enak. Kini, asam urat bisa menimpa siapa saja, terutama
para penggemar makanan enak.
Gangguan asam urat ditandai dengan suatu serangan tiba-tiba di
aderah persendian. Saat bangun tidur, misalnya, ibu jari kaki dan pergelangan
kaki Anda terasa terbakar, sakit dan membengkak. Bahkan selimut yang
Anda gunakan terasa seperti batu yang membebani kaki. Seperti itulah gejala
asam urat alias arthritis gout.
Gangguan asam urat disebabkan oleh tingginya kadar asam urat di
dalam darah. Tingginya asam urat dalam darah menyebabkan terjadinya
penumpukan kristal di daerah persendian sehingga menimbulkan rasa sakit.
Selain rasa sakit di persendian, asam urat juga menyerang ibu jari kaki, dapat
membentuk tofi atau endapan natrium urat dalam jaringan di bawah kulit,
atau bahkan menyebabkan terbentuknya batu ginjal. Jika tidak diatasi
gangguan asam urat ini sangat mengganggu aktivitas. Selain dengan
mengonsumsi obat-obatan, pengaturan pola makanan dapat dijadikan pilihan
untuk mengatasi masalah asam urat. Menu makanan diatur sedemikian rupa
agar lebih banyak makanan dengan kandungan nukleotida purin yang rendah.
Kadar urat di darah tergantung usia dan jenis kelamin. Umunya, anak-
anak memiliki kadar asam urat antara 3,0-4,0 mg/dl. Kadar ini akan
meningkat dengan bertambahnya usia dan menurun saat menopause. Rata-
rata kadar asam urat pada laki-laki dewasa dan wanita premenopause sekitar
6.8 dan 6,0 mg/dl. Kadar asam urat pada orang dewasa cenderung meningkat
dengan bertambahnya usia, berat badan, tekanan darah, konsumsi alkohol dan
gangguan fungsi ginjal.

B. Gejala Gout Artrhitis
Asam urat memiliki tanda-tanda yakni:
1. nyeri sendi, terutama di jempol kaki yang kemudian merambat di
persendian kaki. Umumnya orang yang berusia 35 tahun ke atas rawan
terkena penyakit ini;
2. kesemutan dan linu;
3. nyeri terutama malam hari atau pagi hari saat bangun tidur;
4. sendi yang terkena asam urat terlihat bengkak, kemerahan, panas dan
nyeri luar biasa pada malam dan pagi.

Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


C. Prinsip Diet Yang Harus Dipatuhi Oleh Penderita Asam Urat
1. Pembatasan purin
Apabila telah terjadi pembengkakan sendi maka penderita gangguan
asam urat harus melakukan diet bebas purin. Yang harus dilakukan
adalah membatasi asupan purin menjadi 100-150 mg purin per hari (diet
normal biasanya mengandung 600-1.000 mg purin per hari).
2. Kalori sesuai dengan kebutuhan
Jumlah asupan kalori harus benar disesuaikan dengan kebutuhan
tubuh berdasarkan pada tinggi dan berat badan. Penderita gangguan asam
urat yang kelebihan berat badan, berat badannya harus diturunkannn
dengan tetap memperhatikan jumlah konsumsi kalori. Asupan kalori
yang terlalu sedikit juga bisa meningkatkan kadar asam urat karena
adanya keton bodies yang akan mengurangi pengeluaran asam urat
melalui urin.
3. Tinggi karbohidrat
Karbohidrat kompleks seperti nasi, singkong, roti dan ubi sangat
baik dikonsumsi oleh penderita gangguan asam urat karena akan
meningkatkan pengeluaran asam urat melalui uirn. Konsumsi karbohidrat
kompleks ini sebaiknya tidak kurang dari 100 gram per hari. Karbohidrat
sederhana jenis fruktosaa seperti gula, permen, arum manis, gulali, dan
sirop sebaiknya dihindari karena fruktosa akan meningkatkan kadar asam
urat dalam darah.
4. Rendah protein
Protein terutama yang berasal dari hewan dapat meningkatkan kadar
asam urat dalam darah. Sumber makanan yang mengandung protein
hewani dalam jumlah yang tinggi, misalnya hati, ginjal, otak, paru, dan
limpa. Asupan protein yang dianjurkan bagi penderita gangguan asam
urat adalah sebesar 50-70 gr/hari atau 0,8-1 gr/kg berat badan/hari.
Sumber protein yang disarankan adalahhh protein nabati yang berasal
dari susu, keju dan telur
5. Rendah lemak
Lemak dapat menghambat ekskresi asam urat melalui urin. Makanan
yang digoreng, bersantan, serta margarine dan mentega sebaiknya
dihindari. Konsumsi lemak sebaiknya sebanyak 15 % dari total kalori.
6. Tinggi cairan
Konsumsi cairan yang tinggi dapat membantu membuang asam urat
melalui urin. Karena itu, Anda disarankan untuk menghabiskan minum
minimal sebanyak 2,5 liter atau 10 gelas sehari. Selain dari minuman,
cairan bisa diperoleh melalui buah-buahan segar yang mengandung
banyak air. Buah-buahan yang disarankan adalah semangka, melon,
blewah, nanas, belimbing manis, dan jambu air. Selain buah-buahan
tersebut, buah-buahan yang lain juga boleh dikonsumsi karena buah-
buahan sangat sedikit mengandung purin. Buah-buahan yang sebaiknya
dihindari adalah alpukat dan durian, karena keduanya mempunyai
kandungan lemak yang tinggi.
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


7. Tanpa alkohol
Berdasarkan penelitian diketahui bahwa kadar asam urat mereka
yang mengonsumsi alkohol lebih tinggi dibandingkan mereka yang tidak
mengonsumsi alkohol. Hal ini adalah karena alkohol akan meningkatkan
asam laktat plasma. Asam laktat ini akan menghambat pengeluaran asam
urat dari tubuh.
8. Olahraga
Sebagaibentukpencegahandalammenanganipenyakitasamurat,
dapatdilakukandengansenamasamurat.
Senamasamuratadalahsenamataurangkaiangerakananggotatubuhsebagais
uatuupayauntukmencegahdanmeringankangejala-
gajalaasamuratsertaberfungsisebagaiterapitambahanterhadappasienasamu
ratataulansiadenganasamurat . Senaminijugasebagaisalahsatu modal
untukmemandumencegahdanmemberikanterapiterhadapgejalaasam.
Adapuntujuandarisenamasamuratadalah:
a. menurunkan rasa nyeriakibatasamurat
b. meningkatkankesehatandandayatahantubuhsecaramenyeluruh
c. melatihkekuatanotot-ototpersendianpadalansia.



SENAM ASAM URAT


1. Pengertian
Senam asam urat adalah senam atau rangkaian gerakan anggota tubuh sebagai
suatu upaya untuk mencegah dan meringankan gejala-gajala asam urat serta
berfungsi sebagai terapi tambahan terhadap pasien asam urat atau lansia
dengan asam urat . Senam ini juga sebagai salah satu modal untuk memandu
mencegah dan memberikan terapi terhadap gejala asam urat.

2. Manfaat
a. menurunkan rasa nyeri akibat asam urat
b. meningkatkan kesehatan dan daya tahan tubuh secara menyeluruh
melatih kekuatan otot-otot persendian pada lansia.

3. Langkah-langkah
Tahap Pertama: Latihan Pernapasan
a. Instruksikan lansia untuk duduk dengan nyaman dan punggung ditegakkan
b. Instruksikan untuk menarik napas melalui hidung hingga tulang rusuk
terasa terangkat dan hembuskan napas melalui mulut seperti meniup lilin
c. Instruksikan untuk melakukannya secara kontinu, minimal 4 set dengan
istirahat antar set 1-2 menit.


Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


4. Tahap Kedua: Pemanasan (peregangan)
a. Instruksikan lansia untuk mengangkat kedua tangan
b. Instruksikan untuk menarik tangan ke samping kanan dengan hitungan 1 X
8
c. Instruksikan untuk melakukan hal yang sama dengan menarik tangan ke
samping kiri.
d. Instruksikan lansia untuk menyilangkan tangan kanan dan meletakkan di
bahu kiri, tangan kiri mendorong siku kanan dengan hitungan 1 x 8.
e. Instruksikan untuk melakukan hal yang sama dengan menarik tangan kiri
ke bahu kanan.
f. Instruksikan untuk meletakkan tangan pada pinggang, kemudian
miringkan kearah kanan dan kiri secara bergantian dengan hitungan 2 X 8.
5. Tahap Ketiga: Latihan Persendian
1. Sendi Leher
a. Instruksikan lansia untuk menegakkan kepalanya.
b. Anjurkan untuk memutar kepala ke kanan perlahan lahan hingga kembali
ke posisi awal.
c. Lanjutkan dengan memutar kepala ke kiri secara perlahan-lahan hingga
kembali ke posisi awal. Lakukan secara berulang sebanyak 2X.
2. Sendi Bahu
a. Instruksikan lansia untuk berbaring dengan nyaman dengan posisi lengan
rileks di samping tubuh lansia.
b. Selanjutnya angkat lengan kanan secara perlahan ke arah samping
menjauhi tubuh, kemudian kembalikan pada posisi semula. Ulangi gerakan
yang sama untuk lengan kiri Anda. Lakukan secara bergantian antara
lengan kiri dan kanan. Lakukan sebanyak 3X untuk masing-masing
lengan.
c. Instruksikan lansia untuk menekuk siku ke arah samping dan posisi telapak
tangan menyentuh bahu.
d. Kemudian gerakkan kedua siku ke arah depan, hingga kedua siku saling
menyentuh. Lanjutkan dengan menggerakkan siku kembali ke posisi awal
hingga dada merasa tertarik ketika menarik siku kembali ke posisi awal.

6. Senam Asam urat atau Sakit Sendi (Bahu)
3. Sendi Pinggul
a. Instruksikan lansia untuk berbaring dengan nyaman dengan posisi ujung
tumit menempel.
b. Kemudian jauhkan kaki kanan secara perlahan dari tubuh, lalu
kembalikkan ke posisi awal. Lakukan secara bergantian antara kaki kanan
dan kiri. Lakukan sebanyak 3X untuk masing-masing kaki.

7. Senam Asam urat atau Sakit Sendi (Pinggul)
4. Pergelangan Kaki
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

a. Instruksikan lansia untuk memutar pergelangan kaki kanan searah jarum
jam secara perlahan kemudian lakukan arah sebaliknya (berlawanan jarum
jam).
8. Lakukan secara bergantian antara pergelangan kaki kanan dan kiri dengan
hitungan 1 X 8

Senam Asam urat atau Sakit Sendi (Pergelangan Kaki)

5. Pergelangan Tangan
3) Instruksikan lansia untuk menekuk jarijari tangan.
4) Kemudian putar pergelangan tangan searah jarum jam dan kemudian
berlawanan dengan jarum jam.
9. Lakukan secara bergantian antara pergelangan tangan kanan dan kiri
dengan hitungan 1 X 8

Senam Asam urat atau Sakit Sendi (Pergelangan Tangan)

6. Ruas Jari
3) Instruksikan lansia untuk menyentuh tiap jari-jari tangan dengan ibu
jari. Ulangi hingga 5 kali.
4) Lakukan secara bergantian antara jari tangan kanan dan kiri.

Senam Asam urat atau Sakit Sendi (Ruas Jari)

6. Tahap Kelima: Latihan Kardio
Instruksikan lansia untuk jalan di tempat selama 3-5 menit
Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013

7. Tahap Keenam: Peregangan (pendinginan)
3) Instruksikan lansia untuk memutar badan ke kanan dan ke kiri sebanyak 2
X 8
4) Instruksikan lansia untuk menarik nafas dalam-dalam melalui hidung dan
menghembuskannya melalui mulut secara perlahan-lahan.



Daftar Pustaka


Darmojo, Boedhi,et al.2000.Beberapa masalah penyakit pada Usia Lanjut.
Jakarta: Balai Penerbit FKUI
Darmojo, R. Boedhi. Buku Ajar Geriatri ( Ilmu Kesehatan Usia Lanjut ), Balai
penerbit Fakultas Kedokteran Universitas Indonesia, jakarta, 1999.
Lueckenotte. 1997. Pengkajian Gerontologi edisi 2.EGC: Jakarta






























Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013




Lampiran 4
BOOKLET

Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013



Lampiran 5



BERITA ACARA

Pada hari ini Kamis Tanggal 21 Desember 2013 Pukul 16.00 s.d 17.30 WIB
Bertempat di Musholla di Lingkungan Plalangan Kelurahan Bintoro Kecamatan
Patrang Kabupaten Jember telah dilaksanakan Kegiatan Senam Asam Urat Lansia
oleh Mahasiswa Program Pendidikan Profesi Ners PSIK Universitas Jember.
Kegiatan ini diikuti oleh 15 orang (daftar hadir terlampir).





KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN
UNIVERSITAS JEMBER
PROGRAM STUDI ILMU KEPERAWATAN
PROGRAM PENDIDIKAN PROFESI NERS T.A 2013/2014
Alamat: Jl. Kalimantan No.37 Kampus Bumi Tegal Boto Jember
Telp./Fax (0331) 323450 Jember

Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


Jember, 21 Desember 2013













Lampiran 6:




DAFTAR HADIR

Kegiatan Pendidikan Kesehatan tentang Senam Asam Urat Lansia: Hari Sabtu
Tanggal 21 Desember 2013 Pukul 16.00 s/d 17.00 WIB Bertempat di Musholla di
LingkunganPlalangan Kelurahan Bintoro Kecamatan Patrang Kabupaten Jember.

KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN
UNIVERSITAS JEMBER
PROGRAM STUDI ILMU KEPERAWATAN
PROGRAM PENDIDIKAN PROFESI NERS T.A 2013/2014
Alamat: Jl. Kalimantan No.37 Kampus Bumi Tegal Boto Jember
Telp./Fax (0331) 323450 Jember

Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013



Jember, 21 Desember 2013


Lampiran 7:

Laporan P3N Stase Keperawatan Komunitas-PSIK Universitas Jember 2013


Kegiatan pendidikan kesehatan tentang Senam Asam Urat Lansia pada Hari Sabtu tanggal 21
Desember 2013 di Lingkungan Plalangan Kelurahan Bintoro Kecamatan Patrang Kabupaten
Jember oleh Muhammad Ulul Amri, S.Kep mahasiswa P3N Program Studi Ilmu Keperawatan
Universitas Jember

Kegiatan pendidikan kesehatantentang Senam Asam Urat Lansia pada Hari Rabu tanggal 21
Desember 2013 di Lingkungan Plalangan Kelurahan Bintoro Kecamatan Patrang Kabupaten Jember
oleh Muhammad Ulul Amri, S.Kep mahasiswa P3N Program Studi Ilmu Keperawatan
Universitas Jember