Anda di halaman 1dari 224

PEMBINAANDANPENGEMBANGANPROFESIGURU

BUKU2

PEDOMANPELAKSANAAN
PENILAIANKINERJAGURU
(PKGURU)

KEMENTERIANPENDIDIKANNASIONAL
DIREKTORATJENDERALPENINGKATANMUTU
PENDIDIKDANTENAGAKEPENDIDIKAN
2010

www.bermutuprofesi.org

KATA
APENGANTTAR

upakan jiwaa institusi pendidikan


p
yang mutunya wajib d
ditingkatkan
n secara
Pembelajaran meru
p
did
dik mendap
patkan penggalaman
terus meenerus. Hal ini dapat dimengertti, karena peserta
belajar fomal
f
terbanyak selaama mengikuti prosess pembelajjaran di seekolah. Kondisi ini
menuntu
ut semua pihak
p
untuk menyadaari pentingnya peninggkatan kualitas pemb
belajaran
secara berkelanjuta
b
an, dimana guru adalaah ujung to
ombaknya. Oleh sebab itu, profesi guru
harusdih
hargaidan dikembanggkansebagaaiprofesiyaangberkualitasdanbeermartabat.Profesi
guru meempunyai fu
ungsi, peraan, dan ked
dudukan yaang sangat penting daalam mencaapai visi
pendidikkan,yaitumenciptakaninsanIndonesiayangcerdas,kom
mprehensifdankompe
etitif.

p
mempunyyai kewajiban untukk mewujud
dkan kondiisi yang
Masyarakat dan pemerintah
memunggkinkan gurru dapat melaksanaka
m
an pekerjaaannya secaara profesio
onal, bukan
n hanya
untuk keepentingan guru, nam
mun juga un
ntuk penge
embangan peserta
p
did
dik dan dem
mi masa
depan bangsa
b
Ind
donesia. Daalam rangkka memban
ngun profesi guru seb
bagai profe
esi yang
bermartaabat, yakni untuk mencapai visi pendidikan
n nasional melalui proses pemb
belajaran
yang beerkualitas, maka perllu dilaksan
nakan peniilaian kinerja guru ((PK GURU)) secara
berkelanjutandantteratur.Bukkuinimem
mberikaninfformasiten
ntangPKG
GURU,man
nfaatnya,
danpelaksanaannyaadisekolah
h.

Ucapan terima kassih disampaikan kepaada Tim Diirektorat Profesi Pend


didik di Direktorat
Jenderal Peningkattan Mutu Pendidik dan Tenagga Kepend
didikan (PM
MPTK) yan
ng telah
memunggkinkanterb
bitnyabuku
uini.Semoggabukuini dapatmenjjadisumberracuanbaggisemua
pihakyan
ngterlibatd
dalampelakksanaanPKGURU.

Jakartaa,Desembeer2010
DirekturJenderalPeningkataanMutuPendidik
enagaKependidikan,
danTe

Prof.D
Dr.Baedhow
wi,M.Si.
NIP19
9490828197
79031001

DAFTARISI

KATAPENGANTAR......................................................................................................................i
DAFTARISI.................................................................................................................................ii
BABIPENDAHULUAN................................................................................................................1
A. LatarBelakang.........................................................................................................................1
B. DasarHukum...........................................................................................................................2
C. Tujuan......................................................................................................................................2
BABIIKONSEPPENILAIANKINERJAGURU.................................................................................3
A. PengertianPKGURU................................................................................................................3
B. SyaratSistemPKGURU...........................................................................................................4
C. PrinsipPelaksanaanPKGURU.................................................................................................4
D. AspekyangDinilaidalamPKGURU.........................................................................................5
E. PerangkatPelaksanaanPKGURU............................................................................................8
BABIIIPROSEDURPELAKSANAANPKGURUDANKONVERSIHASILPKGURUKEANGKA
KREDIT.....................................................................................................................................13
A. ProsedurdanWaktuPelaksanaanPKGURU.........................................................................13
B. KonversiNilaiHasilPKGURUkeAngkaKredit......................................................................19
C. PenilaidalamPKGURU..........................................................................................................28
D. Sanksi.....................................................................................................................................29
BABIVTUGASDANTANGGUNGJAWABPIHAKTERKAIT.........................................................31
A. TugasdanTanggungJawabTingkatPusat:KementerianPendidikanNasional...................32
B. TugasdanTanggungJawabTingkatProvinsi:DinasPendidikanProvinsidanLPMP............32
C. TugasdanTanggungJawabTingkatKabupaten/Kota:DinasPendidikanKabupaten/Kota.32
D. TugasdanTanggungJawabTingkatKecamatan:UPTDDinasPendidikan...........................33
E. TugasdanTanggungJawabTingkatSekolah.........................................................................33
BABVPENJAMINANMUTU,MONITORINGDANEVALUASIPELAKSANAANPKGURU..............35
A. Penjaminanmutu..................................................................................................................35
B. MonitoringdanEvaluasiProgram........................................................................................35
C. LaporanMonitoringdanEvaluasiProgramPKGURU...........................................................36
PENUTUP.................................................................................................................................39
LAMPIRAN1:InstrumenPKGuruKelas/MataPelajaran..........................................................41
LAMPIRAN2:InstrumenPKGuruBimbingandanKonseling/Konselor.....................................89
LAMPIRAN3:InstrumenPKGurudenganTugasTambahanyangRelevandenganFungsi
Sekolah/Madrasah..........................................................................................137
LAMPIRAN4:FormatPerhitunganAngkaKreditTugasTambahan........................................213
LAMPIRAN5:LaporanKendaliKinerjaGuru..........................................................................219

ii

BABI
PENDAHULUAN

A. LatarBelakang
Guru adalah pendidik profesional yang mempunyai tugas, fungsi, dan peran penting
dalam mencerdaskan kehidupan bangsa. Guru yang profesional diharapkan mampu
berpartisipasidalampembangunannasionaluntukmewujudkaninsanIndonesiayang
bertakwakepadaTuhanYME,ungguldalamilmupengetahuandanteknologi,memiliki
jiwaestetis,etis,berbudipekertiluhur,danberkepribadian.Tidaklahberlebihankalau
dikatakan bahwa masa depan masyarakat, bangsa dan negara, sebagian besar
ditentukan oleh guru. Oleh sebab itu, profesi guru perlu dikembangkan secara terus
menerusdanproporsionalmenurutjabatanfungsionalguru.Selainitu,agarfungsidan
tugas yang melekat pada jabatan fungsional guru dilaksanakan sesuai dengan aturan
yang berlaku, maka diperlukan Penilaian Kinerja Guru (PK GURU) yang menjamin
terjadinyaprosespembelajaranyangberkualitasdisemuajenjangpendidikan.

PelaksanaanPKGURUdimaksudkanbukanuntukmenyulitkanguru,tetapisebaliknya
PK GURU dilaksanakan untuk mewujudkan guru yang profesional, karena harkat dan
martabat suatu profesi ditentukan oleh kualitas layanan profesi yang bermutu.
Menemukan secara tepat tentang kegiatan guru di dalam kelas, dan membantu
mereka untuk meningkatkan pengetahuan dan keterampilannya, akan memberikan
kontribusi secara langsung pada peningkatan kualitas pembelajaran yang dilakukan,
sekaligus membantu pengembangan karir guru sebagai tenaga profesional. Oleh
karena itu, untuk meyakinkan bahwa setiap guru adalah seorang profesional di
bidangnya dan sebagai penghargaan atas prestasi kerjanya, maka PK GURU harus
dilakukan terhadap guru di semua satuan pendidikan formal yang diselenggarakan
oleh pemerintah, pemerintah daerah, dan masyarakat. Guru yang dimaksud tidak
terbatas pada guru yang bekerja di satuan pendidikan di bawah kewenangan
KementerianPendidikanNasional,tetapijugamencakupguruyangbekerjadisatuan
pendidikandilingkunganKementerianAgama.

HasilPKGURUdapatdimanfaatkanuntukmenyusunprofilkinerjagurusebagaiinput
dalampenyusunanprogramPengembanganKeprofesianBerkelanjutan(PKB).HasilPK
GURU juga merupakan dasar penetapan perolehan angka kredit guru dalam rangka
pengembangankarirgurusebagaimanadiamanatkandalamPeraturanMenteriNegara
Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun 2009
tentang Jabatan Fungsional Guru dan Angka Kreditnya. Jika semua ini dapat
dilaksanakandenganbaikdanobyektif,makacitacitapemerintahuntukmenghasilkan
insanyangcerdaskomprehensifdanberdayasaingtinggilebihcepatdirealisasikan.

Memperhatikankondisijabatangurusebagaiprofesidankebijakanpemerintahdalam
pengembangan profesi guru maka diperlukan pedoman pelaksanaan PK GURU yang
menjelaskan tentang apa, mengapa, kapan, bagaimana dan oleh siapa PK GURU
dilaksanakan. Penyusunan pedoman ini mengacu pada Peraturan Menteri Negara
Pendayagunaan Aparatur Negara dan Reformasi Birokrasi di atas sebagai acuan
pelaksanaanPKGURUdisekolahuntukmempermudahprosespenilaian.

B. DasarHukum
1. UndangUndangNomor20Tahun2003tentangSistemPendidikanNasional.
2. UndangUndangNomor14Tahun2005tentangGurudanDosen.
3. PeraturanPemerintahNomor74tahun2008tentangGuru.
4. Peraturan Menteri Pendidikan Nasional Nomor 16 Tahun 2007 tentang Standar
KualifikasiAkademikdanKompetensiGuru.
5. Peraturan Menteri Pendidikan Nasional Nomor 27 Tahun 2008 tentang Standar
KualifikasidanKompetensiKonselor.
6. Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi
Birokrasi Nomor 16 Tahun 2009 tentang Jabatan Fungsional Guru dan Angka
Kreditnya.
7. PeraturanMenteriPendidikanNasionalNomor28Tahun2010tentangPenugasan
GurusebagaiKepalaSekolah/Madrasah.
8. Peraturan Bersama Menteri Pendidikan Nasional dan Kepala Badan Kepegawaian
Negara Nomor 14 Tahun 2010 dan Nomor 03/V/PB/2010 tentang Petunjuk
PelaksanaanJabatanFungsionalGurudanAngkaKreditnya.
9. Peraturan Menteri Pendidikan Nasional Nomor 35 tahun 2010 tentang Petunjuk
TeknisPelaksanaanJabatanFungsionalGurudanAngkaKreditnya.

C. Tujuan
Pedoman pelaksanaan PK GURU ini disusun untuk memperluas pemahaman semua
pihak terkait tentang prinsip, proses, dan prosedur pelaksanaan PK GURU, sebagai
suatusistempenilaiankinerjayangberbasisbukti(evidencebasedappraisal).

BABII
KONSEPPENILAIANKINERJAGURU

A. PengertianPKGURU
Menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi
Birokrasi Nomor 16 Tahun 2009, PK GURU adalah penilaian dari tiap butir kegiatan
tugas utama guru dalam rangka pembinaan karir, kepangkatan, dan jabatannya.
Pelaksanaantugasutamagurutidakdapatdipisahkandarikemampuanseorangguru
dalam penguasaan pengetahuan, penerapan pengetahuan dan keterampilan, sebagai
kompetensi yang dibutuhkan sesuai amanat Peraturan Menteri Pendidikan Nasional
Nomor 16 Tahun 2007 tentang Standar Kualifikasi Akademik dan Kompetensi Guru.
Penguasaankompetensidanpenerapanpengetahuansertaketerampilanguru,sangat
menentukan tercapainya kualitas proses pembelajaran atau pembimbingan peserta
didik, dan pelaksanaan tugas tambahan yang relevan bagi sekolah/madrasah,
khususnyabagigurudengantugastambahantersebut.SistemPKGURUadalahsistem
penilaian yang dirancang untuk mengidentifikasi kemampuan guru dalam
melaksanakantugasnyamelaluipengukuranpenguasaankompetensiyangditunjukkan
dalamunjukkerjanya.

Secaraumum,PKGURUmemiliki2fungsiutamasebagaiberikut.
1. Untuk menilai kemampuan guru dalam menerapkan semua kompetensi dan
keterampilan yang diperlukan pada proses pembelajaran, pembimbingan, atau
pelaksanaan tugas tambahan yang relevan dengan fungsi sekolah/madrasah.
Dengan demikian, profil kinerja guru sebagai gambaran kekuatan dan kelemahan
guru akan teridentifikasi dan dimaknai sebagai analisis kebutuhan atau audit
keterampilan untuk setiap guru, yang dapat dipergunakan sebagai basis untuk
merencanakanPKB.
2. Untuk menghitung angka kredit yang diperoleh guru atas kinerja pembelajaran,
pembimbingan, atau pelaksanaan tugas tambahan yang relevan dengan fungsi
sekolah/madrasah yang dilakukannya pada tahun tersebut. Kegiatan penilaian
kinerjadilakukansetiaptahunsebagaibagiandariprosespengembangankarirdan
promosiguruuntukkenaikanpangkatdanjabatanfungsionalnya.

Hasil PK GURU diharapkan dapat bermanfaat untuk menentukan berbagai kebijakan


yang terkait dengan peningkatan mutu dan kinerja guru sebagai ujung tombak
pelaksanaanprosespendidikandalammenciptakaninsanyangcerdas,komprehensif,
dan berdaya saing tinggi. PK GURU merupakan acuan bagi sekolah/madrasah untuk
menetapkanpengembangankarirdanpromosiguru.Bagiguru,PKGURUmerupakan
pedoman untuk mengetahui unsurunsur kinerja yang dinilai dan merupakan sarana
untuk mengetahui kekuatan dan kelemahan individu dalam rangka memperbaiki
kualitaskinerjanya.

PK GURU dilakukan terhadap kompetensi guru sesuai dengan tugas pembelajaran,


pembimbingan, atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah.
Khususuntukkegiatanpembelajaranataupembimbingan,kompetensiyangdijadikan
dasar untuk penilaian kinerja guru adalah kompetensi pedagogik, profesional, sosial
dan kepribadian, sebagaimana ditetapkan dalam Peraturan Menteri Pendidikan

Nasional Nomor 16 Tahun 2007. Keempat kompetensi ini telah dijabarkan menjadi
kompetensiguruyangharusdapatditunjukkandandiamatidalamberbagaikegiatan,
tindakan dan sikap guru dalam melaksanakan pembelajaran atau pembimbingan.
Sementaraitu,untuktugastambahanyangrelevandenganfungsisekolah/madrasah,
penilaiankinerjanyadilakukanberdasarkankompetensitertentusesuaidengantugas
tambahan yang dibebankan tersebut (misalnya; sebagai kepala sekolah/madrasah,
wakil kepala sekolah/madrasah, pengelola perpustakaan, dan sebagainya sesuai
dengan Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi
BirokrasiNomor16Tahun2009).

B. SyaratSistemPKGURU
PersyaratanpentingdalamsistemPKGURUadalah:
1. Valid
Sistem PK GURU dikatakan valid bila aspek yang dinilai benarbenar mengukur
komponenkomponen tugas guru dalam melaksanakan pembelajaran,
pembimbingan,dan/atautugaslainyangrelevandenganfungsisekolah/madrasah.
2. Reliabel
SistemPKGURUdikatakanreliabelataumempunyaitingkatkepercayaantinggijika
proses yang dilakukan memberikan hasil yang sama untuk seorang guru yang
dinilaikinerjanyaolehsiapapundankapanpun.
3. Praktis
Sistem PK GURU dikatakan praktis bila dapat dilakukan oleh siapapun dengan
relatif mudah, dengan tingkat validitas dan reliabilitas yang sama dalam semua
kondisitanpamemerlukanpersyaratantambahan.
Salah satu karakteristik dalam desain PK GURU adalah menggunakan cakupan
kompetensidanindikatorkinerjayangsamabagi4(empat)jenjangjabatanfungsional
guru(GuruPertama,GuruMuda,GuruMadya,danGuruUtama).

C. PrinsipPelaksanaanPKGURU
PrinsipprinsiputamadalampelaksanaanPKGURUadalahsebagaiberikut.
1. Berdasarkanketentuan
PKGURUharusdilaksanakansesuaidenganprosedurdanmengacupadaperaturan
yangberlaku.
2. Berdasarkankinerja
AspekyangdinilaidalamPKGURUadalahkinerjayangdapatdiamatidandipantau,
yang dilakukan guru dalam melaksanakan tugasnya seharihari, yaitu dalam
melaksanakan kegiatan pembelajaran, pembimbingan, dan/atau tugas tambahan
yangrelevandenganfungsisekolah/madrasah.
3. BerlandaskandokumenPKGURU
Penilai, guru yang dinilai, dan unsur yang terlibat dalam proses PK GURU harus
memahami semua dokumen yang terkait dengan sistem PK GURU. Guru dan
penilai harus memahami pernyataan kompetensi dan indikator kinerjanya secara
utuh, sehingga keduanya mengetahui tentang aspek yang dinilai serta dasar dan
kriteriayangdigunakandalampenilaian.

4. Dilaksanakansecarakonsisten
PK GURU dilaksanakan secara teratur setiap tahun diawali dengan penilaian
formatifdiawaltahundanpenilaiansumatifdiakhirtahundenganmemperhatikan
halhalberikut.
a) Obyektif
Penilaiankinerjagurudilaksanakansecaraobyektifsesuaidengankondisinyata
gurudalammelaksanakantugasseharihari.
b) Adil
Penilai kinerja guru memberlakukan syarat, ketentuan, dan prosedur standar
kepadasemuaguruyangdinilai.
c) Akuntabel
Hasilpelaksanaanpenilaiankinerjagurudapatdipertanggungjawabkan.
d) Bermanfaat
Penilaiankinerjagurubermanfaatbagigurudalamrangkapeningkatankualitas
kinerjanyasecaraberkelanjutandansekaliguspengembangankarirprofesinya.
e) Transparan
Prosespenilaiankinerjagurumemungkinkanbagipenilai,guruyangdinilai,dan
pihak lain yang berkepentingan, untuk memperoleh akses informasi atas
penyelenggaraanpenilaiantersebut.
f) Praktis
Penilaian kinerja guru dapat dilaksanakan secara mudah tanpa mengabaikan
prinsipprinsiplainnya.
g) Berorientasipadatujuan
Penilaiandilaksanakandenganberorientasipadatujuanyangtelahditetapkan.
h) Berorientasipadaproses
Penilaian kinerja guru tidak hanya terfokus pada hasil, namun juga perlu
memperhatikanproses,yaknibagaimanagurudapatmencapaihasiltersebut.
i) Berkelanjutan
Penilaian kinerja guru dilaksanakan secara periodik, teratur, dan berlangsung
secaraterusmenerusselamaseseorangmenjadiguru.
j) Rahasia
Hasil PK GURU hanya boleh diketahui oleh pihakpihak terkait yang
berkepentingan.

D. AspekyangDinilaidalamPKGURU
Guru sebagai pendidik profesional mempunyai tugas utama mendidik, mengajar,
membimbing, mengarahkan, melatih, menilai, dan mengevaluasi peserta didik pada
pendidikan anak usia dini jalur pendidikan formal, pendidikan dasar, dan pendidikan
menengah. Selain tugas utamanya tersebut, guru juga dimungkinkan memiliki tugas
tugas lain yang relevan dengan fungsi sekolah/madrasah. Oleh karena itu, dalam
penilaiankinerjagurubeberapasubunsuryangperludinilaiadalahsebagaiberikut.
1. Penilaiankinerjayangterkaitdenganpelaksanaanprosespembelajaranbagiguru
mata pelajaran atau guru kelas, meliputi kegiatan merencanakan dan
melaksanakan pembelajaran, mengevaluasi dan menilai, menganalisis hasil
penilaian, dan melaksanakan tindak lanjut hasil penilaian dalam menerapkan 4
(empat)domainkompetensiyangharusdimilikiolehgurusesuaidenganPeraturan
Menteri Pendidikan Nasional Nomor 16 Tahun 2007 tentang Standar Kualifikasi

Akademik dan Kompetensi Guru. Pengelolaan pembelajaran tersebut


mensyaratkan guru menguasai 24 (dua puluh empat) kompetensi yang
dikelompokkan ke dalam kompetensi pedagogik, kepribadian, sosial, dan
profesional. Untuk mempermudah penilaian dalam PK GURU, 24 (dua puluh
empat) kompetensi tersebut dirangkum menjadi 14 (empat belas) kompetensi
sebagaimana dipublikasikan oleh Badan Standar Nasional Pendidikan (BSNP).
RincianjumlahkompetensitersebutdiuraikandalamTabel1.

Tabel1.KompetensiGuruKelas/GuruMataPelajaran
No
1
2
3
4

Jumlah
Kompetensi
Indikator
7
45
3
18
2
6
2
9
14
78

RanahKompetensi
Pedagogik
Kepribadian
Sosial
Profesional
Total

2. PenilaiankinerjadalammelaksanakanprosespembimbinganbagiguruBimbingan
Konseling (BK)/Konselor meliputi kegiatan merencanakan dan melaksanakan
pembimbingan, mengevaluasi dan menilai hasil bimbingan, menganalisis hasil
evaluasi pembimbingan, dan melaksanakan tindak lanjut hasil pembimbingan.
Berdasarkan Peraturan Menteri Pendidikan Nasional Nomor 27 Tahun 2008
tentang Standar Kualifikasi Akademik dan Kompetensi Konselor terdapat 4
(empat) ranah kompetensi yang harus dimiliki oleh guru BK/Konselor. Penilaian
kinerja guru BK/konselor mengacu pada 4 domain kompetensi tersebut yang
mencakup17(tujuhbelas)kompetensisepertidiuraikandalamTabel2.

Tabel2.KompetensiGuruBimbinganKonseling/Konselor
No
1
2
3
4

Jumlah

RanahKompetensi

Kompetensi
3
4
3
7
17

Pedagogik
Kepribadian
Sosial
Profesional
Total

Indikator
9
14
10
36
69

3. Kinerja yang terkait dengan pelaksanaan tugas tambahan yang relevan dengan
fungsisekolah/madrasah.Pelaksanaantugastambahaninidikelompokkanmenjadi
2,yaitutugastambahanyangmengurangijammengajartatapmukadanyangtidak
mengurangi jam mengajar tatap muka. Tugas tambahan yang mengurangi jam
mengajartatapmukameliputi:(1)menjadikepalasekolah/madrasahpertahun;(2)
menjadi wakil kepala sekolah/madrasah per tahun; (3) menjadi ketua program
keahlian/program studi atau yang sejenisnya; (4) menjadi kepala perpustakaan;
atau(5)menjadikepalalaboratorium,bengkel,unitproduksi,atauyangsejenisnya.
Tugastambahanyangtidakmengurangijammengajartatapmukadikelompokkan
menjadi2juga,yaitutugastambahanminimalsatutahun(misalnyamenjadiwali
kelas, guru pembimbing program induksi, dan sejenisnya) dan tugas tambahan
kurang dari satu tahun (misalnya menjadi pengawas penilaian dan evaluasi
pembelajaran,penyusunankurikulum,dansejenisnya).
6

Penilaiankinerjagurudalammelaksanakantugastambahanyangmengurangaijam
mengajar tatap muka dinilai dengan menggunakan instrumen khusus yang
dirancangberdasarkankompetensiyangdipersyaratkanuntukmelaksanakantugas
tambahantersebut.Rincianjumlahkompetensidanjumlahindikatorpelaksanaan
tugastambahandisampaikandalamTabel3,4,5,6,dan7.

a) Tugastambahansebagaikepalasekolah/madrasah

Tabel3.Kompetensikepalasekolah/madrasah
No

Kompetensi

1
2
3
4
5
6

Kriteria

KepribadiandanSosial
Kepemimpinan
PengembanganSekolah/Madrasah
PengelolaanSumberDaya
Kewirausahaan
SupervisiPembelajaran
Total

7
10
7
8
5
3
40

b) Tugastambahansebagaiwakilkepalasekolah/madrasah

Tabel4:Kompetensiwakilkepalasekolah/madrasah

No

Kompetensi

Kriteria

1
KepribadiandanSosial
7

2
Kepemimpinan
10

3
PengembanganSekolah/
7

Madrasah

4
Kewirausahaan
5

JumlahKriteria
29

Jumlahkriteriakeempatkompetensitersebutkemudian

ditambahkandenganbanyaknyakriteriabidangtugastertentu

yangdiampuolehwakilkepalasekolah/madrasahyang

bersangkutan

5
Akademik

4
Kesiswaan

3
Saranadanprasarana

Hubunganmasyarakat

Contoh:jikaseorangwakilkepalasekolah/madrasahmengampubidang
akademik,makatotalkriteriapenilaiankompetensinyaadalah29+5=34

c) Tugastambahansebagaikepalaperpustakaan

Tabel5.Kompetensikepalaperpustakaan
No

Kompetensi

Kriteria

1
2
3
4
5

Perencanaankegiatanperpustakaan
Pelaksanaanprogramperpustakaan
Evaluasiprogramperpustakaan
Pengembangankoleksiperpustakaan
Pengorganisasianlayananjasa informasi
perpustakaan
Penerapanteknologiinformasidankomunikasi

8
9
8
8
8

No
7
8
9
10

Kompetensi

Kriteria

Promosiperpustakaandanliterasiinformasi
Pengembangankegiatanperpustakaan
sebagaisumberbelajarkependidikan
Kepemilikanintegritasdanetoskerja
Pengembanganprofesionalitas
kepustakawanan
Total

4
4
8
4
65

d) Tugastambahansebagaikepalalaboratorium/bengkel/sejenisnya

Tabel6.Kompetensikepalalaboratorium/bengkel/sejenisnya
No
1
2
3
4
5
6
7

Kompetensi

Kriteria

Kepribadian
Sosial
Pengorganisasianguru,laboran/teknisi
Pengelolaanprogramdan administrasi
Pengelolaanpemantauandan evaluasi
Pengembangandaninovasi
LingkungandanK3
Total

11
5
6
7
7
5
5
46

e) Tugastambahansebagaiketuaprogramkeahlian

Tabel7:Kompetensiketuaprogramkeahlian
No
1
2
3
4
5
6
7
8

Kompetensi
Kepribadian
Sosial
Perencanaan
PengelolaanPembelajaran
PengelolaanSumberDayaManusia
PengelolaanSaranadanPrasarana
PengelolaanKeuangan
EvaluasidanPelaporan
Total

Kriteria
6
4
5
6
4
4
4
4
37

Tugastambahanlainyangtidakmengurangijammengajargurudihargailangsung
sebagaiperolehanangkakreditsesuaiketentuanyangberlaku.

E. PerangkatPelaksanaanPKGURU
Perangkat yang harus digunakan oleh penilai untuk melaksanakan PK GURU agar
diperolehhasilpenilaianyangobyektif,akurat,tepat,valid,dandapatdipertanggung
jawabkanadalah:
1. PedomanPKGURU
PedomanPKGURUmengaturtentangtatacarapenilaiandannormanormayang
harus ditaati oleh penilai, guru yang dinilai, serta unsur lain yang terlibat dalam
prosespenilaian.

2. Instrumenpenilaiankinerja
Instrumenpenilaiankinerjayangrelevandengantugasguru,terdiridari:
a. Instrumen1:
PelaksanaanPembelajaranuntukgurukelas/matapelajaran(Lampiran1);
b. Instrumen2:
Pelaksanaan Pembimbingan untuk guru Bumbingan dan Konseling/Konselor
(Lampiran2);dan
c. Instrumen3:
PelaksanaanTugasTambahanyangrelevandenganfungsisekolah/madrasah
(Lampiran 3). Instrumen3 terdiri dari beberapa instrumen terpisah sesuai
dengantugastambahanyangdiembanguru.

Instrumen penilaian kinerja pelaksaaan pembelajaran atau pembimbingan terdiri


dari:
1) Lembarpernyataankompetensi,indikator,dancaramenilai
Lembar ini berisi daftar dan penjelasan tentang ranah kompetensi,
kompetensi,danindikatorkinerjaguruyangharusdiukurmelaluipengamatan
danpemantauan(Lampiran1AatauLampiran2A).
2) Formatlaporandanevaluasiperkompetensi
Formatcatatandanevaluasipenilaiankinerjaperkompetensidigunakanuntuk
mencatat semua hasil pengamatan dan pemantauan yang telah dilakukan,
sebagai bukti pelaksanaan penilaian kinerja guru. Catatan ini harus dilengkapi
dengan buktibukti fisik tertentu, misalnya dokumen pembelajaran dan
penilaian, alat peraga dan media pembelajaran, atau dokumen lain yang
menguatkan bukti kinerja guru. Berdasarkan catatan hasil pengamatan dan
pemantauansertabuktifisikyangada,penilaidisekolahmemberikanskor0,1,
2, pada setiap indikator kinerja guru pada tabel yang disediakan. Persentase
perolehan skor per kompetensi kemudian dikonversikan ke nilai 1, 2, 3, 4,
(Lampiran1BatauLampiran2B).
3) FormatrekaphasilPKGURU
Nilai per kompetensi kemudian direkapitulasi ke format rekap hasil PK GURU
untukmendapatkannilaitotalPKGURU(Lampiran1CatauLampiran2C).Nilai
inilah yang selanjutnya dikonversi ke skala nilai kinerja menurut Peraturan
Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi
Nomor 16 Tahun 2009 untuk diperhitungkan sebagai perolehan angka kredit
guru di tahun tersebut. Format rekap hasil PK GURU dipergunakan untuk
merekapitulasi hasil PK GURU formatif dan sumatif. Format ini juga
dipergunakanuntukmemantaukemajuanguruyanghasilPKGURUformatifnya
mempunyainilaidibawahstandar(1dan/atau2),lihatpanduanprogramPKB.
Ketiga format rekap hasil PK GURU (formatif, sumatif, dan kemajuan) akan
dipergunakansebagaimasukanuntukmenyusunlaporankendalikinerjaguru.
FomatrekaphasilPKGURUsumatifdipergunakansebagaidasarpenghitungan
angkakreditbagitimpenilaijabatanfungsionalguruditingkatkabupaten/kota,
provinsi,ataupusatsesuaikewenangannya.
4) Formatperhitunganangkakredit
SetelahmemperolehnilaitotalPKGURUuntukpembelajaran,pembimbingan
atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah, penilai

dapatmelakukanperhitunganangkakredit.PerhitunganangkakredithasilPK
GURU dapat dilakukan di sekolah tetapi sifatnya hanya untuk keperluan
estimasi perolehan angka kredit. Bagi tim penilai di tingkat kabupaten/kota,
angkakredithasilperhitungantimpenilaitersebutakandipergunakansebagai
dasar penetapan perolehan angka kredit guru (Lampiran 1D atau Lampiran
2D).

Instrumen penilaian kinerja pelaksaaan tugas tambahan yang relevan dengan


fungsi sekolah/madrasah (Lampiran 3) secara umum terdiri dari bagianbagian
berikut.
1) PetunjukPenilaian
Petunjukpenilaianberisipenjelasantentangcaramenilai,teknikpengumpulan
data, pemberian skor, penilai dan persyaratannya, pelaksanaan penilaian dan
hasilpenilaian.Petunjukpengisianiniharusdipahamiolehparapenilaikinerja
gurudengantugastambahanyangrelevandenganfungsisekolah/madrasah.
2) FormatIdentitasDiri
Format ini harus diisi dengan identitas diri guru yang dinilai sesuai dengan
tugas tambahan yang relevan dengan fungsi sekolah/madrasah. Selain itu,
formatinijugaperludiisidenganidentitaspenilai.Guruyangdinilaidanpenilai
harusmenandatanganiformatidentitasdiriini.
3) FormatPenilaianKinerja
Format ini terdiri dari beberapa tabel menurut banyaknya kompetensi yang
akan dinilai sesuai dengan tugas tambahan yang relevan dengan fungsi
sekolah/madrasahyangditugaskankepadaguru.Setiaptabelberisipenjelasan
tentang kriteria/indikator penilaian untuk masingmasing kompetensi,catatan
buktibukti yang teridentifikasi selama penilaian, skor yang diberikan,
perhitunganjumlahskor,skorrataratauntuksetiapkompetensi,sertadiskripsi
penilaian kinerja yang dilakukan oleh penilai. Format ini diisi oleh penilai di
sekolahsesuaidenganhasilpengamatan,wawancara,dan/ataustudidokumen
yangdilakukanolehpenilaiselamaprosespenilaiankinerja.
4) FormatRekapitulasiPenilaianKinerja
Perolehan skor ratarata untuk setiap kompetensi kemudian direkap oleh
penilaipadaformatrekapitulasipenilaiankinerja.Skorrataratamasingmasing
kompetensi dicantumkan dan dijumlahkan dalam format tersebut untuk
selanjutnyadikonversikankeskalanilai0100sesuaidenganPermennegPAN
& RB No. 16 Tahun 2009. Jika kedua penilai dan guru yang dinilai telah
mencapai kesepakatan terhadap hasil penilaian, maka penilai dan guru yang
dinilaiharusmenandatanganiformatrekapitulasipenilaiankinerjatersebut.
5) FormatTambahan
Dalam beberapa instrumen tugas tambahan yang relevan dengan fungsi
sekolah/madrasah, terdapat beberapa format tambahan. Misalnya untuk
penilaian kinerja guru dengan tugas tambahan sebagai kepala perpustakaan,
memiliki format tambahan hasil penilaian dan rincian kegiatan guru
sehubungandengantugastugaspengelolaanperpustakaan.Formattambahan
gurudengantugastambahansebagaikepalalaboratorium/bengkeldilengkapi
dengan format pendalaman terhadap teman sejawat dan/atau peserta didik

10

dariguruyangdinilai.Formattambahaniniberupaformatformatyangharus
diisiolehpenilaisesuaidengandatadaninformasiyangdiperolehnya.

3. Laporankendalikinerjaguru
Hasil PK GURU untuk masingmasing individu guru (guru pembelajaran, guru
bimbingandankonseling/konselor,maupunguruyangdiberitugastambahanyang
relevandenganfungsisekolah/madrasah)kemudiandirekapdalamformatlaporan
kendali kinerja guru (Lampiran 4). Pada format ini dicantumkan hasil PK GURU
formatif, sasaran nilai PK GURU yang akan dicapai setelah guru mengikuti proses
PKB, dan hasil PK GURU sumatif untuk beberapa tahun ke depan. Dengan
demikian, kinerja guru akan dapat dipantau dan dapat diarahkan dalam upaya
peningkatan kinerja guru yang bersangkutan agar mampu memberikan layanan
pendidikanyangberkualitaskepadapesertadidik.

11

12

BABIII
PROSEDURPELAKSANAANPKGURU
DANKONVERSIHASILPKGURUKEANGKAKREDIT

A. ProsedurdanWaktuPelaksanaanPKGURU

1. WaktuPelaksanaan
PK GURU dilakukan 2 (dua) kali setahun, yaitu pada awal tahun ajaran (penilaian
formatif)danakhirtahunajaran(penilaiansumatif).
a. PKGuruFormatif
PK GURU formatif digunakan untuk menyusun profil kinerja guru dan harus
dilaksanakan dalam kurun waktu 6 (enam) minggu di awal tahun ajaran.
Berdasarkan profil kinerja guru ini dan hasil evaluasi diri yang dilakukan oleh
gurusecaramandiri,sekolah/madrasahmenyusunrencanaPKB.
Bagi guruguru dengan PK GURU di bawah standar, program PKB diarahkan
untukpencapaianstandarkompetensitersebut.Sementaraitu,bagiguruguru
dengan PK GURU yang telah mencapai atau di atas standar, program PKB
diorientasikan untuk meningkatkan atau memperbaharui pengetahuan,
keterampilan,dansikapdanperilakukeprofesiannya.
b. PKGuruSumatif
PK GURU sumatif digunakan untuk menetapkan perolahan angka kredit guru
pada tahun tersebut. PK GURU sumatif juga digunakan untuk menganalisis
kemajuan yang dicapai guru dalam pelaksanaan PKB, baik bagi guru yang
nilainya masih di bawah standar, telah mencapai standar, atau melebihi
standar kompetensi yang ditetapkan. PK Guru sumatif harus sudah
dilaksanakan6(enam)minggusebelumpenetapanangkakreditseorangguru.

2. ProsedurPelaksanaan
SecaraspesifikterdapatperbedaanprosedurpelaksanaanPKGURUpembelajaran
atau pembimbingan dengan prosedur pelaksanaan PK GURU untuk tugas
tambahan yang relevan dengan fungsi sekolah/madrasah. Meskipun demikian,
secaraumumkegiatanpenilaianPKGURUditingkatsekolahdilaksanakandalam4
(empat)tahapan,sebagaimanatercantumpadaGambar1.
Persiapan

Sekolah/Dinas
Pendidikan

Pelaksanaan

Pemberian
Nilai

Setuju

Moderator

Tidak

Ya

Pelaporan
(Pengusulan PAK)

Gambar1.TahapanPelaksanaanPKGURUditingkatSekolah/Madrasah

13

a. TahapPersiapan
Dalamtahappersiapan,halhalyangharusdilakukanolehpenilaimaupunguru
yangakandinilai.
1) memahamiPedomanPKGURU,terutamatentangsistemyangditerapkan
danposisiPKGURUdalamkerangkapembinaandanpengembanganprofesi
guru;
2) memahami pernyataan kompetensi guru yang telah dijabarkan dalam
bentukindikatorkinerja;
3) memahami penggunaan instrumen PK GURU dan tata cara penilaian yang
akan dilakukan, termasuk cara mencatat semua hasil pengamatan dan
pemantauan, serta mengumpulkan dokumen dan bukti fisik lainnya yang
memperkuathasilpenilaian;dan
4) memberitahukan rencana pelaksanaan PK GURU kepada guru yang akan
dinilaisekaligusmenentukanrentangwaktujadwalpelaksanaannya.

b. TahapPelaksanaan
Beberapa tahapan PK GURU yang harus dilalui oleh penilai sebelum
menetapkannilaiuntuksetiapkompetensi,adalahsebagaiberikut.
1) SebelumPengamatan
Pertemuanawalantarapenilaidenganguruyangdinilaisebelumdilakukan
pengamatan dilaksanakan di ruang khusus tanpa ada orang ketiga. Pada
pertemuanini,penilaimengumpulkandokumenpendukungdanmelakukan
diskusi tentang berbagai hal yang tidak mungkin dilakukan pada saat
pengamatan.Semuahasildiskusi,wajibdicatatdalamformatlaporandan
evaluasi per kompetensi (Lampiran 1B bagi PK Guru Pembelajaran dan
Lampiran2BbagiPKGuruBK/Konselor)sebagaibuktipenilaiankinerja.
Untuk pelaksanaan tugas tambahan yang relevan dengan fungsi
sekolah/madrasah dapat dicatat dalam lembaran lain karena tidak ada
formatkhususyangdisediakanuntukprosespencatatanini.
2) SelamaPengamatan
Selamapengamatandikelasdan/ataudiluarkelas,penilaiwajibmencatat
semua kegiatan yang dilakukan oleh guru dalam pelaksanaan proses
pembelajaran atau pembimbingan, dan/atau dalam pelaksanaan tugas
tambahan yang relevan dengan fungsi sekolah/madrasah. Dalam konteks
ini,penilaiankinerjadilakukandenganmenggunakaninstrumenyangsesuai
untuk masingmasing penilaian kinerja. Untuk menilai guru yang
melaksanakan proses pembelajaran atau pembimbingan, penilai
menggunakan instrumen PK GURU pembelajaran atau pembimbingan.
Pengamatankegiatanpembelajarandapatdilakukandikelasselamaproses
tatap muka tanpa harus mengganggu proses pembelajaran. Pengamatan
kegiatanpembimbingandapatdilakukanselamaprosespembimbinganbaik
yang dilakukan dalam kelas maupun di luar kelas, baik pada saat
pembimbingan individu maupun kelompok. Penilai wajib mencatat semua
hasil pengamatan pada format laporan dan evaluasi per kompetensi
tersebut(Lampiran1BbagiPKGuruPembelajarandanLampiran2BbagiPK
GuruPembimbingan,BK/Konselor)ataulembarlainsebagaibuktipenilaian
kinerja.Jikadiperlukan,prosespengamatandapatdilakukanlebihdarisatu

14

kaliuntukmemperolehinformasiyangakurat,validdankonsistententang
kinerja seorang guru dalam melaksanakan kegiatan pembelajaran atau
pembimbingan.
Dalamprosespenilaianuntuktugastambahanyangrelevandenganfungsi
sekolah/madrasah,datadaninformasidapatdiperolehmelaluipencatatan
terhadapsemuabuktiyangteridentifikasiditempatyangdisediakanpada
masingmasing kriteria penilaian. Buktibukti ini dapat diperoleh melalui
pengamatan,wawancaradenganpemangkukepentinganpendidikan(guru,
komite sekolah, peserta didik, DU/DI mitra). Buktibukti yang dimaksud
dapatberupa:
a) Buktiyangteramati(tangibleevidences)seperti:
dokumendokumentertulis;
kondisi sarana/prasarana (hardware dan/atau software) dan
lingkungansekolah;
foto,gambar,slide,video;dan
produkproduksiswa.
b) Buktiyangtakteramati(intangibleevidences)seperti:
sikapdanperilakukepalasekolah;dan
budayadaniklimsekolah
3) SetelahPengamatan
Pada pertemuan setelah pengamatan pelaksanaan proses pembelajaran,
pembimbingan, atau pelaksanaan tugas tambahan yang relevan dengan
fungsi sekolah/madrasah, penilai dapat mengklarifikasi beberapa aspek
tertentu yang masih diragukan. Penilai wajib mencatat semua hasil
pertemuan pada format laporan dan evaluasi per kompetensi tersebut
(Lampiran 1B bagi PK Guru Pembelajaran dan lampiran 2B bagi PK Guru
Pembimbingan, BK/Konselor) atau lembar lain sebagai bukti penilaian
kinerja. Pertemuan dilakukan di ruang khusus dan hanya dihadiri oleh
penilai dan guru yang dinilai. Untuk penilaian kinerja tugas tambahan,
hasilnya dapat dicatat pada Format Penilaian Kinerja sebagai deskripsi
penilaiankinerja(lihatLampiran3).

c. Tahappemberiannilai
1) Penilaian
Pada tahap ini penilai menetapkan nilai untuk setiap kompetensi dengan
skalanilai1,2,3,atau4.Sebelumpemberiannilaitersebut,penilaiterlebih
dahulumemberikanskor0,1,atau2padamasingmasingindikatoruntuk
setiap kompetensi. Pemberian skor ini harus didasarkan kepada catatan
hasilpengamatandanpemantauansertabuktibuktiberupadokumenlain
yang dikumpulkan selama proses PK GURU. Pemberian nilai untuk setiap
kompetensidilakukandengantahapansebagaiberikut.
a) Pemberian skor 0, 1, atau 2 untuk masingmasing indikator setiap
kompetensi.Pemberianskorinidilakukandengancaramembandingkan
rangkuman catatan hasil pengamatan dan pemantauan di lembar
formatlaporandanevaluasiperkompetensidenganindikatorkinerja
masingmasingkompetensi(lihatcontohdiTabel8).Aturanpemberian
skoruntuksetiapindikatoradalah:
15

Skor 0 menyatakan indikator tidak dilaksanakan, atau tidak


menunjukkanbukti,
Skor1menyatakanindikatordilaksanakansebagian,atauadabukti
tetapitidaklengkap
Skor 2 menyatakan indikator dilaksanakan sepenuhnya, atau ada
buktiyanglengkap.

Tabel8.ContohPemberianNilaiKompetensitertentupadaprosesPKGURU
Kelas/MataPelajaran/BimbinganKonseling/Konselor

PenilaianKompetensi1:Mengenalkarakteristikpesertadidik
Indikator
1.
2.

3.

4.

5.
6.

Skor

Gurudapatmengidentifikasikarakteristikbelajar
setiappesertadidikdikelasnya.
Gurumemastikanbahwasemuapesertadidik
mendapatkankesempatanyangsamauntuk
berpartisipasiaktifdalamkegiatanpembelajaran.
Gurudapatmengaturkelasuntukmemberikan
kesempatanbelajaryangsamapadasemuapeserta
didikdengankelainanfisikdankemampuanbelajar
yangberbeda.
Gurumencobamengetahuipenyebabpenyimpangan
perilakupesertadidikuntukmencegahagarperilaku
tersebuttidakmerugikanpesertadidiklainnya.
Gurumembantumengembangkanpotensidan
mengatasikekuranganpesertadidik.
Gurumemperhatikanpesertadidikdengan
kelemahanfisiktertentuagardapatmengikuti
aktivitaspembelajaran,sehinggapesertadidik
tersebuttidaktermarginalkan(tersisihkan,diolok
olok,minder,dsb.).

Totalskoryangdiperoleh

1+2+2+0+0+2=7

SkorMaksimumKompetensi=banyaknyaindikator
dikalikandenganskortertinggi

6x2=12

Persentaseskorkompetensi=totalskoryangdiperoleh
dibagidenganSkorMaksimumKompetensidikalikan
100%

7/12x100%=58.33%

KonversiNilaiKompetensi(0%<X25%=1;25%<X
50%=2;50%<X75%=3;dan75%<X100%=4)

58.33% berada pada


rentang 50 % < X 75 %,
jadi kompetensi 1 ini
nilainya3

Perolehan skor untuk setiap kompetensi tersebut selanjutnya


dijumlahkan dan dihitung persentasenya dengan cara: membagi total
skor yang diperoleh dengan total skor maksimum kompetensi dan
mengalikannya dengan 100%. Perolehan persentase skor pada setiap
kompetensi ini kemudian dikonversikan ke skala nilai 1, 2, 3, atau 4.
Konversi skor 0, 1 dan 2 ke dalam nilai kompetensi dilakukan sesuai
Tabel9.

16

Tabel9.Konversiskorkenilaikompetensi
RentangTotalSkorX

NilaiKompetensi

0% < X 25%
25% <X50%
50% <X 75%
75% < X 100%

1
2
3
4

Untuk guru dengan tugas tambahan yang relevan dengan fungsi


sekolah/madrasah, penilaian dilakukan langsung dengan memberikan
nilai 1, 2, 3, dan 4 untuk setiap kriteria/indikator pada kompetensi
tertentu (lihat contoh Tabel 10). Kemudian, nilai setiap
kriteria/indikator dijumlahkan dan hitung rataratanya. Nilai ratarata
inimerupakannilaibagisetiapkompetensiterkait.

Tabel10.ContohPemberianNilaiKompetensitertentupadaprosesPKGURU
dengantugastambahansebagaikepalasekolah

Kompetensi6

:SupervisiPembelajaran(PKKS6)
KRITERIA

1.

2.

3.

Menyusunprogramsupervisiakademik
dalamrangkapeningkatan
profesionalismeguru.
Melaksanakansupervisiakademik
terhadapgurudenganmenggunakan
pendekatandantekniksupervisiyang
tepat.
Menilaidanmenindaklanjutikegiatan
supervisiakademikdalamrangka
peningkatanprofesionalismeguru.

JumlahSkor
SkorRataRata=JumlahSkor:3=8:3

BUKTIYANG
TERIDENTIFIKASI

SKOR
12 3 4

12 3 4

12 3 4

8
2,7

DeskripsiKinerjayangTelahDilakukan:

Dengan demikian, penilaian kinerja guru dengan tugas tambahan


tersebuttidakperlulagimengkonversikannyakenilai1,2,3,dan4.
b) Nilaisetiapkompetensitersebutkemudiandirekapitulasidalamformat
hasil penilaian kinerja guru (Lampiran 1C bagi PK Guru Kelas/Mata
Pelajaran atau 2C bagi PK Guru Bimbingan dan Konseling/Konselor)
untuk mendapatkan nilai total PK GURU. Untuk penilaian kinerja guru
dengantugastambahanyangrelevandenganfungsisekolah/madrasah,
nilai untuk setiap kompetensi direkapitulasi ke dalam format
rekapitulasi penilaian kinerja untuk mendapatkan nilai PK GURU. Nilai
totaliniselanjutnyadikonversikankedalamskalanilaisesuaiPeraturan
Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi

17

Birokrasi No. 16 Tahun 2009. Konversi ini dilakukan dengan


menggunakanrumussebagaiberikut.

Nilai PKG (skala 100) =

Nilai PKG
Nilai PKG Tertinggi

100

Keterangan:

Nilai PKG (skala 100) maksudnya nilai PK Guru Kelas/Mata Pelajaran,


Bimbingan dan Konseling/Konselor atau tugas tambahan yang relevan
dengan fungsi sekolah/madrasah dalam skala 0 100 menurut Peraturan
Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi
Nomor16Tahun2009.
Nilai PKG adalah nilai PK GURU Kelas/Mata Pelajaran, Bimbingan dan
Konseling/Konselor atau pelaksanaan tugas tambahan yang relevan dengan
fungsi sekolah/madrasah yang diperoleh dalam proses PK GURU sebelum
diubah dalam skala 0 100 menurut Peraturan Menteri Negara
Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun
2009.
NilaiPKGTertinggiadalahnilaitertinggiPKGURUyangdapatdicapai,yaitu56
(=14x4)bagiPKGURUpembelajaran(14kompetensi),dan68(=17x4)bagi
PK Guru pembimbingan (17 kompetensi). Nilai tertinggi PK GURU dengan
tugastambahandisesuaikandenganinstrumenterkaituntukmasingmasing
tugastambahanyangsesuaidenganfungsisekolah/madrasah.

c) Berdasarkan hasil konversi nilai PK GURU ke dalam skala nilai sesuai


dengan PermenegPAN dan RB Nomor 16 tahun 2010 tentang Jabatan
Fungsional Guru dan Angka Kreditnya, selanjutnya dapat ditetapkan
sebutandanpersentaseangkakreditnyasebagaimanatercantumdalam
tabel11.
Tabel11.KonversiNilaiKinerjaHasilPKGURUkepersentaseAngkaKredit
NilaiHasilPKGURU

Sebutan

91 100
76 90
61 75
51 60
50

Amatbaik
Baik
Cukup
Sedang
Kurang

PersentaseAngka
kredit
125%
100%
75%
50%
25%

d) Setelahmelaksanakanpenilaian,penilaiwajibmemberitahukankepada
guruyangdinilaitentangnilaihasilPKGURUberdasarkanbukticatatan
untuk setiap kompetensi. Penilai dan guru yang dinilai melakukan
refleksi terhadap hasil PK GURU, sebagai upaya untuk perbaikan
kualitaskinerjagurupadaperiodeberikutnya.
e) Jika guru yang dinilai dan penilai telah sepakat dengan hasil penilaian
kinerja,makakeduanyamenandatanganiformatlaporanhasilpenilaian
kinerja guru tersebut (Lampiran 1C untuk Guru Pembelajaran atau
Lampiran 2C untuk Guru Pembimbingan BK/Konselor). Format ini juga
ditandatanganiolehkepalasekolah.
f) Khusus bagi guru yang mengajar di 2 (dua) sekolah atau lebih (guru
multi sekolah/madrasah), maka penilaian dilakukan di sekolah/
madrasah induk. Meskipun demikian, penilai dapat melakukan
pengamatan serta mengumpulkan data dan informasi dari
sekolah/madrasahlaintempatgurumengajarataumembimbing.

18

2) PernyataanKeberatanterhadapHasilPenilaian
Keputusan penilai terbuka untuk diverifikasi. Guru yang dinilai dapat
mengajukan keberatan terhadap hasil penilaian tersebut. Keberatan
disampaikan kepada Kepala Sekolah dan/atau Dinas Pendidikan, yang
selanjutnyaakanmenunjukseseorangyangtepatuntukbertindaksebagai
moderator. Dalam hal ini moderator dapat mengulang pelaksanaan PK
GURU untuk kompetensi tertentu yang tidak disepakati atau mengulang
penilaiankinerjasecaramenyeluruh.Pengajuanusulpenilaianulangharus
dicatatdalamlaporanakhir.Dalamkasusini,nilaiPKGURUdarimoderator
digunakan sebagai hasil akhir PK GURU. Penilaian ulang hanya dapat
dilakukan satu kali dan moderator hanya bekerja untuk kasus penilaian
tersebut.

d. Tahappelaporan
SetelahnilaiPKGURUformatifdansumatifdiperoleh,penilaiwajibmelaporkan
hasil PK GURU kepada pihak yang berwenang untuk menindaklanjuti hasil PK
GURU tersebut. Hasil PK GURU formatif dilaporkan kepada kepala
sekolah/koordinatorPKBsebagaimasukanuntukmerencanakankegiatanPKB
tahunan. Hasil PK GURU sumatif dilaporkan kepada tim penilai tingkat
kabupaten/kota, tingkat provinsi, atau tingkat pusat sesuai dengan
kewenangannya. Laporan PK Guru sumatif ini digunakan oleh tim penilai
tingkat kabupaten/kota, provinsi, atau pusat sebagai dasar perhitungan dan
penetapan angka kredit (PAK) tahunan yang selanjutnya dipertimbangkan
untuk kenaikan pangkat dan jabatan fungsional guru. Laporan mencakup: (1)
Laporan dan evaluasi per kompetensi sesuai format; (ii) Rekap hasil PK GURU
sesuaiformat;dan(iii)dokumenpendukunglainnya.

Guru dengan tugas tambahan yang relevan dengan fungsi sekolah/madrasah dan
mengurangibebanjammengajartatapmuka,dinilaidenganmenggunakan2(dua)
instrumen, yaitu: (i) instrumen PK GURU pembelajaran atau pembimbingan; dan
(ii) instrumen PK GURU pelaksanaan tugas tambahan yang relevan dengan fungsi
sekolah/madrasah. Hasil PK GURU pelaksanaan tugas tambahan tersebut akan
digabungkan dengan hasil PK GURU pelaksanaan pembelajaran atau
pembimbingansesuaipersentaseyangditetapkandalamaturanyangberlaku.

B. KonversiNilaiHasilPKGURUkeAngkaKredit
NilaikinerjaguruhasilPKGURUperludikonversikankeskalanilaimenurutPeraturan
MenteriNegaraPendayagunaanAparaturNegaradanReformasiBirokrasiNomor16
Tahun2009tentangJabatanFungsionalGurudanAngkaKreditnya.Hasilkonversiini
selanjutnya digunakan untuk menetapkan sebutan hasil PK GURU dan persentase
perolehan angka kredit sesuai pangkat dan jabatan fungsional guru. Sebelum
melakukan pengkonversian hasil PK GURU ke angka kredit, tim penilai harus
melakukan verifikasi terhadap hasil PK GURU. Kegiatan verifikasi ini dilaksanakan
dengan menggunakan berbagai dokumen (Hasil PK GURU yang direkapitulasi dalam
FormatRekapHasilPKGURU,catatanhasilpengamatan,studidokumen,wawancara,
dan sebagainya yang ditulis dalam Format Laporan dan Evaluasi per kompetensi
beserta dokumen pendukungnya) yang disampaikan oleh sekolah untuk pengusulan

19

penetapanangkakredit.Jikadiperlukandandimungkinkan,kegiatanverifikasihasilPK
GURU dapat mencakup kunjungan ke sekolah/madrasah oleh tim penilai tingkat
kabupaten/kota,provinsi,ataupusat.

PengkonversianhasilPKGURUkeAngkaKreditadalahtugasTimPenilaiAngkaKredit
kenaikan jabatan fungsional guru di tingkat kabupaten/kota, provinsi, atau pusat.
Penghitungan angka kredit dapat dilakukan di tingkat sekolah, tetapi hanya untuk
keperluan estimasi perolehan angka kredit guru. Angka kredit estimasi berdasarkan
hasil perhitungan PK GURU yang dilaksanakan di sekolah, selanjutnya dicatat dalam
formatpenghitunganangkakredityangditandatanganiolehpenilai,guruyangdinilai
dan diketahui oleh kepala sekolah. Bersamasama dengan angka angka kredit dari
unsur utama lainnya (pengembangan diri, publikasi ilmiah dan karya inovatif) dan
unsurpenunjang,hasilperhitunganPKGURUyangdilakukanolehtimpenilaitingkat
kabupaten/kota, provinsi, atau pusat akan direkap dalam daftar usulan penetapan
angka kredit (DUPAK) untuk proses penetapan angka kredit kenaikan jabatan
fungsionalguru.

1. Konversi nilai PK GURU bagi guru tanpa tugas tambahan yang relevan dengan
fungsisekolah/madrasah
Konversi nilai PK GURU ke angka kredit dilakukan berdasarkan Tabel 11 di atas.
Selanjutnya, berdasarkan Permenneg PAN dan RB Nomor 16 Tahun 2009,
perolehanangkakredituntukpembelajaranataupembimbingansetiaptahunbagi
gurudiperhitungkandenganrumussebagaiberikut:

(AKK AKPKB AKP) JM


NPK
JWM
Angka kredit per tahun =
4

Keterangan:
AKKadalahangkakreditkumulatifminimalyangdipersyaratkanuntukkenaikanpangkat.
AKPKB adalah angka kredit PKB yang diwajibkan (subunsur pengembangan diri, karya
ilmiah,dan/ataukaryainovatif).
AKPadalahangkakreditunsurpenunjangsesuainketentuanPermenegPANdanRBNomor
16Tahun2009.
JM adalah jumlah jam mengajar (tatap muka) guru di sekolah/madrasah atau jumlah
konseliyangdibimbingolehguruBK/Konselorpertahun.
JWMadalahjumlahjamwajibmengajar(2440jamtatapmukaperminggu)bagiguru
pembelajaranataujumlahkonseli(150250konselipertahun)yangdibimbingolehguru
BK/Konselor.
NPKadalahpersentaseperolehanangkakreditsebagaihasilpenilaiankinerja.
4adalahwakturataratakenaikanpangkatreguler,(4tahun).
JM/JWM = 1 bagi guru yang mengajar 2440 jam tatap muka per minggu atau
membimbing150250konselipertahun.
JM/JWM=JM/24bagiguruyangmengajarkurangdari24jamtatapmukaperminggu
atauJM/150bagiguruBK/Konseloryangmembimbingkurangdari150konseliper
tahun.

AKK, AKPKB dan AKP yang dipersyaratkan untuk guru dengan jenjang/pangkat
tertentu ditetapkan berdasar Pasal 18 Peraturan MenteriNegara Pendayagunaan
AparaturNegaradanReformasiBirokrasiNo.16Tahun2009.
Menurutperaturanini,jenjangjabatanfungsionalguruterdiridari;GuruPertama,
GuruMuda,GuruMadya,danGuruUtama.SeorangGuruyangakandipromosikan
20

naik jenjang pangkat dan jabatan fungsionalnya setingkat lebih tinggi,


dipersyaratkanharusmemilikiangkakreditkumulatifminimalsebagaiberikut:
Tabel12.PersyaratanAngkaKredit
untukKenaikanPangkatdanJabatanFungsionalGuru
PersyaratanAngkaKredit
kenaikanpangkatdan
jabatan
JabatanGuru
PangkatdanGolonganRuang
Kumulatif
Kebutuhan
Perjenjang
minimal
1
2
3
4
GuruPertama
PenataMuda,III/a
100
50
PenataMudaTingkatI,III/b
150
50
GuruMuda
Penata,III/c
200
100
PenataTingkatI,III/d
300
100
GuruMadya
Pembina,IV/a
400
150
PembinaTingkatI,IV/b
550
150
PembinaanUtamaMuda,IV/c
700
150
GuruUtama
PembinaUtamaMadya,IV/d
850
200
PembinaUtama,IV/e
1.050
200
Keterangan:(1)Angkakreditkumulatifminimalpadakolom3adalahjumlahangkakreditminimal
yang dimiliki untuk masingmasing jenjang jabatan/pangkat; dan (2) Angka kredit pada kolom 4
adalah jumlah peningkatan minimal angka kredit yang dipersyaratkan untuk kenaikan
pangkat/jabatansetingkatlebihtinggi.

Persyaratan angka kredit yang diperlukan untuk kenaikan pangkat dan jabatan
fungsional dari satu jenjang ke jenjang berikutnya yang lebih tinggi terdiri dari
unsur utama paling kurang 90% dan unsur penunjang paling banyak 10%. Unsur
utama terdiri dari unsur pendidikan, pembelajaran dan tugas tambahan yang
relevan dengan fungsi sekolah/madrasah, serta pengembangan keprofesian
berkelanjutan (PKB). Unsur PKB terdiri dari pengembangan diri, publikasi ilmiah,
dan karya inovatif. Angka kredit dari unsur PKB yang harus dipenuhi untuk naik
pangkat dan jabatan fungsional dari jenjang tertentu ke jenang lain yang lebih
tinggiadalahsebagaiberikut.
a. Guru Pertama, pangkat Penata Muda, golongan ruang III/a yang akan naik
pangkat menjadi Guru Pertama, pangkat Penata Muda Tingkat I, golongan
ruang III/b mensyaratkan paling sedikit 3 (tiga) angka kredit dari subunsur
pengembangandiri.
b. GuruPertama,pangkatPenataMudaTingkatI,golonganruangIII/byangakan
naik jabatan/pangkat menjadi Guru Muda, pangkat Penata, golongan ruang
III/cmensyaratkanpalingsedikit4(empat)angkakreditdarisubunsurpublikasi
ilmiah dan/atau karya inovatif, dan paling sedikit 3 (tiga) angka kredit dari
subunsurpengembangandiri.
c. Guru Muda, pangkat Penata, golongan ruang III/c yang akan naik pangkat
menjadi Guru Muda, pangkat Penata Tingkat I, golongan ruang III/d
mensyaratkan paling sedikit 6 (enam) angka kredit dari subunsur publikasi
ilmiah dan/atau karya inovatif, dan paling sedikit 3 (tiga) angka kredit dari
subunsurpengembangandiri.
d. Guru Muda, pangkat Penata Tingkat I, golongan ruang III/d yang akan naik
jabatan/pangkatmenjadiGuruMadya,pangkatPembina,golonganruangIV/a
mensyaratkan paling sedikit 8 (delapan) angka kredit dari subunsur publikasi

21

e.

f.

g.

h.

ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka kredit dari
subunsurpengembangandiri.
Guru Madya, pangkat Pembina, golongan ruang IV/a yang akan naik pangkat
menjadi Guru Madya, pangkat Pembina Tingkat I, golongan ruang IV/b
mensyaratkanpalingsedikit12(duabelas)angkakreditdarisubunsurpublikasi
ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka kredit dari
subunsurpengembangandiri.
GuruMadya,pangkatPembinaTingkatI,golonganruangIV/byang akannaik
pangkatmenjadiGuruMadya,pangkatPembinaUtamaMuda,golonganruang
IV/c mensyaratkan paling sedikit 12 (dua belas) angka kredit dari subunsur
publikasi ilmiah dan/atau karya inovatif, dan paling sedikit 4 (empat) angka
kreditdarisubunsurpengembangandiri.
GuruMadya,pangkatPembinaUtamaMadya,golonganruangIV/cyangakan
naik jabatan/pangkat menjadi Guru Utama, pangkat Pembina Utama Madya,
golongan ruang IV/d, mensyaratkan paling sedikit 14 (empat belas) angka
kreditdarisubunsurpubliksiilmiahdan/ataukaryainovatif,danpalingsedikit5
(lima)angkakreditdarisubunsurpengembangandiri.
GuruUtama,pangkatPembinaUtamaMadya,golonganruangIV/dyangakan
naik pangkat menjadi Guru Utama, pangkat Pembina Utama, golongan ruang
IV/e mensyaratkan paling sedikit 20 (dua puluh) angka kredit dari subunsur
publikasiilmiahdan/ataukaryainovatif,danpalingsedikit5(lima)angkakredit
darisubunsurpengembangandiri.

Contoh1:GuruMataPelajaran
Budiman, S.Pd. adalah guru Bahasa Indonesia dengan jabatan Guru Pertama
pangkatdangolonganruangPenataMudaIII/aTMT1April2012.Budiman,S.Pd.
yangmengajar24jamtatapmukadantelahmengikutiPKGURUpadaDesember
2012mendapatnilai50.Makauntukmenghitungangkakredityangdiperoleholeh
Budiman, S.Pd. dalam tahun tersebut digunakan langkahlangkah perhitungan
sebagaiberikut.
1) KonversihasilPKGURUkeskalanilai0100sesuaiPeraturanMenteriNegara
Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Nomor 16 Tahun
2009denganmenggunakanformulamatematikaberikut:
Nilai PKG
Nilai PKG (skala100)

=
100
Nilai

PKG

Tertinggi

Keterangan:
NilaiPKGskala100adalahnilaiPKGuruKelas/MataPelajaranatauBimbingandan
Konseling/Konselor dalam skala 0 100 menurut Peraturan Menteri Negara
PendayagunaanAparaturNegaradanReformasiBirokrasiNomor16Tahun2009.
Nilai PKG adalah nilai PK GURU Kelas/Mata Pelajaran atau Bimbingan dan
Konseling/KonseloryangdiperolehdalamprosesPKGURUsebelumdiubahkedalam
skala 0 100 menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara
danReformasiBirokrasiNomor16Tahun2009.
NilaiPKGTertinggiadalahnilaitertinggiPKGURUyangdapatdicapai,yaitu56(=14x
4)bagiPKGURUKelas/MataPelajaran(14kompetensi),dan68(=17x4)bagiPKGuru
BimbingandanKonseling/Konselor(17kompetensi).

NilaiPKGURUtertinggiuntukpembelajaranadalah56,makadenganformula
matematikatersebutdiperolehNilaiPKGskala100=50/56x100=89.
22

2) BerdasarkanPeraturanMenteriNegaraPendayagunaanAparaturNegaradan
ReformasiBirokrasiNo.16Tahun2009,nilai89beradadalamrentang7690,
sehinggaBudiman,S.Pd.memperolehnilaiBaik(100%).
3) Bila Budiman, S.Pd. mengajar 24 jam per minggu maka berdasarkan rumus
tersebut angka kredit yang diperoleh Budiman, S.Pd. untuk subunsur
pembelajaranpadatahun2012(dalamperiode1tahun)adalah:

AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4
AngkaKreditsatutahun={(5035)x24/24x100%}=10,5

4
4) AngkakredityangdiperolehBudiman,S.Pd.selamatahun2012adalah10.5
per tahun. Apabila Budiman, S.Pd. memperoleh nilai kinerja tetap Baik,
selama 4 tahun, maka angka kredit untuk unsur pembelajaran yang
dikumpulkanadalah10.5x4=42.
5) Apabila Budiman, S.Pd. melaksanakan kegiatan Pengembangan Keprofesian
Berkelanjutandanmemperoleh3angkakreditdaripengembangandiri,dan5
angkakreditdarikegiatanpenunjang,makaSdr.Budiman,S.Pd.memperoleh
angka kredit kumulatif sebesar : 42 + 3 + 5 = 50. Karena angka kredit yang
dipersyaratkanuntuknaikpangkat/jabatandariGuruPertamapangkatPenata
Muda, golongan ruang III/a ke Guru Muda pangkat Penata Muda Tingkat I,
golongan ruang III/b adalah 50, maka Budiman, S.Pd. dapat naik
pangkat/jabatantepatdalam4tahun.

Contoh2:GuruBimbingandanKonseling/Konselor
Rahayu,S.Pd.adalahguruBimbingandanKonselingpadaMTsNegeri2Pamulang
denganjabatanGuruMudapangkatPenatagolonganruangIII/cTMT1April2013.
Sebagai guru BK, Rahayu S.Pd. membimbing 150 peserta didik per tahun dan
selama empat tahun telah mengikuti program pengembangan diri dengan angka
kredit3sertamenghasilkanpublikasiilmiahdan/ataukaryainovatifdenganangka
kredit 6. Rahayu juga telah memperoleh angka kredit 10 untuk unsur penunjang.
PadaDesember2013yangbersangkutandinilaikinerjanyadanmemperolehhasil
nilai PK GURU sebesar 58. Penilaian kinerja terhadap Rahayu, S.Pd. pada tiga
tahun berikutnya selalu memberikan hasil Baik. Langkahlangkah untuk
menghitungangkakredityangdiperolehRahayu,S.Pd.adalahsebagaiberikut.
1) Konversi hasil PK GURU Rahayu, S.Pd. tahun 2013 ke skala nilai 0 100
menurut Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan
ReformasiBirokrasiNomor16Tahun2009adalah=58/68x100=85,29.
2) BerdasarkanPeraturanMenteriNegaraPendayagunaanAparaturNegaradan
Reformasi Birokrasi No. 16 Tahun 2009 rentang nilai 85,29 berada dalam
rentang7690dandisebutBaik(100%),.
3) Angka kredit yang diperoleh Rahayu, S.Pd. untuk subunsur pembimbingan
padatahun2013(dalamperiode1tahun)adalah:

23

AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4
AngkaKreditsatutahun=[{100(3+6)10}x150/150x100%]=20,25

4
4) Angka kredit yang diperoleh Rahayu, S.Pd. pada tahun 2013 adalah 20,25.
KarenaRahayu, S.Pd. memperoleh nilai kinerja tetap Baik, selama4 tahun,
maka angka kredit untuk subunsur pembimbingan yang dikumpulkan adalah
20,25x4=81,0.
5) Selama 4 (empat) tahun tersebut, Rahayu, S.Pd. melaksanakan kegiatan
Pengembangan Keprofesian Berkelanjutan dan memperoleh 3 angka kredit
daripengembangandiri,6angkakreditdaripublikasiilmiahdankaryainovatif,
dan10angkakreditdarikegiatanpenunjang,makaRahayu,S.Pd.memperoleh
angkakreditkumulatifsebesar:81,5+3+6+10=100.Karenaangkakredit
yang dipersyaratkan untuk naik pangkat/jabatan dari Guru Muda pangkat
Penata,golonganruangIII/ckeGuruMudapangkatPenataTingkatI,golongan
ruangIII/dadalah100makaRahayu,S.Pd.dapatnaikpangkat/jabatandalam
dari4tahun.

2. Konversi nilai PK GURU dengan tugas tambahan yang relevan dengan fungsi
sekolah/madrasahyangmengurangijammengajartatapmukaguru
Hasil akhir nilai kinerja guru dengan tugas tambahan yang relevan dengan fungsi
sekolah/madrasah (Kepala Sekolah, Wakil Kepala Sekolah, Kepala Laboratorium,
KepalaPerpustakaan,dansejenisnya)yangmengurangijammengajartatapmuka
diperhitungkan
berdasarkan
prosentase
nilai
PK
GURU
pembelajaran/pembimbingan dan prosentase nilai PK GURU pelaksanaan tugas
tambahantersebut.
1) Untukitu,nilaihasilPKGURUKelas/MataPelajaranatauPKGURUBimbingan
dan Konseling/Konselor, atau PK GURU dengan tugas tambahan yang relevan
denganfungsisekolah/madrasahperludiubahterlebihdahulukeskala0100
denganformulamatematikaberikut:

Nilai PKG
Nilai PKG (skala 100) =
100
Nilai PKG

maksimum

Keterangan:
NilaiPKGskala100adalahnilaiPKGURUKelas/MataPelajaranatauBimbingandan
Konseling/Konselor atau tugas tambahan yang relevan dengan fungsi
sekolah/madrasah dalam skala 0 100 (sesuai Peraturan Menteri Negara
PendayagunaanAparaturNegaradanReformasiBirokrasiNo.16Tahun2009)
Nilai PKG adalah total nilai PK Guru Kelas/Mata Pelajaran atau Bimbingan dan
Konseling/Konselor, atau tugas tambahan yang relevan dengan fungsi
sekolah/madrasahyangdiperolehsebelumdiubahkedalamskala0100.
NilaiPKGmaksimumadalahnilaitertinggiPKGURU.UntukguruKelas/MataPelajaran
adalah56(=14x4),untukguruBimbingandanKonseling/Konseloradalah68(=17x
4),atautugastambahanyangrelevandenganfungsisekolah/madrasahsesuaidengan
instrumenmasingmasing.

2) Masingmasing hasil konversi nilai kinerja guru untuk unsur pembelajaran/


pembimbingan dan tugas tambahan yang relevan dengan fungsi
24

sekolah/madrasah, kemudian dikategorikan ke dalam Amat Baik (125%), Baik


(100%), Cukup (75%), Sedang (50%), atau Kurang (25%) sebagaimana diatur
dalam Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan
ReformasiBirokrasiNo.16Tahun2009.
3) Angkakreditpertahunmasingmasingunsurpembelajaran/pembimbingandan
tugastambahanyangrelevandenganfungsisekolah/madrasahyangdiperoleh
olehgurudihitungmenggunakanrumusberikutini.
a) Untuk menghitung AK subunsur pembelajaran/pembimbingan digunakan
rumusberikut.

Angka

kredit

per tahun

(AKK AKPKB

AKP) JM
4

JWM

NPK

Keterangan:
AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikan
pangkat.
AKPKBadalahangkakreditPKByangdiwajibkan(subunsurpengembangandiri,karya
ilmiah,dan/ataukaryainovatif).
AKP adalah angka kredit unsur penunjang sesuai dengan ketentuan menurut
PermenegPANdanRBNomor16Tahun2009.
JMadalahjumlahjammengajar(tatapmuka)gurudisekolah/madrasahataujumlah
konseliyangdibimbingolehguruBK/Konselor.
JWMadalahjumlahjamwajibmengajar(2440jamtatapmukaperminggu)bagi
gurupembelajaranataujumlahkonseli(150250konselipertahun)yangdibimbing
olehguruBK/Konselor.
NPKadalahprosentaseperolehanangkakreditsebagaihasilpenilaiankinerja
4adalahwakturataratakenaikanpangkatreguler(4tahun).
JM/JWM=1bagiguruyangmengajar2440jamtatapmukapermingguatau
yangmembimbing150250konselipertahunbagiguruBK/Konselor.
JM/JWM = JM/24 bagi guru yang mengajar kurang dari 24 jam tatap muka per
mingguatauJM/150bagiguruBK/Konseloryangmembimbingkurangdari150
konselipertahun.

b) Untuk menghitung angka kredit subunsur tugas tambahan yang relevan


denganfungsisekolah/madrasahdigunakanrumusberikutini.

(AKK - AKPKB - AKP) NPK


Angka kredit per tahun =
4
Keterangan:
AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk kenaikan
pangkat.
AKPKBadalahangkakreditPKByangdiwajibkan(subunsurpengembangandiri,karya
ilmiah,dan/ataukaryainovatif).
AKP adalah angka kredit unsur penunjang yang diwajibkan sesuai dengan ketentuan
menurutPermenegPANdanRBNomor16Tahun2009.
NPKadalahprosentaseperolehanangkakreditsebagaihasilpenilaiankinerja
4adalahwakturataratakenaikanpangkat(reguler),4tahun.

4) Selanjutnyaangkakreditunsurpembelajaran/pembimbingandanangkakredit
tugas tambahan yang relevan dengan fungsi sekolah/madrasah dijumlahkan
sesuai prosentasenya untuk memperoleh total angka kredit dengan
perhitungansebagaiberikut:

25

a. GurudenganTugasTambahansebagaiKepalaSekolah
TotalAngkaKredit=25%AngkaKreditPembelajaran/Pembimbingan+75%
AngkaKreditTugasTambahansebagaiKepalaSekolah.
b. GurudenganTugasTambahansebagaiWakilKepalaSekolah
TotalAngkaKredit=50%AngkaKreditPembelajaran/Pembimbingan+50%
AngkaKreditTugasTambahansebagaiWakilKepalaSekolah.
c. Guru dengan Tugas Tambahan sebagai Kepala Perpustakaan/
Laboratorium/Bengkel,atauKetuaProgramKeahlian;
TotalAngkaKredit=50%AngkaKreditPembelajaran/Pembimbingan+50%
AngkaKreditTugasTambahansebagaiPustakawan/Laboran

Contoh3:Guruyangmendapattugastambahanyangmengurangijammengajar
tatapmuka(misalnyaKepalaSekolah/Madrasah)
AhmadSumarna,S.Pd.jabatanGuruMadyapangkatPembinagolonganruangIV/a
TMT 1April2014mengajarmatapelajaranFisika,diberitugastambahansebagai
kepalasekolah,danmemperolehhasilpenilaiankinerjasebagaiguruadalah48dan
sebagai kepala sekolahmendapat jumlah skorratarata 18 pada Desember 2014.
Langkahlangkahperhitunganangkakreditnyaadalahsebagaiberikut.
Perhitunganangkakreditsubunsurpembelajaran:
1)
KonversihasilpenilaiankinerjatugaspembelajaranAhmadSumarna,S.Pd.ke
skala nilai Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan
ReformasiBirokrasiNomor16Tahun2009adalah:48/56x100=85,7.
2)
Nilai kinerja guru untuk subunsur pembelajaran/pembimbingan, kemudian
dikategorikankedalamAmatBaik(125%),Baik(100%),Cukup(75%),Sedang
(50%), atau Kurang (25%) sebagaimana diatur dalam Peraturan Menteri
Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi No. 16
Tahun 2009. Nilai PK Guru subunsur pembelajaran Ahmad Sumarna, S.Pd.
yangmendapattugastambahansebagaiKepalaSekolah=85,7masukdalam
rentang7690dengankategoriBaik(100%).
3)
Angka kredit per tahun subunsur pembelajaran yang diperoleh Ahmad
Sumarna,S.Pd.adalah:
AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4
AngkaKreditsatutahun=[{150(4+12)15}x6/6x100%]=29,75.

4
PerhitunganangkakredittugastambahansebagaiKepalaSekolah:
1)
Konversi hasil penilaian kinerjaAhmad Sumarna, S.Pd. dalam melaksanakan
tugas tambahan sebagai Kepala Sekolah, ke skala nilai Peraturan Menteri
NegaraPendayagunaanAparaturNegaradanReformasiBirokrasiNomor16
Tahun2009adalah18/24x100=75.
2)
Nilai kinerja guru untuk subunsur tugas tambahan sebagai Kepala Sekolah,
kemudian dikategorikan ke dalam Amat Baik (125%), Baik (100%), Cukup
(75%),Sedang(50%),atauKurang(25%)sebagaimanadiaturdalamPeraturan
Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi
No. 16 Tahun 2009. Nilai PK Guru tugas tambahan Ahmad Sumarna, S.Pd.
sebagaiKepalaSekolah=75masukdalamrentang6175dengankategori
Cukup(75%).
26

3)

4)

5)

6)

Angka kredit per tahun unsur tugas tambahan sebagai Kepala Sekolah yang
diperolehAhmadSumarna,S.Pd.adalah:
AngkaKreditsatutahun=(AKKAKPKBAKP)xNPK
4
AngkaKreditsatutahun={150(4+12)15}x75%=22,31.

4
Total angka kredit yang diperoleh Ahmad Sumarna, S.Pd. untuk tahun 2014
sebagaiguruyangmendapattugastambahansebagaiKepalaSekolahadalah
=25%(29,75)+75%(22,31)=7,44+16,73=24,17.
Jika selama 4 (empat) tahun terus menerus Ahmad Sumarna, S.Pd.
mempunyai nilai kinerja yang sama, maka nilai yang diperoleh Ahmad
Sumarna,S.Pd.sebagaigurudengantugastambahansebagaikepalasekolah
selama4tahunadalah4x24,17=96,68.
Apabila Ahmad Sumarna, S.Pd. melaksanakan kegiatan pengembangan
keprofesian berkelanjutan dan memperoleh 4 angka kredit dari kegiatan
pengembangandiri,12angkakreditdaripublikasiilmiah,dan15angkakredit
dari kegiatan penunjang, maka Ahmad Sumarna, S.Pd. memperoleh angka
kreditkumulatifsebesar96,68+4+12+15=127,68.Jadiyangbersangkutan
tidak dapat naik pangkat dari golongan ruang IV/a ke golongan ruang IV/b
denganjabatanGuruMadyadalamwaktu4tahun,karenabelummencapai
persyaratan angka kredit yang diperlukan untuk naik pangkat dan jabatan
fungsionalnyasebesar150.

Catatan:
Perolehanangkakreditgurudengantugastambahanlainyangrelevandenganfungsi
sekolah/madrasah selain kepala sekolah diperhitungkan dengan cara yang sama
(perbedaannyahanyapadarumuspenjumlahannya)

3. KonversinilaiPKGURUdengantugastambahanlainyangrelevandenganfungsi
sekolah/madrasahtetapitidakmengurangijammengajartatapmukaguru
Angka kredit tugas tambahan bagi guru dengan tugas tambahan lain yang tidak
mengurangijammengajartatapmuka,langsungdiperhitungkansebagaiperolehan
angkakreditgurupadaperiodetahuntertentu.Banyaknyatugastambahanuntuk
seorang guru maksimum 2 (dua) tugas per tahun. Angka kredit kumulatif yang
diperolehdiperhitungkansebagaiberikut.
1) Tugas yang dijabat selama satu tahun (misalnya menjadi wali kelas, tim
kurikulum,pembimbinggurupemula,dansejenisnya).
Angkakreditkumulatifyangdiperoleh=AngkaKreditHasilPKGURUselama
setahun + 5% Angka Kredit Hasil PK GURU selama
setahun x banyaknya tugas temporer yang diberikan
selamasetahun.
2) Tugasyangdijabatselamakurangdarisatutahunatautugastugassementara
(misalnyamenjadipengawaspenilaiandanevaluasi,membimbingpesertadidik
dalam kegiatan ekstrakurikuler, menjadi pembimbing penyusunan publikasi
ilmiahdankaryainovatif,dansejenisnya)

27

Angkakreditkumulatifyangdiperoleh=AngkaKreditHasilPKGURUselama
setahun + 2% Angka Kredit Hasil PK GURU selama
setahun x banyaknya tugas temporer yang diberikan
selamasetahun.
Contoh 4: Guru yang mendapat tugas tambahan menjadi Wali Kelas (tugas
tambahanlainyangtidakmengurangijammengajardandikerjakandalamjangka
waktusatutahun)
MisalnyaBudiman,S.Pd.(padacontoh1)diberikantugastambahansebagaiwali
kelas selama setahun yang tidak mengurangi jam mengajarnya. Karena Budiman,
S.Pd, pada perhitungan contoh 1 sudah mendapatkan angka kredit dari tugas
pembelajarannyasebesar10,5pertahun,makaangkakreditkumulatifyangdapat
dikumpulkan oleh Budiman, S.Pd. selama setahun, karena yang bersangkutan
mendapattugassebagaiwalikelasadalah:
Angka kredit kumulatif yang dikumpulkan = Angka Kredit Hasil PK GURU selama
setahun + 5% Angka Kredit Hasil PK GURU selama
setahun=10,5+(10,5x5/100)=10,5+0,53=11,03.
Contoh5:Guruyangmendapattugastambahanyangbersifatsementara(tugas
tambahan lain yang tidak mengurangi jam mengajar dan dilaksanakan kurang
darisatutahun)
Misalnya Budiman, S.Pd. (pada contoh 1) diberikan tugas sementara (kurang dari
setahun) yang tidak mengurangi jam mengajarnya sebanyak 2 kali sebagai
pengawaspenilaiandanevaluasi.KarenaBudiman,S.Pd.padaperhitungancontoh
1 sudah mendapatkan angka kredit dari tugas pembelajarannya sebesar 10,5 per
tahun,makaangkakreditkumulatifyangdapatdikumpulkanolehBudiman,S.Pd.
selamasetahun,karenamendapattugastambahanyangbersifatseentaratersebut
adalahsebagaiberikut.

Angkakreditkumulatifyangdikumpulkanselamasetahun=AngkaKreditHasilPK
GURU selama setahun + 2% Angka Kredit Hasil PK
GURU selama setahun x banyaknya tugas sementara
yangdiberikanselamasetahun=10,5+(10,5x2/100)x
2=10,5+0,21x2=10,5+0,42=10,92.

C. PenilaidalamPKGURU
1. KriteriaPenilai
Penilaian kinerja guru dilakukan di sekolah oleh Kepala Sekolah. Apabila Kepala
Sekolah tidak dapat melaksanakan sendiri (misalnya karena jumlah guru yang
dinilai terlalu banyak), maka Kepala Sekolah dapat menunjuk Guru Pembina atau
Koordinator PKB sebagai penilai. Penilaian kinerja Kepala Sekolah dilakukan oleh
Pengawas.Penilaiharusmemilikikriteriasebagaiberikut.
a) Menduduki jabatan/pangkat paling rendah sama dengan jabatan/pangkat
guru/kepalasekolahyangdinilai.
b) MemilikiSertifikatPendidik.
c) Memiliki latar belakang pendidikan yang sesuai dan menguasai bidang kajian
Guru/KepalaSekolahyangakandinilai.

28

d) Memilikikomitmenyangtinggiuntukberpartisipasiaktifdalammeningkatkan
kualitaspembelajaran.
e) Memilikiintegritasdiri,jujur,adil,danterbuka.
f) Memahami PK GURU dan dinyatakan memiliki keahlian serta mampu untuk
menilaikinerjaGuru/KepalaSekolah.
Dalam hal Kepala Sekolah, Pengawas, Guru Pembina, dan Koordinator PKB
memilikilatarbelakangbidangstudiyangberbedadenganguruyangakandinilai
maka penilaian dapat dilakukan oleh Kepala Sekolah dan/atau Guru Pembina/
Koordinator PKB dari Sekolah lain atau oleh Pengawas dari kabupaten/kota lain
yang sudah memiliki sertifikat pendidik dan memahami PK GURU. Hal ini berlaku
jugauntukmemberikanpenilaiankepadaGuruPembina.
2. MasaKerja
Masa kerja tim penilai kinerja guru ditetapkan oleh Kepala Sekolah atau Dinas
Pendidikanpalinglamatiga(3)tahun.Kinerjapenilaidievaluasisecaraberkalaoleh
Kepala Sekolah atau Dinas Pendidikan dengan memperhatikan prinsipprinsip
penilaian yang berlaku. Untuk sekolah yang berada di daerah khusus, penilaian
kinerja guru dilakukan oleh Kepala Sekolah dan/atau Guru Pembina setempat.
Jumlah guru yang dapat dinilai oleh seorang penilai adalah 5 sampai 10 guru per
tahun.
D. Sanksi
Penilaidanguruyangdinilaiakandikenakansanksiapabilayangbersangkutanterbukti
melanggar prinsipprinsip pelaksanaan PK GURU, sehingga menyebabkan Penetapan
Angka Kredit (PAK) diperoleh dengan cara melawan hukum. Sanksi tersebut adalah
sebagaiberikut:
1. DiberhentikansebagaiGuruatauKepalaSekolahdan/atauPengawas.
2. Bagi penilai, wajib mengembalikan seluruh tunjangan profesi, tunjangan
fungsional,dansemuapenghargaanyangpernahditerimasejakyangbersangkutan
melakukanprosesPKGURU.
3. Bagi guru wajib mengembalikan seluruh tunjangan profesi, tunjangan fungsional,
dan semua penghargaan yang pernah diterima sejak yang bersangkutan
memperolehdanmempergunakanPAKyangdihasilkandariPKGURU.

29

30

BABIV
TUGASDANTANGGUNGJAWABPIHAKTERKAIT
DALAMPELAKSANAANPENILAIANKINERJAGURU

Setiap pihak terkait memiliki tugas dan tanggung jawab dalam pelaksanaan kegiatan PK
GURU Penetapan tugas dan tanggung jawab tersebut sesuai dengan semangat otonomi
daerah serta mengutamakan prinsipprinsip efisiensi, keterbukaan, dan akuntabilitas.
PelaksanaantugasdantanggungjawabtersebutditunjukkandalamdiagramGambar2.

Menyusun Pedoman dan instrumen PK GURU,

melakukan Pemantauan dan Evaluasi,


TingkatPusat
KEMDIKNAS

menyeleksi dan melatih tim inti PK GURU tingkat

pusat.

Melaksanakan Pemetaan Data, Pendampingan,

Pembimbingan, dan Konsultasi Pelaksanaan


Dinas Pendidikan
Tingkat
Provinsi

Kegiatan, Pemantauan dan Evaluasi, Pelaporan


Provinsi dan LPMP
untuk menjamin pelaksanaan PK GURU yg

berkualitas.

Mengelola PK GURU tingkat Kabupaten/Kota

untuk menjamin PK GURU dilaksanakan secara


Dinas Pendidikan

Tingkat
Kab/Kota
efektif, efisien, obyektif, adil, akuntabel, serta
Kabupaten/Kota

membantu & memonitor


pelaksanaan PK GURU.

Membantu pelaksanaan tugas Kabupaten/Kota

Tingkat Kecamatan

UPTD Dinas Pendidikan


Kabupaten/Kota di Kec.

untuk menjamin keterlaksanaan PK GURU


secara efektif, efisien, obyektif, adil, akuntabel
serta membantu dan memonitor pelaksanaan PK
GURU.

Tingkat Sekolah

Merencanakan, melaksanakan dan melaporkan


pelaksanaan PK GURU secara efektif, efiesien,
obyektif, akuntabel, dsb.

Sekolah atau
Madrasah

Koordinator
PKB

Bertanggung jawab bahwa guru menerima


dukungan untuk meningkatkan kompetensi
dan/atau profesionalismenya sesuai dengan
profil kinerjanya.

Gambar2.DiagramTugasdanTanggungJawabPihakTerkaitdalamPelaksanaan
KegiatanPKGURU

31

Diagramdiatasmenunjukkanadanyaketerkaitantugasdantanggungjawabpihakpihak
yang terlibat dalam pelaksanaan PK GURU, mulai dari tingkat pusat (Kemdiknas) sampai
dengan sekolah. Konsekuensi dari adanya keterkaitan tersebut, menuntut agar pihak
pihak yang terlibat dalam pelaksanaan PK GURU melakukan koordinasi. Tugas dan
tanggungjawabmasingmasingpihakdirincisebagaiberikut.
A. TugasdanTanggungJawabTingkatPusat:KementerianPendidikanNasional
1. Menyusun dan mengembangkan Ramburambu Pengembangan Kegiatan PK
GURU.
2. MenyusunProsedurOperasionalStandarPelaksanaanPKGURU.
3. MenyusuninstrumendanperangkatlainuntukpelaksanaanPKGURU.
4. Mensosialisasikan, menyeleksi dan melaksanakan TOT penilai PK GURU tingkat
pusat.
5. MemantaudanmengevaluasikegiatanPKGURU.
6. MenyusunlaporanhasilpemantauandanevaluasiPKGURUsecaranasional.
7. Menyampaikan laporan hasil pemantauan dan evaluasi PK GURU kepada Dinas
Pendidikandansekolahsebagaiumpanbalikuntukditindaklanjuti.
8. MengkoordinasidanmensosialisasikankebijakankebijakanterkaitPKGURU.

B. TugasdanTanggungJawabTingkatProvinsi:DinasPendidikanProvinsidanLPMP
1. Menghimpun data profil guru dan sekolah yang ada di daerahnya berdasarkan
hasilPKGURUdisekolah.
2. Mensosialisasikan, menyeleksi, dan melaksanakan TOT untuk melatih penilai PK
GURUtingkatKabupaten/Kota.
3. Menetapkan dan mengesahkan tim penilai PK GURU yang berada di bawah
kewenanganprovinsidalambentukSuratKeputusan(SK)KepalaDinasPendidikan
Provinsi.
4. Melaksanakan pendampingan kegiatan PK GURU di sekolahsekolah yang ada di
bawahkewenangannya.
5. Menyediakan pelayanan konsultasi pelaksanaan kegiatan PK GURU yang ada di
bawahkewenangannya.
6. Memantau dan mengevaluasi pelaksanaan kegiatan PK GURU di sekolahsekolah
yangadadibawahkewenangannya.
7. Dinas Pendidikan Provinsi bersamasama dengan LPMP membuat laporan hasil
pemantauandanevaluasikegiatanPKGURUdanmengirimkannyakepadasekolah,
Dinas Pendidikan Kabupaten/Kota, dan/atau Kemdiknas, cq. Direktorat yang
menanganiPendidik,

C. Tugas dan Tanggung Jawab Tingkat Kabupaten/Kota: Dinas Pendidikan


Kabupaten/Kota
1. Menghimpun dan menyediakan data profil guru dan sekolah yang ada di
wilayahnyaberdasarkanhasilPKGURUdisekolah.
2. Mensosialisasikan dan melalui koordinasi dengan Dinas Pendidikan Provinsi dan
LPMPmelatihpenilaiPKGURUtingkatKabupaten/Kota.
3. Membantu pengkoordinasian pelaksanaan kegiatan PK GURU di sekolahsekolah
yangadadiwilayahnya.
4. Melaksanakan pendampingan kegiatan dan pengelolaan PK GURU di sekolah
sekolahyangadadiwilayahnya.

32

5. Menetapkan dan mengesahkan tim penilai PK GURU bagi guru yang berada di

bawahkewenangannyadalambentukSuratKeputusan(SK)KepalaDinas.
6. Mengetahui dan menyetujui program kerja pelaksanaan PK GURU yang diajukan
sekolah.
7. Menyediakan pelayanan konsultasi dan penyelesaian konflik dalam pelaksanaan
kegiatanPKGURUdisekolahsekolahyangadadidaerahnya.
8. Memantau dan mengevaluasi pelaksanaan kegiatan PK GURU untuk menjamin
pelaksanaanyangefektif,efisien,obyektif,adil,akuntabel,dansebagainya.
9. Membuat laporan hasil pemantauan dan evaluasi kegiatan PK GURU di sekolah
sekolah yang ada di wilayahnya dan mengirimkannya kepada sekolah, dan/atau
LPMPdengantembusankeDinasPendidikanProvinsimasingmasing.

D. TugasdanTanggungJawabTingkatKecamatan:UPTDDinasPendidikan
1. Menghimpun dan menyediakan data profil guru dan sekolah yang ada di
kecamatanwilayahnyaberdasarkanhasilPKGURUdisekolah.
2. Membantu pengkoordinasian pelaksanaan kegiatan PK GURU di wilayah
kecamatannya.
3. Melaksanakan pendampingan kegiatan dan pengelolaan PK GURU di wilayah
kecamatannya.
4. Menetapkan dan mengesahkan penilai PK GURU dalam bentuk Surat Keputusan
(SK)penetapansebagaipenilai.
5. MenyediakanpelayanankonsultasidalampelaksanaankegiatanPKGURUyangada
didaerahnya.
6. MemantaudanmengevaluasisertamelaporkanpelaksanaankegiatanPKGURUdi
tingkatkecamatanuntukdisampaikankepadaDinasPendidikanKabupaten/Kota.

E. TugasdanTanggungJawabTingkatSekolah
1. MemilihdanmengusulkanpenilaiuntukpelaksanaanPKGURU
2. Menyusun program kegiatan sesuai dengan RambuRambu Penyelenggaraan PK
GURUdanProsedurOperasionalStandarPenyelenggaraanPKGURU.
3. MengusulkanrencanaprogramkegiatankeUPTDatauDinasKabupaten/Kota.
4. MelaksanakankegiatanPKGURUsesuaiprogramyangtelahdisusunsecaraefektif,
efisien,obyektif,adil,akuntabel,dsb.
5. Memberikankemudahanaksesbagipenilaiuntukmelaksanakantugas
6. Melaporkan kepada UPTD atau Dinas Pendidikan Kabupaten/Kota jika terjadi
permasalahandalampelaksanaanPKGURU
7. Membuatlaporanpertanggungjawabankegiatan,administrasi,keuangan(jikaada)
danpelaksanaanprogram.
8. Membuat rencana tindak lanjut program pelaksanaan PK GURU untuk tahun
berikutnya.
9. Membantutimpemantaudanevaluasidaritingkatpusat,LPMP,DinasPendidikan
Kabupaten/Kota,UPTDDinasPendidikanKabupatendiKecamatan,danPengawas
Sekolah.
10. Membuat laporan kegiatan PK GURU dan mengirimkannya kepada Tim penilai
tingkat kabupaten/kota, provinsi, atau nasional sesuai kewenangannya sebagai
dasar penetapan angka kredit (PAK) tahunan yang diperlukan untuk kenaikan
pangkat dan jabatan fungsional guru. Tim Penilai untuk menghitung dan

33

menetapkanangkakredit,terlebihdahulumelakukanverifikasiterhadapberbagai
dokumen hasil PK GURU. Pada kegiatan verifikasi jika diperlukan dan memang
dibutuhkan tim penilai dapat mengunjungi sekolah. Sekolah juga menyampaikan
laporan tersebut kepada Dinas Pendidikan Kabupaten/Kota dan/atau ke UPTD
PendidikanKecamatan.
11. Merencanakan program untuk memberikan dukungan kepada guru yang
memperolehhasilPKGURUdibawahstandaryangditetapkanmaupunbagiguru
yangtelahmencapaistandar.

34

BABV
PENJAMINANMUTU,MONITORINGDANEVALUASIPELAKSANAANPKGURU

A. Penjaminanmutu
Penjaminan mutu PK GURU merupakan serangkaian proses untuk mengidentifikasi
keterlaksanaandanmutupelaksanaanPKGURUditiapsekolahsehinggaseluruhtahap
kegiatanmengarahpadatujuanyangdiharapkan.Peningkatanpenjaminanmutusecara
sistem meliputi perencanaan, pelaksanaan, monitoringevaluasi, dan tindak lanjut
perbaikan mutu. Sistem penjaminan mutu dapat dilakukan melalui pendekatan
monitoring maupun evaluasi. Monitoring dilakukan secara berkala dalam rangka
menghimpun data tentang keterlaksanaan program. Penilaian dilakukan untuk
mengidentifikasikinerjaPKGURUdalammenilaikemajuankinerjagurusecaraberkala
danberkelanjutan.

PelaksanaanpenjaminanmutuPKGURUmeliputi(1)identifikasitujuan,indikator,dan
targetPKGURU,(2)pengembanganinstrumen(3)penerapaninstrumendalamrangka
menghimpun data (4) mengolah, menganalisis dan menginterpretasikan data (5)
mengidentifikasikekuatandankelemahansertamengidentifikasipenyebabmunculnya
kekuatandankelemahan(6)menyusunrekomendasiperbaikanmutuberkelanjutan(7)
mengembangkan rencana PK GURU berikutnya. Oleh karena itu, pelaksanaan
penjaminanmutumemerlukaninstrumentersendiriyangdisusunoleh penyelenggara
penjaminan mutu. Untuk menunjang efektivitas penyelenggaraan, maka penjaminan
mutuPKGURUmemerlukanperencanaan,kalenderpelaksanaan,strukturpelaksana,
dan alur sistem informasi hasil evaluasi penjaminan mutu sebagai produk kegiatan
penjaminanmutuPKGURU.

Pelaksanaan penjaminan mutu PK GURU dilakukan sepanjang tahun, diawali dengan


kegiatan evaluasi diri sekolah (EDS) dan pelaksanaan monitoring sekolah oleh
pemerintahdaerah(MSPD).ProdukkegiatanEDSdanMSPDdivalidasiolehpemerintah
provinsimaupunlembagapenjaminanmutupendidikan(LPMP)danpemerintah.Hasil
pelaksanaanpenjaminanmutuPKGURUadalahpotretkinerjagurudisetiapsekolah,
kabupaten/kota, provinsi dan nasional. Profil kinerja mendeskripsikan tingkat
keterlaksanaan PK GURU, dan mutu pelaksanaan PK GURU di setiap sekolah. Hasil
penjaminanmutuPKGURUdiklasifikasikandalamkelompoksekolahberkinerjarendah,
cukup, dan tinggi. Kelompok sekolah yang berkinerja rendah dan cukup perlu
ditindaklanjuti dengan pembinaan melalui program pendampingan oleh Lembaga
PenjaminanMutuPendidikan(LPMP).

Sekolah yang berkinerja tinggi mendapat pembinaan lebih lanjut dari pemerintah,
tingkat provinsi, dan kabupaten/kota serta dapat memfasilitasi sekolah berkinerja
rendah dan cukup. Biaya penyelenggaraan program penjaminan mutu PK GURU
menjadi tanggung jawab masingmasing Provinsi, Pemerintah Kabupaten/Kota, dan
satuanpendidikan.

B. MonitoringdanEvaluasiProgram
Dalam penjaminan efektivitas pelaksanaan PK GURU, perlu dilakukan kegiatan
monitoring dan evaluasi yang dilaksanakan secara bertahap dan berkesinambungan

35

olehinstitusi/pihakterkait.HasilmonitoringdanevaluasimerefleksikanefektivitasPK
GURUyangdilaksanakanolehsekolah.Hasilmonitoringdanevaluasijugadipergunakan
untukmeningkatkanmutupelaksanaanPKGURUberikutnya.
Monitoringdanevaluasipadaprinsipnyamerupakanstrategiuntukmengetahuiapakah
pelaksanaan program PK GURU telah sesuai dengan tujuan yang diharapkan. Di
samping itu melalui kegiatan ini dapat diidentifikasi masalah dan rekomendasi untuk
mengatasinya. Proses analisis dalam evaluasi diarahkan pada penyusunan kesimpulan
tentang keberhasilan program PK GURU untuk memetakan kinerja seorang guru.
Secara nyata oleh karena itu, kegiatan monitoring dan evaluasi harus mampu
menjawabpertanyaan:
1. ApakahperencanaanprogramPKGURUbenarbenarsudahmengarahpadaproses
yang efektif, efisien, obyektif, dan akuntabel untuk menggambarkan kinerja guru
yangsesungguhnyadalammelaksanakantugasnya?
2. ApakahpelaksanaanPKGURUdanperanpelaksanaPKGURUtelahefektif,efisien,
obyektif, adil, akuntabel, serta mampu mengidentifikasi permasalahan dalam
pelaksanaanPKGURU?
3. Apakah kegiatan PK GURU berdampak pada peningkatan kompetensi guru dalam
memberikan layanan pendidikan di sekolah, khususnya dalam pelaksanaan tugas
sehariharimemfasilitasipembelajaran,pembimbingandan/atautugaslainnya.
4. Bagaimana akuntabilitas pelaksanaan PK GURU di sekolah? Apakah terjamin
keberlanjutannyadanaparekomendasiuntukpeningkatannya?.

Dengan menganalisis data, petugas monitoring dan evaluasi diharapkan dapat


menjawabpertanyaantersebutdiatassertadapatmenarikkesimpulanyangobyektif
terhadappelaksanaanPKGURU,sehinggamenggambarkankondisinyatasekolahyang
dinilai.

C. LaporanMonitoringdanEvaluasiProgramPKGURU
Setelah melakukan monitoring dan evaluasi pelaksanaan PK GURU, tim/petugas
menyusunlaporanyangmenggambarkanperencanaan,prosesdanhasilyangdicapai.
Adapunsistematikapelaporanadalahsebagaiberikut.

1. Pendahuluan
Bagian pendahuluan merupakan rangkaian pemikiran yang mendasari kegiatan
monitoringdanevaluasipelaksanaanPKGURU,yangmemuathalhalberikut.
a. Latar Belakang: menggambarkan dasar pemikiran dilaksanakannya monitoring
danevaluasi.
b. Permasalahan: menggambarkan masalah penting yang berhubungan dengan
pelaksanaanPKGURU.
c. Tujuan: mencakup sejumlah karakter pelaksanaan PK GURU yang ingin dicapai
dalamkegiatanmonitoringdanevaluasi.
d. Manfaat:merupakansejumlahharapanyangdiintegrasikanpadapenerapanan
temuanhasilprosesmonitoringdanevaluasiPKGURU.
e. Skenariokegiatanberisirangkaiankegiatanyangakandilakukandalamkegiatan
monitoringdanevaluasiPKGURU.

36

2. Metodologi
Metodologi mencakup ruang lingkup, lokasi, populasi dan sampel, petugas
monitoring,evaluasi,dananalisisdata.

3. Hasilmonitoringdanevaluasi
Hasilmonitoringdanevaluasiadalahbagianintilaporanyangmenyajikandatadan
hasilanalisis,baikyangbersifatdeskriptifkuantitatifmaupunanalisisyangbersifat
kualitatif. Pembahasan hasil monitoring dan evaluasi adalah bagian penting yang
menyampaikan ulasan dan pemaknaan terhadap hasil data kuantitatif dan
kualitatif yang terkumpul untuk menjawab tujuan pelaksanaan monitoring dan
evaluasi serta program pengembangan keprofesian berkelanjutan yang dapat
memotretpelaksanaankegiatanPKGURUdilapangan.

4. KesimpulandanRekomendasi
Berdasarkan hasil analisis, dibuat kesimpuan dan rekomendasi. Kesimpulan
merupakan intisari terpenting dari pelaksanan monitoring dan evaluasi.
Penyusunan kesimpulan hendaknya; (1) singkat, jelas, dan mudah dipahami; (2)
selaras, sejalan dan sesuai dengan permasalahan kegiatan PK GURU; dan (3)
menyampaikan permasalahan yang dihadapi dan upaya pemecahannya.
Rekomendasi ditujukan untuk perbaikan pelaksanaan PK GURU dan sekaligus
perbaikanpelaksanaanmonitoringdanevaluasinya.

Laporan hasil monitoring dan evaluasi disampaikan oleh tim monitoring dan
evaluasi kepada Kepala Dinas, Kepala Sekolah dan Koordinator PK GURU sekolah
dan/atau institusi terkait sebagai bentuk pertanggungjawaban (akuntabilitas)
pelaksanaanPKGURU.Hasilmonitoringdanevaluasiyangdiperolehdarikegiatan
yang dilakukan secara berkesinambungan, komprehensif, dan transparan
diharapkandapatmemotivasisemuayangterlibatdalamprogramPKGURUuntuk
terus menerus berupaya meningkatkan mutu pelaksanaan program tersebut
sebagai upaya peningkatan profesionalisme guru dalam menunjang peningkatan
kualitaspendidikan.

37

38

BABVI
PENUTUP

PKGURUdilakukanuntukmelihatkinerjagurudalammelaksanakantugasutamanya,yaitu
melaksanakan pembelajaran, pembimbingan dan/atau pelaksanaan tugas lain yang
relevan dengan fungsi sekolah/madrasah. Hasil PK GURU selanjutnya digunakan untuk
membantu guru dalam meningkatkan pengetahuan dan keterampilannya pada
kompetensi tertentu sesuai keperluan. Dengan demikian diharapkan guru akan mampu
berkontribusi secara optimal dalam upaya peningkatan kualitas pembelajaran peserta
didikdansekaligusmembantugurudalampengembangankarirnyasebagaiseorangyang
profesional.Jadi,PKGURUmerupakanbagiandariprosesuntukmeyakinkansemuapihak
bahwasetiapguruadalahseorangyangprofesional,danpesertadidikdapatmemperoleh
kesempatanterbaikuntukdapatberkembangsesuaikapasitasmasingmasing.

Pelaksanaan terintegrasi antara PK GURU dan PKB akan menciptakan guru yang
mempunyai motivasi tinggi, berdedikasi tinggi, terampil dalam membangkitkan minat
pesertadidikuntukmenguasaiilmupengetahuandanteknologi,sertamemilikiintegritas
kepribadian yang tangguh untuk berkompetisi di era global. Diharapkan pedoman
pelaksanaan PK GURU ini dapat menjadi acuan bagi semua pihak yang terkait dengan
pelaksanaanPKGURU.

39

40

LAMPIRAN1
INSTRUMEN
PKGURUKELAS/MATAPELAJARAN

41

Lampiran1A

Lembarpernyataankompetensi,indikator,dancaramenilai
PKGuruKelas/MataPelajaran
Sumber:
Peraturan Menteri Pendidikan nasional16/2007 tentang Standar Kualifikasi
AkademikdanKompetensiGuru
BSNP versi 6.0. 11/2008 Kerangka Indikator untuk Pelaporan Pencapaian Standar
NasionalPendidikan:StandarKualifikasiAkademikdanKompetensiGuru.
Permenegpan dan RB 16/2009 tentang Jabatan Fungsional Guru dan Angka
Kreditnya.

Kompetensi

Caramenilai

Pedagogik
1.

Menguasaikarakteristikpesertadidik.

Pengamatan&Pemantauan

2.

Pengamatan

3.

Menguasasiteoribelajardanprinsipprinsippembelajaranyang
mendidik.
Pengembangankurikulum.

Pengamatan

4.

Kegiatanpembelajaranyangmendidik.

Pengamatan

5.

Pengembanganpotensipesertadidik.

Pengamatan&Pemantauan

6.

Komunikasidenganpesertadidik.

Pengamatan

7.

Penilaiandanevaluasi.

Pengamatan

Kepribadian
8.
9.

Bertindaksesuaidengannormaagama,hukum,sosial,dankebudayaan Pengamatan&Pemantauan
nasional.
Menunjukkanpribadiyangdewasadanteladan.
Pengamatan&Pemantauan

10. EtosKerja,tanggungjawabyangtinggi,rasabanggamenjadi guru.

Pengamatan&Pemantauan

Sosial
11.

Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif.

Pengamatan&Pemantauan

12.

Komunikasidengansesamaguru,tenagakependidikan,orangtua,
pesertadidik,danmasyarakat.
Profesional

Pemantauan

13. Penguasaanmateri,struktur,konsep,danpolapikirkeilmuanyang
mendukungmatapelajaranyangdiampu.
14. MengembangkanKeprofesionalanmelaluitindakanyangreflektif.

Pengamatan
Pemantauan

Keterangan
Pengamatan adalah kegiatan untuk menilai kinerja guru melalui diskusi sebelum pengamatan,
pengamatan selama pelaksanaan proses pembelajaran, dan diskusi setelah
pengamatan.
Pemantauan adalah kegiatan untuk menilai kinerja guru melalui pemeriksaan dokumen,
wawancaradenganguruyangdinilai,dan/atauwawancaradenganwargasekolah.

42

Kompetensi1
Jenisdancaramenilai
Pernyataan

1.
2.
3.
4.
5.
6.

:Mengenalkarakteristikpesertadidik
:KompetensiPedagogik(PengamatandanPemantauan)
: Gurumencatatdanmenggunakaninformasitentangkarakteristikpesertadidik
untuk membantu proses pembelajaran. Karakteristik ini terkait dengan aspek
fisikintelektual,sosialemosional,moral,danlatarbelakangsosialbudaya.
Indikator
Gurudapatmengidentifikasikarakteristikbelajarsetiappesertadidikdikelasnya.
Guru memastikan bahwa semua peserta didik mendapatkan kesempatan yang sama untuk berpartisipasi
aktifdalamkegiatanpembelajaran.
Guru dapat mengatur kelas untuk memberikan kesempatan belajar yang sama pada semua peserta didik
dengankelainanfisikdankemampuanbelajaryangberbeda.
Gurumencobamengetahuipenyebabpenyimpanganperilakupesertadidikuntukmencegahagarperilaku
tersebuttidakmerugikanpesertadidiklainnya.
Gurumembantumengembangkanpotensidanmengatasikekuranganpesertadidik.
Guru memperhatikan peserta didik dengan kelemahan fisik tertentu agar dapat mengikuti aktivitas
pembelajaran,sehinggapesertadidiktersebuttidaktermarginalkan(tersisihkan,diolokolok,minder,dsb).

ProsesPenilaian
SebelumPengamatan:
1. Mintalahdaftarnamapesertadidik.
1.1 Pilihlah 4 (empat) nama peserta didik secara random. Tanyakan bagaimana kemampuan belajar
keempatpesertadidiktersebut.Mintalahbuktihasilulanganterakhirkeempatpesertadidiktersebut.
1.2 Pilihlah 4 (empat) nama peserta didik lain. Tanyakan bagaimana karakteristik keempat peserta didik
tersebut(aktif,pendiam,pemalu,ceria,dsb.).
2. Mintalah guru untuk memilih satu nama peserta didik dengan karakteristik teretntu (misalnya aspek
intelektual).Tanyakanbagaimanacaramembantumengembangkanpotensinyatersebut.
3. Mintalah guru memilih satu nama peserta didik dengan kekurangan tertentu (misalnya aspek sosial).
Tanyakanbagaimanacaramembantupesertadidiktersebutuntukmengatasikelemahannya.
4. Tanyakankepadaguru,apakahdikelasadapesertadidikyangmempunyaikelainanfisiktertentu.Bilaada,
bagaimanacaramemastikanbahwapesertadidiktersebutdapatbelajardenganbaik.
5. Tanyakan kepada guru, apakah barubaru ini ada kejadian luar biasa dalam keluarga peserta didik
(kelahiran, kematian, sedang ada yang sakit, dsb.). Tanyakan apakah hal tersebut berdampak terhadap
pembelajaranpesertadidikyangbersangkutan,danbagaimanamengatasinya.
6. Tanyakankepadaguruapakahadapesertadidikdikelasyangselalumenggangupesertadidiklain.Bilaada,
bagaimanaupayauntukmencegahagarperilakutersebuttidakmerugikanpesertadidiklain.
7. Mintalah guru untuk menjelaskan karakteristik umum kelas yang diajarnya (kelas yang ratarata memiliki
pesertadidikyangcerdas,kreatif,rataratabaikdalammatapelajarantertentu,dsb.).
SelamaPengamatan:
1. Amati apakah guru mengatur posisi tempat duduk peserta didik sesuai dengan kegiatan/aktivitas
pembelajaranyangdilakukan.
2. Amatiapakahguruhanyadiamdidepankelasatauberkelilingmensupervisisemuapesertadidik.
3. Amati apakah selama proses pembelajaran guru melakukan pengecekan secara rutin dengan bertanya
kepadapesertadidiktentangketerbacaanmediabelajaryangdigunakan(termasukpenjelasanpadapapan
tulis).
4. Amatiapakahselamaprosespembelajarangurumelakukanpengecekansecararutinbahwasemuapeserta
didiksecaraaktifmelaksanakantugastugasyangdiberikan.
5. Amatiapakahadapesertadidikyangmelakukankegiatanlaindiluarkegiatanyangseharusnyadilakukan
danbagaimanagurubersikapterhadappesertadidikyangdemikian.
Setelahpengamatan:
1. Tanyakankepadaguruapakahadaalasantertentudaripenempatanpesertadidik(posisitempatduduk)di
dalamkelas(karenapendengaranataupenglihatanyangkurangjelas,karenaperlukonsentrasi,dsb.).
2. Mintalah guru menjelaskan persepsinya tentang hasil pembelajaran peserta didik (apakah sukses, apakah
adaanakyangtidakberpartisipasi,dsb.).
Pemantauan:
Periksa pada awal dan pertengahan semester apakah guru membuat catatan tentang kemajuan dan
perkembanganpesertadidik.

43

Kompetensi2
Jenisdancaramenilai
Pernyataan

1.
2.
3.
4.
5.
6.

:Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik.
:Pedagogik(Pengamatan)
: Guru menetapkan berbagai pendekatan, strategi, metode, dan teknik
pembelajaranyangmendidiksecarakreatifsesuaidenganstandarkompetensi
guru. Guru menyesuaikan metode pembelajaran supaya sesuai dengan
karakteristikpesertadidikdanmemotivasimerekauntukbelajar.
Indikator
Guru memberi kesempatan kepada peserta didik untuk menguasai materi pembelajaran sesuai usia
dankemampuanbelajarnyamelaluipengaturanprosespembelajarandanaktivitasyangbervariasi.
Guruselalumemastikantingkatpemahamanpesertadidikterhadapmateripembelajarantertentudan
menyesuaikanaktivitaspembelajaranberikutnyaberdasarkantingkatpemahamantersebut.
Guru dapat menjelaskan alasan pelaksanaan kegiatan/aktivitas yang dilakukannya, baik yang sesuai
maupunyangberbedadenganrencana,terkaitkeberhasilanpembelajaran.
Gurumenggunakanberbagaiteknikuntukmemotiviasikemauanbelajarpesertadidik.
Gurumerencanakankegiatanpembelajaranyangsalingterkaitsatusamalain,denganmemperhatikan
tujuanpembelajaranmaupunprosesbelajarpesertadidik.
Gurumemperhatikanresponpesertadidikyangbelum/kurangmemahamimateripembelajaranyang
diajarkandanmenggunakannyauntukmemperbaikirancanganpembelajaranberikutnya.

ProsesPenilaian
SebelumPengamatan:
MintalahRPPpadagurudanperiksalahRPPtersebut.
1. Pilihlah satu topik pembelajaran tertentu. Tanyakan bagaimana strategi untuk mencapai tujuan
pembelajaran tersebut, seberapa penting tujuan pembelajaran tersebut, dan bagaimana kaitannya
dengantujuanpembelajaransebelumnya.
2. Tanyakan seberapa jauh kegiatan atau aktivitas pembelajaran yang akan dilaksanakan sesuai dengan
usia,kesiapanbelajar,tingkatpembelajaran,dancarabelajarpsertadidik.
3. Tanyakan alasan yang melatar belakangi penyusunan rencana kegiatan atau rencana aktivitas dalam
RPP.
SelamaPengamatan:
1. Amatiapakahgurumelaksanakanaktivitaspembelajaransecarabervariasi.
2. Amati apakah guru memberi kesempatan kepada semua peserta didik untuk menguasai materi
pembelajaransesuaiusiadankemampuanbelajarnya.
3. Amatiapakahguruselalumemastikantingkatpemahamanpesertadidikterhadapmateripembelajaran
tertentu dan menyesuaikan aktivitas pembelajaran berikutnya berdasarkan tingkat pemahaman
tersebut.
4. Amati apakah guru memanfaatkan berbagai teknik untuk memberikan motivasi kemauan belajar
pesertadidikmelaluipemanfaatanberbagaiteknikpembelajaran.
5. Amati bagaimana guru menghubungkan halhal baru dengan pengetahuan awal yang dimiliki peserta
didik.
6. Amati bagaimana kegiatan yang dilaksanakan dapat membantu peserta didik untuk mencapai tujuan
pembelajaran.
7. Amatibagaimanagurumenanggapiresponpesertadidikterhadapmateriyangsedangdiajarkan.
Setelahpengamatan:
1. Pilihlahsatuaktivitasgurudikelas(yangdiamatipadasaatpengamatan)yangsesuaidenganrencana
pembelajaran. Tanyakan mengapa guru melaksanakan aktivitas tersebut dan bagaimana kaitannya
dengantujuanpembelajaran.
2. Pilihlah satu aktivitas di kelas (yang diamati pada saat pengamatan) yang dilaksanakan berbeda dari
rencanapembelajaran.Tanyakanmengapagurumengubahpelaksanaanpembelajaranmenjadisangat
berbeda dengan rencana semula. Tanyakan pula apakah pengubahan tersebut terkait dengan
keberhasilanpembelajaran.
Pemantauan:

44

Kompetensi3
:Pengembangankurikulum
Jenisdancaramenilai :Pedagogik(Pengamatan)
Pernyataan
: Guru menyusun silabus sesuai dengan tujuan terpenting kurikulum dan
menggunakanRPPsesuaidengantujuandanlingkungan pembelajaran.
Gurumemilih,menyusun,danmenatamateripembelajaranyangsesuai
dengankebutuhanpesertadidik.

Indikator
1. Gurudapatmenyusunsilabusyangsesuaidengankurikulum.
2. Gurumerancangrencanapembelajaranyangsesuaidengansilabusuntukmembahasmateri
ajartertentuagarpesertadidikdapatmencapaikompetensidasaryangditetapkan.
3. Gurumengikutiurutanmateripembelajarandenganmemperhatikantujuanpembelajaran.
4. Gurumemilihmateripembelajaranyang:a)sesuaidengantujuanpembelajaran,b)tepatdan
mutakhir, c) sesuai dengan usia dan tingkat kemampuan belajar peserta didik, d) dapat
dilaksanakandikelasdane)sesuaidengankontekskehidupansehariharipesertadidik.

ProsesPenilaian
SebelumPengamatan:
Periksalah RPP, dan cermati apakah RPP tersebut telah sesuai dengan silabus dalam
kurikulumsekolah.

SelamaPengamatan:
1. Amatiseberapalancar,jelasdanlengkapgurumenyampaikanmateriyangdiajarkannya.
2. Amati bagaimana guru menyesuaikan materi yang dijarkan dengan usia, latar belakang, dan
tingkatpembelajaranpesertadidik.
3. Amati bagaimana guru menghubungkan materi yang diajarkan dengan lingkungan dan
kehidupansehariharipesertadidik.
4. Amatiapakahmateriyangdiajarkanguruadalahmateriyangmutakhir.
5. Amati apakah kegiatan/aktifitas pembelajaran yang dilaksanakan guru mencakup berbagai
tipepembelajaransiswa.
6. Amati bagaimana guru membantu mengembangkan kemampuan atau keterampilan
generiknya(kreatifitas,berpikirkritis,berpikirinovatif,danpemecahanmasalah,dsb):Berapa
jauh pengetahuan atau keterampilan generik tersebut tercakup dalam mata pelejaran
tersebut.

Setelahpengamatan:
Meminta guru menjelaskan bagaimana dia memanfaatkan hasil pembelajaran yang
dilaksanakannyauntukmengembangkantopikmatapelajaranberikutnya.

Pemantauan:

45

Kompetensi4
:KegiatanPembelajaranyangMendidik
Jenisdancaramenilai :Pedagogik(Pengamatan)
Pernyataan
:Guru menyusun dan melaksanakan rancangan pembelajaran yang
mendidik secara lengkap. Guru melaksanakan kegiatan pembelajaran
yang sesuai dengan kebutuhan peserta didik. Guru menyusun dan
menggunakanberbagaimateripembelajarandansumberbelajarsesuai
dengan karakteristik peserta didik. Jika relevan, guru memanfaatkan
teknologiinformasikomunikasi(TIK)untukkepentinganpembelajaran.
Indikator
Guru melaksanakan aktivitas pembelajaran sesuai dengan rancangan yang telah disusun secara lengkap dan pelaksanaan
aktivitastersebutmengindikasikanbahwagurumengertitentangtujuannya.
2. Guru melaksanakan aktivitas pembelajaran yang bertujuan untuk membantu proses belajar peserta didik, bukan untuk
mengujisehinggamembuatpesertadidikmerasatertekan.
3. Gurumengkomunikasikaninformasibaru(misalnyamateritambahan)sesuaidenganusiadantingkatkemampuanbelajar
pesertadidik.
4. Guru menyikapi kesalahan yang dilakukan peserta didik sebagai tahapan proses pembelajaran, bukan sematamata
kesalahan yang harus dikoreksi. Misalnya: dengan mengetahui terlebih dahulu peserta didik lain yang setuju/tidak setuju
denganjawabantersebut,sebelummemberikanpenjelasantentangjawabanygbenar.
5. Gurumelaksanakankegiatanpembelajaransesuaiisikurikulumdanmengkaitkannyadengankontekskehidupanseharihari
pesertadidik.
6. Guru melakukan aktivitas pembelajaran secara bervariasi dengan waktu yang cukup untuk kegiatan pembelajaran yang
sesuaidenganusiadantingkatkemampuanbelajardanmempertahankanperhatianpesertadidik.
7. Gurumengelolakelasdenganefektiftanpamendominasiatausibukdengankegiatannyasendiriagarsemuawaktupeserta
dapattermanfaatkansecaraproduktif.
8. Gurumampumenyesuaikanaktivitaspembelajaranyangdirancangdengankondisikelas.
9. Guru memberikan banyak kesempatan kepada peserta didik untuk bertanya, mempraktekkan dan berinteraksi dengan
pesertadidiklain.
10. Gurumengaturpelaksanaanaktivitaspembelajaransecarasistematisuntukmembantuprosesbelajarpesertadidik.Sebagai
contoh:gurumenambahinformasibarusetelahmengevaluasipemahamanpesertadidikterhadapmaterisebelumnya.
11. Gurumenggunakanalatbantumengajar,dan/atauaudiovisual(termasukTIK)untukmeningkatkanmotivasibelajarpeserta
didikdalammencapaitujuanpembelajaran.
1.

ProsesPenilaian
SebelumPengamatan:
MintalahRPPpadagurudanperiksalahRPPtersebut.
1. Tanyakantentangtopikdankegiatanpembelajaranyangakandilakukan.Tanyakanapakahkemungkinanakanadakesulitan
dalammembahastopiktersebutuntukmencapaitujuanyangditetapkan.
2. Bila ada peserta didik yang mengalami kesulitan untuk memahami materi tersebut, bagaimana strategi guru untuk
mengatasinya.
3. Tanyakanbagaimanacaramenentukantingkatpemahamanpesertadidikterhadaptopiktsb.
SelamaPengamatan:
1. Amati apakah guru menyesuaikan kemampuan peserta untuk berkonsentrasi dalam menerima pelajaran sesuai dengan
tingkatperkembangannya
2. Amati apakah semua kegiatan yang dilaksanakan dalam pembelajaran dapat membantu peserta didik untuk mencapai
tujuanpembelajaran
3. Amatibagaimanagurumengelolaaktifitas(misalnyaapakahwaktunyasesuaidenganRPPatauyangdirencanakan,apakah
gurumelaksanakanpembelajaransesuai/tidakdgtujuanpembelajaranygdirencanakan
4. Amatiseberapalamawaktuyangdigunakanolehpesertadidikuntukmelaksanakankegiatan/aktifitaspembelajaranuntuk
menghasilkansesuatuyangbersifatproduktif,danberapalamapesertadidikhanyamenerimaketerangan,informasiatau
instruksidarigurudalampembelajarannya
5. Amati bagaimana guru membantu setiap peserta didik untuk melakukan kegiatannya masingmasing, apakah ada peserta
didikygtidakterlibataktifdlmpembelajarannya&bagaimanagurumenanganipesertadidiktsb.
6. Amati bagaimana guru menggunakan media pembelajaran tersebut di bawah ini, apakah sesuai dengan tujuan
pembelajaran, apakah dapat membantu cara belajar atau memotivisai peserta didik, serta seberapa terampil guru
menggunakannya.a)Papantulis;b)Gambardan/ataubahantercetak;c)Alatbantuvideovisual;c)Komputer/TIK;dand)
Medialainnya.
Setelahpengamatan:
Mintalah guru untuk menjelaskan seberapa jauh tingkat keberhasilan dalam pembelajaran yang dilaksanakan, dan
mengidentifikasikanbagianapayangperludiperbaiki.
Pemantauan:

46

Kompetensi5

Jenisdancaramenilai

:Memahamidanmengembangkanpotensi
:Pedagogik(PengamatandanPemantauan)

Pernyataan

1.
2.
3.
4.
5.
6.
7.

:Guru menganalisis potensi pembelajaran setiap peserta didik dan


mengidentifikasi pengembangan potensi peserta didik melalui program
pembelajaran yang mendukung siswa mengaktualisasikan potensi akademik,
kepribadian, dan kreativitasnya sampai ada bukti jelas bahwa peserta didik
mengaktualisasikanpotensimereka.
Indikator
Gurumenganalisishasilbelajarberdasarkansegalabentukpenilaianterhadapsetiappesertadidikuntuk
mengetahuitingkatkemajuanmasingmasing.
Gurumerancangdanmelaksanakanaktivitaspembelajaranyangmendorongpesertadidikuntukbelajar
sesuaidengankecakapandanpolabelajarmasingmasing.
Guru merancang dan melaksanakan aktivitas pembelajaran untuk memunculkan daya kreativitas dan
kemampuanberfikirkritispesertadidik.
Guru secara aktif membantu peserta didik dalam proses pembelajaran dengan memberikan perhatian
kepadasetiapindividu.
Gurudapatmengidentifikasidenganbenartentangbakat,minat,potensi,dankesulitanbelajarmasing
masingpesertadidik.
Guru memberikan kesempatan belajar kepada peserta didik sesuai dengan cara belajarnya masing
masing.
Gurumemusatkanperhatianpadainteraksidenganpesertadidikdanmendorongnyauntukmemahami
danmenggunakaninformasiyangdisampaikan.

ProsesPenilaian
SebelumPengamatan:
Periksadaftarhadir,pilih4(empat)namapesertadidiksecaraacak,danmintalahgurumenerangkanhal
halberikut:
1. Bagaimanagurudapatmenunjukkankekuatandankelemahanbelajarpesertadidik(misalnyamelalui
pengamatansikappesertadidikterhadapmateriataumatapelajarantertentu).
2. Tindakan apa yang dilakukan guru untuk mengembangkan kekuatan dan mengatasi kelemahan
tersebut.
3. ApakahpesertadidiktersebutpernahmendapatlayanankhususdariguruBK.
SelamaPengamatan:
1. Amati seberapa jauh guru memperhatikan setiap peserta didik, apakah guru hanya memberikan
perhatiankepadapesertadidikyangmemilikikelebihantertentusaja.
2. Amatibagaimanagurumenyakinkansetiappesertadidikterlibatsecaraaktifdalampembelajaran.
3. Amatiseberapajauhgurumemberikanperhatianterhadapkontribusiyangdiberikanolehpesertadidik
dan berapa banyak kesempatan yang diberikan kepada peserta didik untuk menyampaikan
pemikiran/pendapatnya.
4. Amatibagaimanagurumemotivasipesertadidikuntukbertanyatentanghalhalyangberkaitandengan
topikyangdibahas.
5. Amatibagaimanagurumemotivasipesertadidikuntukmengembangkanpemikirandanpengalamannya
yangmelebihipengetahuandanpengalamandilingkungandankehidupanseharihari.
Setelahpengamatan:
1. Mintalahgurumenjelaskanapakahadatindaklanjutyangakandilakukankarenatopiktersebutmenarik
atausulit,danbagaimanamelanjutkannya.
2. Mintalah guru menjelaskan apakah ada peserta didik yang pernah mendapat perhatian khusus untuk
mengembangkanpotensinyadanmanfaatnyauntukperbaikanRPP.
Pemantauan:
Periksaapakahgurumemilikidokumententangkemajuanbelajarsetiappesertadidik.

47

Kompetensi6
:KomunikasidenganPesertaDidik
Jenisdancaramenilai :Pedagogik(Pengamatan)
Pernyataan
:Guru berkomunikasi secara efektif, empatik dan santun dengan peserta
didik dan bersikap antusias dan positif. Guru memberikan respon yang
lengkapdanrelevankepadakomentarataupertanyaanpesertadidik.
1.

2.

3.
4.
5.
6.

Indikator
Gurumenggunakanpertanyaanuntukmengetahuipemahamandanmenjagapartisipasipesertadidik,
termasukmemberikanpertanyaanterbukayangmenuntutpesertadidikuntukmenjawabdenganide
danpengetahuanmereka.
Gurumemberikanperhatiandanmendengarkansemuapertanyaandantanggapanpesertadidik,tanpa
menginterupsi,kecualijikadiperlukanuntukmembantuataumengklarifikasipertanyaan/tanggapan
tersebut.
Gurumenanggapipertanyaanpesertadidiksecaratepat,benar,danmutakhir,sesuaitujuan
pembelajarandanisikurikulum,tanpamempermalukannya.
Gurumenyajikankegiatanpembelajaranyangdapatmenumbuhkankerjasamayangbaikantarpeserta
didik.
Gurumendengarkandanmemberikanperhatianterhadapsemuajawabanpesertadidikbaikyangbenar
maupunyangdianggapsalahuntukmengukurtingkatpemahamanpesertadidik.
Gurumemberikanperhatianterhadappertanyaanpesertadidikdanmeresponnyasecaralengkapdan
relevanuntukmenghilangkankebingunganpadapesertadidik.

ProsesPenilaian
SebelumPengamatan:
Mintalahgurumenjelaskanbagaimanamendoronginteraksiaktifantarpesertadidik
SelamaPengamatan:
1. Amatiberapalamawaktuyangdigunakanoleh:
a) guruuntukberbicaradikelas;
b) guruuntukberbicarakepadapesertadidiksecaraindividu;
c) pesertadidikuntukmenjawabpertanyaanguru;
d) pesertadidikuntukmemulaiberinterkasidenganguru;
e) pesertadidikuntukbekerjabersamasama;
f) pesertadidikuntukbekerjamandiri.
2. Amatisaatpesertadidikbekerjadalamkelompok,berapabanyakanggotanya,danapakahsetiap
anggotakelompokmemilikiwaktuyangcukupuntukberpatisipasisecaraaktifdalamkegiatanyang
sedangdilakukan.
3. Amatibagaimanagurumemastikanpesertadidikyangdudukdibelakangataudisampingkanankiri
kelasuntukberpartisipasiaktifdalamprosespembelajaran.
4. Amativariasipertanyaanyangdigunakanguru(apakahpertanyaantersebuthanyauntukanakyang
pandaiataumencakupjugauntukanakyangkurangpandai).
5. Cermatiseberapabanyakpertanyaanterbukayangdisampaikanolehgurudibandingkanpertanyaan
yangtelahdiketahuijawabannya.
6. Amatibagaimanacaragurumemilihpesertadidikyangakanmenjawabpertanyaantersebut.
7. Amatibagaimanagurumeresponjawabanpesertadidikdanberapaseringgurumendorongpeserta
didikuntukbekerjasamadalammenjawabpertanyaan.
Setelahpengamatan:
Memintagurumenjelaskantentangpersepsinyaberkaitandenganefektifitaskomunikasiyangterjadi
selamaprosespembelajaran,misalnyapertanyaandaripesertadidikcukupbanyak.
Pemantauan:

48

Kompetensi7
:PenilaiandanEvaluasi
Jenisdancaramenilai :Pedagogik(Pengamatan)
Pernyataan

:Guru menyelenggarakan penilaian proses dan hasil belajar secara


berkesinambungan.Gurumelakukanevaluasiatasefektivitasprosesdan
hasil belajar dan menggunakan informasi hasil penilaian dan evaluasi
untukmerancangprogramremedialdanpengayaan.Gurumenggunakan
hasilanalisispenilaiandalamprosespembelajarannya.

Indikator
1.

Guru menyusun alat penilaian yang sesuai dengan tujuan pembelajaran untuk mencapai kompetensi
tertentusepertiyangtertulisdalamRPP.
2. Guru melaksanakan penilaian dengan berbagai teknik dan jenis penilaian, selain penilaian formal yang
dilaksanakansekolah,danmengumumkanhasilsertaimplikasinyakepadapesertadidik,tentangtingkat
pemahamanterhadapmateripembelajaranyangtelahdanakandipelajari.
3. Guru menganalisis hasil penilaian untuk mengidentifikasi topik/kompetensi dasar yang sulit sehingga
diketahui kekuatan dan kelemahan masingmasing peserta didik untuk keperluan remedial dan
pengayaan.
4. Guru memanfaatkan masukan dari peserta didik dan merefleksikannya untuk meningkatkan
pembelajaranselanjutnya,dandapatmembuktikannyamelaluicatatan,jurnalpembelajaran,rancangan
pembelajaran,materitambahan,dansebagainya.
5. Guru memanfatkan hasil penilaian sebagai bahan penyusunan rancangan pembelajaran yang akan
dilakukanselanjutnya.

ProsesPenilaian
SebelumPengamatan:
1. MemintaguruuntukmenyediakanRPPdanalatpenilaian.Periksaapakahalatpenilaiansesuaidengan
tujuanpembelajaran.Mintalahgurumenjelaskanbagaimanamemanfaatkanperangkattersebutuntuk
merencanakan,memonitorkemajuandanperkembanganpesertadidikdalampembelajarannya.
2. Memintagurumenjelaskanberbagaiteknikdanjenispenilaianyangpernahdilakukan.
SelamaPengamatan:

SetelahPengamatan:
1. Meminta guru menjelaskan bagaimana cara memperoleh masukan balik tentang pengajarannya
(misalnyaevaluasiolehpesertadidik,komentardaritemansekerja,refleksidiri,dsb).
2. Memintagurumenunjukkanhasilanalisispenilaiandanmenunjukkantopikkempetensiyangsulituntuk
keperluanremedial.
3. Bagaimana guru mengkomunikasikan hasil penilaian kepada peserta didik dan menunjukkan materi
pembelajaranyangbelumdikuasaipesertadidik.
4. Bagaimanagurumendeskripsikandanmemanfaatkanhasilanalisispenilaianuntukmerencanakandan
melaksanakanpembelajaranberikutnya.
Pemantauan:

49

Kompetensi8

: Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaan
nasionalIndonesia
Jenisdancaramenilai : Kepribadian(PengamatandanPemantauan)
Pernyataan
: GurubertindaksesuaidenganhukumdiIndonesia.Semuakegiatanyang
dilaksanakan oleh guru mengindikasikan penghargaanya terhadap
berbagai keberagaman agama, keyakinan yang dianut, suku, adat
istiadat daerah asal, latar belakang sosial ekonomi, dan/atau tampilan
fisik.
Indikator
1.
2.
3.
4.
5.

Guru menghargai dan mempromosikan prinsipprinsip Pancasila sebagai dasar ideologi dan etika bagi
semuawargaIndonesia.
Guru mengembangkan kerjasama dan membina kebersamaan dengan teman sejawat tanpa
memperhatikanperbedaanyangada(misalnya:suku,agama,dangender).
Guru saling menghormati dan menghargai teman sejawat sesuai dengan kondisi dan keberadaan
masingmasing.
GurumemilikirasapersatuandankesatuansebagaibangsaIndonesia.
Guru mempunyai pandangan yang luas tentang keberagaman bangsa Indonesia (misalnya: budaya,
suku,agama).

ProsesPenilaian
SebelumPengamatan:
BagaimanapandangangurutentangkeberagamanbangsaIndonesia(misalnya:budaya,suku,agama).

SelamaPengamatan:

SetelahPengamatan:

Pemantauan:
Penilai mewawancarai warga sekolah (teman sejawat, peserta didik, orang tua, dan tenaga kependidikan
lainnya),danmemintapenjelasandancontohtentangperilakudanreputasiguruyangdinilaiterkaitdengan:
1. bagaimanagurumemahamiprinsipprinsipPancasilasebagaidasarideologidanetikabagisemuawarga
Indonesia;
2. bagaimana sikap guru dalam pergaulan seharihari (menghormati, menghargai, dan membantu satu
sama lain, sesuai dengan kondisi dan keberadaan masingmasing, bangga sebagai bangsa Indonesia);
dan
3. bagaimanapandangangurutentangkeberagamanbangsaIndonesia(misalnya:budaya,suku,agama).

50

Kompetensi9
:Menunjukkanpribadiyangdewasadanteladan
Jenisdancaramenilai :Kepribadian(PengamatandanPemantauan)
Pernyataan

: Guru menampilkan diri sebagai teladan bagi peserta didik dan


masyarakat. Guru dihormati oleh peserta didiknya dan oleh anggota
masyarakatsekitarnya,termasukorangtuasiswa.
Indikator
1.
2.
3.

4.
5.

Gurubertingkahlakusopandalamberbicara,berpenampilan,danberbuatterhadapsemuapeserta
didik,orangtua,dantemansejawat.
Gurumaumembagipengalamannyadengankolega,termasukmengundangmerekauntuk
mengobservasicaramengajarnyadanmemberikanmasukan.
Gurumampumengelolapembelajaranyangmembuktikanbahwagurudihormatiolehpesertadidik,
sehinggasemuapesertadidikselalumemperhatikangurudanberpartisipasiaktifdalamproses
pembelajaran.
Gurubersikapdewasadalammenerimamasukandaripesertadidikdanmemberikankesempatan
kepadapesertadidikuntukberpartisipasidalamprosespembelajaran.
Guruberperilakubaikuntukmencitrakannamabaiksekolah.

ProsesPenilaian
SebelumPengamatan:

SelamaPengamatan:
1. Amatibagaimanaguruberbicaradanbersikapterhadappesertadidiknya(misalnyaapakahsesuai
denganusia,tidakmerendahkandiripesertadidik,santun,dsb.).
2. Amatibagaimanapesertadidikberbicaradanbersikapterhadapgurunya(misalnyasopan,santun,
terbuka,apakahpesertadidikselalumemperhatikanguruwaktuberbicara,selalumelaksanakan
petunjukguru,apakahguruperlumedisiplinkanpesertadidiknya,dsb.).
3. Amatibagaimanagurumemastikansetiappesertadidikmelakukantugasdanberpartisipasiaktifdalam
pembelajarannya.

SetelahPengamatan:

Pemantauan:
Penilaimelakukanwawancaradengankepalasekolah,wakilkepalasekolahdan/ataukoordinatorPKB
tentang:
1. kehadirangurudisekolahdandikelas(apakahselaluhadirsesuaijammengajarnya,apakahselalu
masukkelastepatwaktu,dsb.);
2. apakahgurumemenuhitugasnonpembelajarannyadanbagaimanagurumempersiapkantugastugas
tersebut(misalnyaapakahhasiltesdikembalikankepadapesertadidiktepatwaktu,apakahrajin
melakukansupervisikegiatanekstrakurikulum,dsb),danapakahpekerjaannyasesuaidenganstandar
yangdiharapkanolehsekolah;
3. bagaimanaguruberbagipengalamankeberhasilandalampembelajarandengantemansejawat;dan
4. bagaimanagurubekerjasebagaianggotakelompokdalamkomunitassekolahtermasukdalamkegiatan
KKG/MGMP.

51

Kompetensi10
:Etoskerja,tanggungjawabyangtinggi,rasabanggamenjadiguru
Jenisdancaramenilai :Kepribadian(PengamatandanPemantauan)
Pernyataan

:Guru berperilaku sesuai dengan kode etik profesi guru. Guru


melaksanakan
tugasnya
sesuai
dengan
harapan
kepala
sekolah/madrasah dan komite sekolah/madrasah. Semua kegiatan guru
memperhatikan kebutuhan peserta didik, teman sekerja, dan tujuan
sekolah.
Indikator
1. Gurumengawalidanmengakhiripembelajarandengantepatwaktu.
2. Jikaguruharusmeninggalkankelas,gurumengaktifkansiswadenganmelakukanhalhalproduktifterkait
denganmatapelajaran,danmemintagurupiketataugurulainuntukmengawasikelas.
3. Guru memenuhi jam mengajar dan dapat melakukan semua kegiatan lain di luar jam mengajar
berdasarkanijindanpersetujuanpengelolasekolah.
4. Gurumemintaijindanmemberitahulebihawal,denganmemberikanalasandanbuktiyangsahjikatidak
menghadirikegiatanyangtelahdirencanakan,termasukprosespembelajarandikelas.
5. Guru menyelesaikan semua tugas administratif dan nonpembelajaran dengan tepat waktu sesuai
standaryangditetapkan.
6. Guru memanfaatkan waktu luang selain mengajar untuk kegiatan yang produktif terkait dengan
tugasnya.
7. Guru memberikan kontribusi terhadap pengembangan sekolah dan mempunyai prestasi yang
berdampakpositifterhadapnamabaiksekolah.
8. Gurumerasabanggadenganprofesinyasebagaiguru.

ProsesPenilaian
Sebelumpengamatan:
SelamaPengamatan:
Amati apakah guru memiliki materi tambahan sesuai dengan tujuan pembelajaran yang dapat
dipergunakanolehgurupiketapabilagurubersangkutanharusmelakukantugaslain.
Setelahpengamatan:
Pemantauan:
1. Duakalidalamsatusemester,penilaimelakukankunjungankekelasdiawal,ditengahdandiakhirjam
pelajaranyangmengamati:
1.1.apakahgurutepatwaktudalammengawalidanmengakhirikelasnya;dan
1.2.apakahpesertadidiknyatetapmelakukantugastugasmerekasesuaidenganjadwal.
2. Duakalidalamsatusemesterpenilaibertanyakepadapesertadidik,diantaranya:
1.1.apakahguruyangbersangkutanpernahtidakhadir
1.2.jikagurutidakhadir,kegiatanapayangdilakukanolehpesertadidik.
3. Dalam wawancara dengan warga sekolah (teman sejawat, peserta didik, orang tua, dan tenaga
kependidikanlainnya,koordinatorPKB),penilaimemintamerekauntukmenjelaskanperilakuguruyang
dinilaiterhadaptugastugasnonpembelajaran.

52

Kompetensi11
:Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif.
Jenisdancaramenilai :Sosial(PengamatandanPemantauan)
Pernyataan
:Guru menghargai peserta didik, orang tua peserta didik dan teman
sejawat. Guru bertindak inklusif, serta tidak diskriminatif terhadap
pesertadidik,temansejawat,danmasyarakatsekitar.Gurumenerapkan
metode pembelajaran yang memfasilitasi pembelajaran semua peserta
didik.
Indikator
1.
2.
3.

Guru memperlakukan semua peserta didik secara adil, memberikan perhatian dan bantuan sesuai
kebutuhanmasingmasing,tanpamemperdulikanfaktorpersonal.
Guru menjaga hubungan baik dan peduli dengan teman sejawat (bersifat inklusif), serta berkontribusi
positifterhadapsemuadiskusiformaldaninformalterkaitdenganpekerjaannya.
Guruseringberinteraksidenganpesertadidikdantidakmembatasiperhatiannyahanyapadakelompok
tertentu(misalnya:pesertadidikyangpandai,kaya,berasaldaridaerahyangsamadenganguru).

ProsesPenilaian
SebelumPengamatan:

SelamaPengamatan:
1. Amatibagaimanagurumembagiwaktunyadalamberinteraksidenganpesertadidik,baiksecaraindividu
maupunkelompok.
2. Amati bagaimana guru melakukan interaksi (bertanya, berdiskusi, dsb) dengan peserta didik untuk
menarikperhatianseluruhpesertadidikdikelas.
3. Amatibagaimanagurumenghargaiprosesdanhasilkerjapesertadidikyangdianggapbaik.
4. Amatibagaimanagurumenanganipersainganyangtidaksehatantarpesertadidik.
5. Amati bagaimana guru manangani peserta didik yang melakukan tindakan negatif terhadap peserta
didiklainnya(misalnyadiskriminasietnik,gender,agama,dsb.).
6. Amati apakah guru memberikan perhatian yang sama terhadap setiap peserta didik, atau hanya
memberikanperhatianterhadappesertadidikataukelompokpesertadidiktertentu.

SetelahPengamatan:

Pemantauan:
1. Tanyakankepadakepalasekolah,wakilkepalasekolah,ataukoordinatorPKBtentang:
1.1.hubungandankepedulianguruterhadaptemansejawatdanorangtuapesertadidik;dan
1.2.kontribusigurudalamberbagaidiskusiformaldaninformalterkaitdenganpekerjaannya.

53

Kompetensi12

:Komunikasi dengan sesama guru, tenaga kependidikan, orang tua


pesertadidik,danmasyarakat.
Jenisdancaramenilai :Sosial(Pemantauan)
Pernyataan
:Guru berkomunikasi secara efektif baik lisan maupun tulisan dengan
orang tua peserta didik dan masyarakat. Guru menyediakan informasi
resmi(baiklisanmaupuntulisan)kepadaorangtuapesertadidiktentang
programpembelajarandankemajuanpesertadidik(sekurangkurangnya
dua kali dalam setahun). Guru berpartisipasi dalam kegiatan kerjasama
antara sekolah dan masyarakat dan berkomunikasi dengan komunitas
profesidanberpartisipasidalamkegiatanyangrelevan.
Indikator

1.

2.
3.

Guru menyampaikan informasi tentang kemajuan, kesulitan, dan potensi peserta didik kepada orang
tuanya,baikdalampertemuanformalmaupuntidakformalantaragurudanorangtua,temansejawat,
dandapatmenunjukkanbuktinya.
Guru ikut berperan aktif dalam kegiatan di luar pembelajaran yang diselenggarakan oleh sekolah dan
masyarakatdandapatmemberikanbuktikeikutsertaannya.
Guru memperhatikan sekolah sebagai bagian dari masyarakat, berkomunikasi dengan masyarakat
sekitar,sertaberperandalamkegiatansosialdimasyarakat.

ProsesPenilaian
SebelumPengamatan:

SelamaPengamatan:

SetelahPengamatan:

Pemantauan:
1. Penilai meminta guru menyediakan dokumen/catatan tentang pertemuan guru dengan orang tua
berkaitandengankemajuan,kesulitan,danpotensipesertadidik.Cermatidancatataspekspesifikyang
telahdilakukanguruterkaitdenganhalhaltersebut.
2. Penilaimemintagurumenyediakandokumen/catatanyangmembuktikankerjasamanyadenganteman
sejawat dan/atau tenaga kependidikan untuk membantu peserta didik yang membutuhkan layanan
khusus(misalnyalayananBKdenganguruBK,layananadministrasidengantenagakependidikan,dsb).
3. Tanyakankepadatemansejawatdan/atauorangtuapesertadidiktentangperilaku,sikap,ataukegiatan
guruyangberhubungandengankegiatannonpembelajaran.

54

Kompetensi13

:Penguasaanmateristrukturkonsepdanpolapikirkeilmuanyangmen
dukungmatapelajaranyangdiampu.
Jenisdancaramenilai :Profesional(Pengamatan)
Pernyataan
: Rancangan, materi dan kegiatan pembelajaran, penyajian materi baru
dan respon guru terhadap peserta didik memuat informasi pelajaran
yang tepat dan mutakhir. Pengetahuan ini ditampilkan sesuai dengan
usia dan tingkat pembelajaran peserta didik. Guru benarbenar
memahami mata pelajaran dan bagaimana mata pelajaran tersebut
disajikandidalamkurikulum.Gurudapatmengatur,menyesuaikandan
menambah aktifitas untuk membantu peserta didik menguasai aspek
aspek penting dari suatu pelajaran dan meningkatkan minat dan
perhatianpesertadidikterhadappelajaran.
Indikator

1.

2.
3.

Guru melakukan pemetaan standar kompetensi dan kompetensi dasar untuk mata pelajaran yang
diampunya, untuk mengidentifikasi materi pembelajaran yang dianggap sulit, melakukan perencanaan
danpelaksanaanpembelajaran,danmemperkirakanalokasiwaktuyangdiperlukan.
Guru menyertakan informasi yang tepat dan mutakhir di dalam perencanaan dan pelaksanaan
pembelajaran.
Gurumenyusunmateri,perencanaandanpelaksanaanpembelajaranyangberisiinformasiyangtepat,
mutakhir,danyangmembantupesertadidikuntukmemahamikonsepmateripembelajaran.

ProsesPenilaian
SebelumPengamatan:
Cermati RPP. Pelajari apakah materi yang tercakup dalam RPP merupakan materi yang tepat dan
mutakhir.
SelamaPengamatan:
1. Amati apakah guru menguasai, terampil dan lancar dalam melaksanakan kegiatan pembelajaran atau
apakahguruharusseringmenggunakancatatanataubukuuntukmenyampaikanpembelajaran.
2. Amati apakah guru melaksanakan kegiatan pembelajaran berdasarkan kerangka topik yang dibahas,
apakahgurudapatmengidentifikasibagianbagianyangpentingatautidakdaritopiktersebut.
3. Amatiapakahgurumengetahuitopiktopiktertentuyangmungkinsulitdipahamiolehpesertadidikdan
memerlukanpengulangansecarabervariasi.
4. Amati bagaimana guru merespon pertanyaan atau pendapat peserta didik (apakah guru mau
mendengar,menghargaidanmeresponsecaratepatdanbenarpertanyaandanpendapatpesertadidik).
5. Amatibagaimanagurumenanggapipertanyaanatautanggapanpesertadidikyangtidakrelevandengan
tujuanpembelajaran.
6. Amati berapa lama guru menanggapi pertanyaan atau tanggapan peserta didik tertentu tanpa
mengabaikanpesertadidiklainnya.
Setelahpengamatan:
Pemantauan:

55

Kompetensi14
:Mengembangkankeprofesianmelaluitindakanreflektif
Jenisdancaramenilai :Profesional(Pemantauan)
Pernyataan

: Guru melakukan refleksi terhadap kinerja sendiri secara terus menerus


danmemanfaatkanhasilrefleksiuntukmeningkatkankeprofesian.Guru
melakukan penelitian tindakan kelas dan mengikuti perkembangan
keprofesian melalui belajar dari berbagai sumber, guru juga
memanfaatkan TIK dalam berkomunikasi dan pengembangan
keprofesianjikadimungkinkan.

Indikator
1. Guru melakukan evaluasi diri secara spesifik, lengkap, dan didukung dengan contoh
pengalamandirisendiri.
2. Gurumemilikijurnalpembelajaran,catatanmasukandaritemansejawatatauhasilpenilaian
prosespembelajaransebagaibuktiyangmenggambarkankinerjanya.
3. Guru memanfaatkan bukti gambaran kinerjanya untuk mengembangkan perencanaan dan
pelaksanaan pembelajaran selanjutnya dalam program Pengembangan Keprofesian
Berkelanjutan(PKB).
4. Guru dapat mengaplikasikan pengalaman PKB dalam perencanaan, pelaksanaan, penilaian
pembelajarandantindaklanjutnya.
5. Guru melakukan penelitian, mengembangkan karya inovasi, mengikuti kegiatan ilmiah
(misalnyaseminar,konferensi),danaktifdalammelaksanakanPKB.
6. GurudapatmemanfaatkanTIKdalamberkomunikasidanpelaksanaanPKB.

ProsesPenilaian
Sebelumpengamatan:
SelamaPengamatan:
SetelahPengamatan:

Pemantauan:
1. PenilaimemintagurumenyediakanevaluasidiridanrencanatahunanprogramPKB.
2. Penilai meminta guru menyediakan bukti tentang keikutsertaanya dalam melaksanakan
kegiatanPKB.
3. Penilai meminta guru menjelaskan dampak PKB terhadap pembelajaran dengan contoh atau
buktiyangdapatdipertanggungjawabkan.
4. Penilai meminta guru menyediakan bukti tentang refleksi diri misalnya jurnal pembelajaran,
catatanpentingdalamRPP,dsb.
5. Penilaibertanyakepadaguruapakahpernahmengakseslaman(website)yangterkaitdengan
programPKB,jikayaberikancontohnya.
6. Penilai meminta guru menjelaskan bagaimana memperoleh masukan dari peserta didik
tentang kegiatan pembelajaran (misalnya apakah yang dipelajari menarik, bermanfaat bagi
pesertadidik,sesuaidengankebutuhannya,dsb.).
7. Penilaimemintagurumenjelaskanapakahgurumerupakananggotaprofesitertentu,apakah
guruselaluhadirdalamkegiatankeprofesian:KKG/MGMP,seminar,lokakarya,dsb.
8. Penilai meminta guru menjelaskan tentang perannya dalam kegiatan keprofesian (misalnya
KKG/MGMP, seminar, lokakarya, dsb.), dan apakah hasil kegiatan keprofesian diaplikasikan
dalamkegiatanpembelajarandandiimbaskankepadatemansejawat.
9. Penilai melaksanakan wawancara dengan koordinator PKB dan bertanya bagaimana guru
berpartisipasidalamkegiatanPKB.
10. Penilaimelaksanakanwawancaradenganpengeloladan/ataupesertaKKG/MGMPbagaimana
guru yang dinilai berpartisiapasi dalam kegiatan yang dilaksanakan dalam program
KKG/MGMP.

56

Lampiran1B
LAPORANDANEVALUASI
PENILAIANKINERJAGURUKELAS/GURUMATAPELAJARAN

:____________________________________________(1)

NamaGuru

NIP/NomorSeriKarpeg

Pangkat/GolonganRuang
TerhitungMulaiTanggal

NUPTK/NRG

Namasekolah danalamat

:_______________________/_____________________(2)
:_______________________/_____________________(3)

:____________________________________________(4)
:____________________________________________
____________________________________________(5)

Tanggalmulaibekerja
disekolahini

:____________________________________________(6)

Bulan

Tahun

:_________________sampai___________________(7)
Periodepenilaian

(tanggal,bulan,tahun)
(tanggal,bulan,tahun)

PERSETUJUAN(8)
(Persetujuaniniharusditandatanganiolehpenilaidanguruyangdinilai)

Penilai dan guru yang dinilai menyatakan telah membaca dan mamahami semua aspek yang
ditulis/dilaporkandalamformatinidanmenyatakansetuju.

Namaguru

Namapenilai

Tanda

Tandatangan
tangan

Tanggal
___bulan____tahun_______

57

Kompetensi1 :Mengenalkarakteristikpesertadidik
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(21)
Tindaklanjutyangdiperlukan:

(22)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

58


PenilaianuntukKompetensi1:Mengenalkarakteristikpesertadidik
Skor
Indikator
1. Gurudapatmengidentifikasikarakteristikbelajar
setiappesertadidikdikelasnya.
2. Gurumemastikanbahwasemuapesertadidik
mendapatkankesempatanyangsamauntuk
berpartisipasiaktifdalamkegiatanpembelajaran.
3. Gurudapatmengaturkelasuntukmemberikan
kesempatanbelajaryangsamapadasemua
pesertadidikdengankelainanfisikdan
kemampuanbelajaryangberbeda.
4. Gurumencobamengetahuipenyebab
penyimpanganperilakupesertadidikuntuk
mencegahagarperilakutersebuttidakmerugikan
pesertadidiklainnya.
5. Gurumembantumengembangkanpotensidan
mengatasikekuranganpesertadidik.
6. Gurumemperhatikanpesertadidikdengan
kelemahanfisiktertentuagardapatmengikuti
aktivitaspembelajaran,sehinggapesertadidik
tersebuttidaktermarginalkan(tersisihkan,diolok
olok,minder,dsb.).
Totalskoruntukkompetensi1
Skormaksimumkompetensi1=jumlahindikator2
Persentase=(totalskor/12)100%
Nilaiuntukkompetensi1
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Seluruhnya
bukti(Tidak
sebagian
terpenuhi
terpenuhi)

(26)

(27)
12(28)
(29)

(30)

59

Kompetensi2 :Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)
SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(21)
Tindaklanjutyangdiperlukan:

(22)

60

PenilaianuntukKompetensi2:Menguasaiteoribelajardanprinsipprinsippembelajaran
yangmendidik
Skor
Indikator

Tidakada
bukti
(Tidak
terpenuhi)

Terpenuhi
sebagian

Seluruhnya
terpenuhi

1. Gurumemberikesempatankepadapesertadidik
untukmenguasaimateripembelajaransesuaiusia
0
1
2
dankemampuanbelajarnyamelaluipengaturan
prosespembelajarandanaktivitasyangbervariasi.
2. Guruselalumemastikantingkatpemahamanpeserta
didikterhadapmateripembelajarantertentudan
0
1
2
menyesuaikanaktivitaspembelajaranberikutnya
berdasarkantingkatpemahamantersebut.
3. Gurudapatmenjelaskanalasanpelaksanaan
kegiatan/aktivitasyangdilakukannya,baikyang
0
1
2
sesuaimaupunyangberbedadenganrencana,
terkaitkeberhasilanpembelajaran.
4. Gurumenggunakanberbagaiteknikuntuk
0
1
2
memotiviasikemauanbelajarpesertadidik.
5. Gurumerencanakankegiatanpembelajaranyang
salingterkaitsatusamalain,denganmemperhatikan
0
1
2
tujuanpembelajaranmaupunprosesbelajarpeserta
didik.
6. Gurumemperhatikanresponpesertadidikyang
belum/kurangmemahamimateripembelajaranyang
0
1
2
diajarkandanmenggunakannyauntukmemperbaiki
rancanganpembelajaranberikutnya.
Totalskoruntukkompetensi2
(27)
Skormaksimumkompetensi2=jumlahindikator2
12(28)
Persentase=(totalskor/12)100%
(29)
Nilaiuntukkompetensi2

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

61

(26)

Kompetensi3 :Pengembangankurikulum
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(21)
Tindaklanjutyangdiperlukan:

(22)

62

PenilaianuntukKompetensi3:Pengembangankurikulum
Skor
Indikator

1. Gurudapatmenyusunsilabusyangsesuaidengan
kurikulum.
2. Gurumerancangrencanapembelajaranyangsesuai
dengansilabusuntukmembahasmateriajar
tertentuagarpesertadidikdapatmencapai
kompetensidasaryangditetapkan.
3. Gurumengikutiurutanmateripembelajaran
denganmemperhatikantujuanpembelajaran.
4. Gurumemilihmateripembelajaranyang:a)sesuai
dengantujuanpembelajaran,b)tepatdan
mutakhir,c)sesuaidenganusiadantingkat
kemampuanbelajarpesertadidik,dand)dapat
dilaksanakandikelase)sesuaidengankonteks
kehidupansehariharipesertadidik.
Totalskoruntukkompetensi3
Skormaksimumkompetensi3=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi3
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
bukti
(Tidak
terpenuhi)

Terpenuhi
sebagian

Terpenuhi
seluruhnya

(26)

(27)
8(28)
(29)

(30)

63

Kompetensi4 :KegiatanPembelajaranyangMendidik
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(11)
(12)

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(15)
(16)

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(19)
(20)

(21)
Tindaklanjutyangdiperlukan:

(22)

64

PenilaianuntukKompetensi4:KegiatanPembelajaranyangMendidik
Indikator

Skor
Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. Gurumelaksanakanaktivitaspembelajaransesuaidengan
rancanganyangtelahdisusunsecaralengkapdan
0
1
2
pelaksanaanaktivitastersebutmengindikasikanbahwaguru
mengertitentangtujuannya.
2. Gurumelaksanakanaktivitaspembelajaranyangbertujuan
untukmembantuprosesbelajarpesertadidik,bukanuntuk
0
1
2
mengujisehinggamembuatpesertadidikmerasatertekan.
3. Gurumengkomunikasikaninformasibaru(misalnyamateri
tambahan)sesuaidenganusiadantingkatkemampuan
0
1
2
belajarpesertadidik.
4. Gurumenyikapikesalahanyangdilakukanpesertadidik
sebagaitahapanprosespembelajaran,bukansematamata
kesalahanyangharusdikoreksi.Misalnya:dengan
0
1
2
mengetahuiterlebihdahulupesertadidiklainyangsetuju
atautidaksetujudenganjawabantersebut,sebelum
memberikanpenjelasantentangjawabanyangbenar.
5. Gurumelaksanakankegiatanpembelajaransesuaiisi

kurikulumdanmengkaitkannyadengankontekskehidupan
0
1
2
sehariharipesertadidik.
6. Gurumelakukanaktivitaspembelajaransecarabervariasi
denganwaktuyangcukupuntukkegiatanpembelajaran
0
1
2
yangsesuaidenganusiadantingkatkemampuanbelajardan
mempertahankanperhatianpesertadidik.
7. Gurumengelolakelasdenganefektiftanpamendominasi
atausibukdengankegiatannyasendiriagarsemuawaktu
0
1
2
pesertadapattermanfaatkansecaraproduktif.
8. Gurumampumenyesuaikanaktivitaspembelajaranyang
0
1
2
dirancangdengankondisikelas.
9. Gurumemberikanbanyakkesempatankepadapesertadidik
untukbertanya,mempraktekkandanberinteraksidengan
0
1
2
pesertadidiklain.
10. Gurumengaturpelaksanaanaktivitaspembelajaransecara
sistematisuntukmembantuprosesbelajarpesertadidik.
Sebagaicontoh:gurumenambahinformasibarusetelah
0
1
2
mengevaluasipemahamanpesertadidikterhadapmateri
sebelumnya.
11. Gurumenggunakanalatbantumengajar,dan/atauaudio
visual(termasukTIK)untukmeningkatkanmotivasibelajar
0
1
2
pesertadidikdalammencapaitujuanpembelajaran.
Totalskoruntukkompetensi4
(27)
Skormaksimumkompetensi4=jumlahindikator2
22(28)
Persentase=(totalskor/22)100%
(29)
Nilaiuntukkompetensi4

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

65

(26)

Kompetensi5 :Memahamidanmengembangkanpotensi
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)
SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(21)
Tindaklanjutyangdiperlukan:

(22)

66

Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(23)
(24)

(25)

PenilaianuntukKompetensi5:Memahamidanmengembangkanpotensi
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. Gurumenganalisishasilbelajarberdasarkan
segalabentukpenilaianterhadapsetiappeserta
0
1
2
didikuntukmengetahuitingkatkemajuanmasing
masing.
2. Gurumerancangdanmelaksanakanaktivitas
pembelajaranyangmendorongpesertadidik
0
1
2
untukbelajarsesuaidengankecakapandanpola
belajarmasingmasing.
3. Gurumerancangdanmelaksanakanaktivitas

pembelajaranuntukmemunculkandaya
0
1
2
kreativitasdankemampuanberfikirkritispeserta
didik.
4. Gurusecaraaktifmembantupesertadidikdalam
prosespembelajarandenganmemberikan
0
1
2
perhatiankepadasetiapindividu.
5. Gurudapatmengidentifikasidenganbenar
tentangbakat,minat,potensi,dankesulitan
0
1
2
belajarmasingmasingpesertadidik.
6. Gurumemberikankesempatanbelajarkepada
pesertadidiksesuaidengancarabelajarnya
0
1
2
masingmasing.
7. Gurumemusatkanperhatianpadainteraksi
denganpesertadidikdanmendorongnyauntuk
0
1
2
memahamidanmenggunakaninformasiyang
disampaikan.
Totalskoruntukkompetensi5
(27)
Skormaksimumkompetensi5=jumlahindikator2 14(28)
Persentase=(totalskor/14)100%
(29)
Nilaiuntukkompetensi5

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

(26)

67

Kompetensi6 :Komunikasidenganpesertadidik
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(19)
(20)

(21)
Tindaklanjutyangdiperlukan:

(22)

68


PenilaianuntukKompetensi6:Komunikasidenganpesertadidik
Skor
Indikator
1. Gurumenggunakanpertanyaanuntukmengetahui
pemahamandanmenjagapartisipasipesertadidik,
termasukmemberikanpertanyaanterbukayang
menuntutpesertadidikuntukmenjawabdenganide
danpengetahuanmereka.
2. Gurumemberikanperhatiandanmendengarkan
semuapertanyaandantanggapanpesertadidik,
tanpamenginterupsi,kecualijikadiperlukanuntuk
membantuataumengklarifikasi
pertanyaan/tanggapantersebut.
3. Gurumenanggapinyapertanyaanpesertadidik
secaratepat,benar,danmutakhir,sesuaitujuan
pembelajarandanisikurikulum,tanpa
mempermalukannya.
4. Gurumenyajikankegiatanpembelajaranyangdapat
menumbuhkankerjasamayangbaikantar
pesertadidik.
5. Gurumendengarkandanmemberikanperhatian
terhadapsemuajawabanpesertadidikbaikyang
benarmaupunyangdianggapsalahuntukmengukur
tingkatpemahamanpesertadidik.
6. Gurumemberikanperhatianterhadappertanyaan
pesertadidikdanmeresponnyasecaralengkapdan
relevanuntukmenghilangkankebingunganpada
pesertadidik.
Totalskoruntukkompetensi6
Skormaksimumkompetensi6=jumlahindikator2
Persentase=(totalskor/12)100%
Nilaiuntukkompetensi6
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
Seluruhnya

(26)

(27)
12(28)
(29)

(30)

69

Kompetensi7 :Penilaiandanevaluasi
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketerangangur

(13)
Tindaklanjutyangdiperlukan:

(14)

SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
SetelahPengamatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(21)
Tindaklanjutyangdiperlukan:

(22)

70

PenilaianuntukKompetensi7:Penilaiandanevaluasi
Skor
Indikator
1. Gurumenyusunalatpenilaianyangsesuaidengan
tujuanpembelajaranuntukmencapaikompetensi
tertentusepertiyangtertulisdalamRPP.
2. Gurumelaksanakanpenilaiandenganberbagai
teknikdanjenispenilaian,selainpenilaianformal
yangdilaksanakansekolah,danmengumumkan
hasilsertaimplikasinyakepadapesertadidik,
tentangtingkatpemahamanterhadapmateri
pembelajaranyangtelahdanakandipelajari.
3. Gurumenganalisishasilpenilaianuntuk
mengidentifikasitopik/kompetensidasaryangsulit
sehinggadiketahuikekuatandankelemahan
masingmasingpesertadidikuntukkeperluan
remedialdanpengayaan.
4. Gurumemanfaatkanmasukandaripesertadidik
danmerefleksikannyauntukmeningkatkan
pembelajaranselanjutnya,dandapat
membuktikannyamelaluicatatan,jurnal
pembelajaran,rancanganpembelajaran,materi
tambahan,dansebagainya.
5. Gurumemanfatkanhasilpenilaiansebagaibahan
penyusunanrancanganpembelajaranyangakan
dilakukanselanjutnya.
Totalskoruntukkompetensi7
Skormaksimumkompetensi7=jumlahindikator2
Persentase=(totalskor/10)100%
Nilaiuntukkompetensi7
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

2
(26)

(27)
10(28)
(29)

(30)

71

Kompetensi8 :Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaannasional
Indonesia
NamaGuru
:(9)
NamaPenilai :(10)
SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

72


PenilaianuntukKompetensi8:Bertindaksesuaidengannormaagama,hukum,sosialdan
kebudayaannasionalIndonesia
Skor
Indikator

Terpen
Tidakada
Terpenuhi
uhi
bukti(Tidak
sebagian Seluruh
terpenuhi)
nya

1. Gurumenghargaidanmempromosikanprinsipprinsip
Pancasilasebagaidasarideologidanetikabagisemua
0
1
2
wargaIndonesia.
2. Gurumengembangkankerjasamadanmembina

kebersamaandengantemansejawattanpa
0
1
2
memperhatikanperbedaanyangada(misalnya:suku,
agama,dangender).
3. Gurusalingmenghormatidanmenghargaiteman
sejawatsesuaidengankondisidankeberadaanmasing
0
1
2
masing.
4. Gurumemilikirasapersatuandankesatuansebagai
0
1
2
bangsaIndonesia.
5. Gurumempunyaipandanganyangluastentang
keberagamanbangsaIndonesia(misalnya:budaya,suku,
0
1
2
agama).
Totalskoruntukkompetensi8
(27)
Skormaksimumkompetensi8=jumlahindikator2
10(28)
Persentase=(totalskor/10)100%
(29)
Nilaiuntukkompetensi8

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

73

(26)

Kompetensi9 :Menunjukkanpribadiyangdewasadanteladan
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(13)
Tindaklanjutyangdiperlukan:

(14)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

74


PenilaianuntukKompetensi9:Menunjukkanpribadiyangdewasadanteladan
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. Gurubertingkahlakusopandalamberbicara,
berpenampilan,danberbuatterhadapsemua
0
1
2
pesertadidik,orangtua,dantemansejawat.
2. Gurumaumembagipengalamannyadenganteman
sejawat,termasukmengundangmerekauntuk

0
1
mengobservasicaramengajarnyadanmemberikan
2
masukan.
3. Gurumampumengelolapembelajaranyang
membuktikanbahwagurudihormatiolehpeserta
didik,sehinggasemuapesertadidikselalu
0
1
2
memperhatikangurudanberpartisipasiaktifdalam
prosespembelajaran.
4. Gurubersikapdewasadalammenerimamasukan
daripesertadidikdanmemberikankesempatan
0
1
2
kepadapesertadidikuntukberpartisipasidalam
prosespembelajaran.
5. Guruberperilakubaikuntukmencitrakannama
0
1
2
baiksekolah.
Totalskoruntukkompetensi9
(27)
Skormaksimumkompetensi9=jumlahindikator2
10(28)
Persentase=(totalskor/10)100%
(29)
Nilaiuntukkompetensi9

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

75

(26)

Kompetensi10:Etoskerja,tanggungjawabyangtinggi,danrasabanggamenjadiguru
NamaGuru
:(9)
NamaPenilai :(10)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

76

Penilaian untuk Kompetensi 10: Etos kerja, tanggung jawab yang tinggi, dan rasa bangga
menjadiguru
Skor
Tidakada
Indikator
Terpenuhi Terpenuhi
bukti(Tidak
sebagian seluruhnya
terpenuhi)
1. Gurumengawalidanmengakhiripembelajaran
0
1
2
dengantepatwaktu.
2. Jikaguruharusmeninggalkankelas,guru
mengaktifkansiswadenganmelakukanhalhal
produktifterkaitdenganmatapelajaran,dan
0
1
2
memintagurupiketataugurulainuntuk
mengawasikelas.
3. Gurumemenuhijammengajardandapat
melakukansemuakegiatanlaindiluarjam

0
1
mengajarberdasarkanijindanpersetujuan
2
pengelolasekolah.
4. Gurumemintaijindanmemberitahulebihawal,
denganmemberikanalasandanbuktiyangsah

jikatidakmenghadirikegiatanyangtelah
0
1
2
direncanakan,termasukprosespembelajarandi
kelas.
5. Gurumenyelesaikansemuatugasadministratif
dannonpembelajarandengantepatwaktusesuai
0
1
2
standaryangditetapkan.
6. Gurumemanfaatkanwaktuluangselainmengajar
untukkegiatanyangproduktifterkaitdengan
0
1
2
tugasnya.
7. Gurumemberikankontribusiterhadap
pengembangansekolahdanmempunyaiprestasi
0
1
2
yangberdampakpositifterhadapnamabaik
sekolah.
8. Gurumerasabanggadenganprofesinyasebagai
0
1
2
guru.
Totalskoruntukkompetensi10
(27)
Skormaksimumkompetensi10=jumlahindikator2 16(28)
Persentase=(totalskor/16)100%
Nilaiuntukkompetensi10
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

(29)
(30)

77

(26)

Kompetensi11:Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif
NamaGuru
:(9)
NamaPenilai :(10)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(16)
Tindaklanjutyangdiperlukan:

(17)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi11:Bersikapinklusif,bertindakobjektif,sertatidak
Diskriminatif
Skor
Indikator

Tidakada
Terpenuhi Seluruhnya
bukti(Tidak
sebagian
terpenuhi
terpenuhi)

1. Gurumemperlakukansemuapesertadidiksecaraadil,

memberikanperhatiandanbantuansesuaikebutuhan
0
1
2
masingmasing,tanpamemperdulikanfaktorpersonal.
2. Gurumenjagahubunganbaikdanpedulidengan
temansejawat(bersifatinklusif),sertaberkontribusi
0
1
2
positifterhadapsemuadiskusiformaldaninformal
terkaitdenganpekerjaannya.
3. Guruseringberinteraksidenganpesertadidikdan
tidakmembatasiperhatiannyahanyapadakelompok
0
1
2
tertentu(misalnya:pesertadidikyangpandai,kaya,
berasaldaridaerahyangsamadenganguru).
Totalskoruntukkompetensi11
(27)
Skormaksimumkompetensi11=jumlahindikator2
6(28)
Persentase=(totalskor/6)100%
(29)
Nilaiuntukkompetensi11

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

78

(26)

Kompetensi12:Komunikasidengansesamaguru,tenagapendidikan,orangtuapeserta

didik,danmasyarakat
NamaGuru
:(9)
NamaPenilai :(10)

Pemantauan

Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

Penilaian untuk Kompetensi 12: Komunikasi dengan sesama guru, tenaga pendidikan, orang
tuapesertadidik,danmasyarakat
Skor
Indikator

Tidakada
Terpenuhi Seluruhnya
bukti(Tidak
sebagian
terpenuhi
terpenuhi)

1. Gurumenyampaikaninformasitentangkemajuan,
kesulitan,danpotensipesertadidikkepadaorang

tuanya,baikdalampertemuanformalmaupuntidak
0
1

formalantaragurudanorangtua,temansejawat,
2
dandapatmenunjukkanbuktinya.
2. Guruikutberperanaktifdalamkegiatandiluar
pembelajaranyangdiselenggarakanolehsekolahdan
0
1
2
masyarakatdandapatmemberikanbukti
keikutsertaannya.
3. Gurumemperhatikansekolahsebagaibagiandari
masyarakat,berkomunikasidenganmasyarakat
0
1
2
sekitar,sertaberperandalamkegiatansosialdi
masyarakat.
Totalskoruntukkompetensi12
(27)
Skormaksimumkompetensi12=jumlahindikator2
6(28)
Persentase=(totalskor/6)100%
(29)
Nilaiuntukkompetensi12

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

79

(26)

Kompetensi13:Penguasaanmateristrukturkonsepdanpolapikirkeilmuanyang
mendukungmatapelajaranyangdiampu
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru

(11)
(12)

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(15)
(16)

(17)
Tindaklanjutyangdiperlukan:

(18)

PenilaianuntukKompetensi13:Penguasaanmateristrukturkonsepdanpolapikirkeilmuan
yangmendukungmatapelajaranyangdiampu
Skor
Indikator
1. Gurumelakukanpemetaanstandarkompetensi
dankompetensidasaruntukmatapelajaranyang
diampunya,untukmengidentifikasimateri
pembelajaranyangdianggapsulit,melakukan
perencanaandanpelaksanaanpembelajaran,dan
memperkirakanalokasiwaktuyangdiperlukan.
2. Gurumenyertakaninformasiyangtepatdan
mutakhirdidalamperencanaandanpelaksanaan
pembelajaran.
3. Gurumenyusunmateri,perencanaandan
pelaksanaanpembelajaranyangberisiinformasi
yangtepat,mutakhir,danyangmembantupeserta
didikuntukmemahamikonsepmateri
pembelajaran.
Totalskoruntukkompetensi13
Skormaksimumkompetensi13=jumlahindikator2
Persentase=(totalskor/6)100%
Nilaiuntukkompetensi13
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

2
(26)

(27)
6(28)
(29)

(30)

80

Kompetensi14:Mengembangkankeprofesianmelaluitindakanreflektif
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi14:Mengembangkankeprofesianmelaluitindakanreflektif
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. Gurumelakukanevaluasidirisecaraspesifik,
lengkap,dandidukungdengancontohpengalaman
0
1
2
dirisendiri.
2. Gurumemilikijurnalpembelajaran,catatanmasukan
darikolegaatauhasilpenilaianprosespembelajaran
0
1
2
sebagaibuktiyangmenggambarkankinerjanya.
3. Gurumemanfaatkanbuktigambarankinerjanya
untukmengembangkanperencanaandan
pelaksanaanpembelajaranselanjutnyadalam
0
1
2
programPengembanganKeprofesianBerkelanjutan
(PKB).
4. GurudapatmengaplikasikanpengalamanPKBdalam
perencanaan,pelaksanaan,penilaianpembelajaran
0
1
2
dantindaklanjutnya.
5. Gurumelakukanpenelitian,mengembangkankarya
inovasi,mengikutikegiatanilmiah(misalnyaseminar,
0
1
2
konferensi),danaktifdalammelaksanakanPKB.
6. GurudapatmemanfaatkanTIKdalamberkomunikasi
0
1
2
danpelaksanaanPKB.
Totalskoruntukkompetensi14
(27)
Skormaksimumkompetensi14=jumlahindikator2
12(28)
Persentase=(totalskor/12)100%
(29)
Nilaiuntukkompetensi14

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

81

(26)

PETUNJUKPENGISIANFORMAT1B
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama Pegawai Negeri Sipil yang dinilai sesuai dengan yang tercantum
dalamSKpengangkatanpertamasebagaiCPNS.
2.
(2)
TulislahNomorIndukPegawaidanNomorKarpegPNSyangbersangkutan.
3.
(3)
Tulislah pangkat dan golongan ruang terakhir PNS tersebut terhitung mulai
tanggalberlakunyaSK.
4.
(4)
Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang
merupakanNomorRegistrasibagiPendidikdanTenagaKependidikanpadajalur
pendidikan formal maupun nonformal jenjang pendidikan dasar dan
menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta
Nomor Restgrasi Guru (NRG) setelah yang bersangkutan memiliki sertifikat
pendidik.
5.
(5)
Tulislah dengan jelas Nama Sekolah tempat guru bekerja berikut alamatnya
sebagaiSatuanAdministrasiPangkalguruyangbersangkutan.
6.
(6)
Tulislah sejak kapan guru bekerja pada sekolah sebagai Satuan Admimistrasi
Pangkalyangbersangkutan.
7.
(7)
Tulislah waktu mulai dilakukan penilaian dan akhir pelaksanaan penilaian bagi
gurutersebutpadatahunajarantertentu.
8.
(8)
Tulislah nama guru yang dinilai dan nama penilai yang melakukan penilaian
kinerja guru, selanjutnya tandatangani secara bersama pada ruang yang
tersediasebagaitandapersetujuanbersamaterhadaphasilpenilaian,sertatulis
tanggalbulandantahunsaatmenyatakanpersetujuanterhadaphasilpenilaian.
9.
(9)
CukupJelas.
10.
(10)
CukupJelas.
11.
(11)
Tulislah tanggal saat melakukan pengamatan awal terhadap guru yang dinilai
danterhadapdokumendokumenyangdiperlukandalampenilaian.
12.
(12)
Tuliskandokumendanbahanapasajayangdiperiksa.
13.
(13)
Tulislah tanggapan penilai terhadap dokumen dan bahan yang telah diperiksa
sertatanggapanguruataspertanyaanyangdiajukanolehpenilai.
14.
(14)
Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah memeriksa
dokumen,bahan,danberdiskusidenganguruyangdinilai.
15.
(15)
Tulislah tanggal saat melakukan pengamatan terhadap kegiatan guru dalam
pelaksanaanprosespembelajarandikelas.
16.
(16)
Tulislah dokumen dan bahan lain yang juga diamati selama melakukan
pengamatankegiatangurudalammelaksanakanpembelajajarandikelas.
17.
(17)
Tulislah tanggapan terhadap aktivitas guru dan peserta didik selama masa
pengamatandalamprosespembelajarandikelas.
18.
(18)
Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah melakukan
pengamatanprosespembelajarandikelas.
19.
(19)
Tulislah tanggal saat melakukan diskusi dengan guru setelah melakukan
pengamatan terhadap kegiatan guru dalam melaksanakan pembelajaran di
kelas.
20.
(20)
Tulislah dokumen dan bahan pendukung yang diperiksa setelah melakukan
pengamatan terhadap kegiatan guru dalam melaksanakan pembelajaran di
kelas.
21.
(21)
Tulislah tanggapan penilai terhadap dokumen yang diperiksa dan tanggapan
guru terhadap pertanyaanpertanyaan yang diberikan oleh penilai terkait
denganpelaksanaankegiatanpembelajarandikelas.

82

NO
22.
23.
24.
25.
26.

27.
28.
29.

30.

NOMOR
URAIAN
KODE
(22)
Tulislahtindaklanjutyangdiperlukanolehpenilaiuntukmeningkatkankualitas
gurudalampelaksanaanpembelajarandikelas.
(23)
Tulislahtanggalsaatmelakukanpemantauanterhadapguruyangyangdinilai.
(24)
Tullislah dokumen dan/atau bahan yang diperiksa selama melakukan
pemantauanterhadapguruyangdinilai.
(25)
Tulislah tanggapan penilai terhadap hasil pemantauan kegiatan guru yang
dinilai.
(26)
Berikan skor 0 atau 1 atau 2 terhadap indikatorindikator yang menunjukkan
kompetensi guru yang dinilai sebagai hasil evaluasi terhadap dokumen dan
tanggapan guru sebelum pengamatan dan/atau selama pengamatan dan/atau
setelahpengamatandan/ataupemantauan.
(27)
Tulislahtotalhasilskorsetiapindikatorpadakompetensiyangbersangkutan.
(28)
Angkainimenunjukkanskormaksimumpadakompetensitertentu
(29)
Hitungdantulislahhasilpenilaiankompetensitertentudengancaramembagi
total skor yang diperoleh (nomor kode 27) dengan skor maksimum pada
kompetensitertentu(nomorkode28)dikalikanseratuspersen(100%).
(30)
Tulislah nilai kinerja guru dengan mengkonversi hasil persentase (nomor kode
29) ke dalam angka 1 atau 2 atau 3 atau 4 dengan menggunakan ketentuan
perhitungansebagaiberikut:
Nilai1untuk0%<X<25%
Nilai2untuk25%<X<50%
Nilai3untuk50%<X<75%
Nilai4untuk75%<X<100%

83

Lampiran1C
REKAPHASILPENILAIANKINERJAGURUKELAS/MATAPELAJARAN
a. Nama

:............................(1)
NIP

:............................(2)
Tempat/TanggalLahir

:/.............................(3)
Pangkat/Jabatan/Golongan
:............................(4)
TMTsebagaiguru

:............................(5)
MasaKerja

:........Tahun......Bulan(6)
JenisKelamin

:L/P(7)
PendidikanTerakhir/Spesialisasi
:............................(8)
ProgramKeahlianyangdiampu
:............................(9)
b. NamaInstansi/Sekolah

:...........................(10)
Telp/Fax

:...........................(11)
Kelurahan

:...........................(12)
Kecamatan

:...........................(13)
Kabupaten/kota

:...........................(14)
Provinsi

:..........................(15)

Periodepenilaian (16)
Formatif
..........sampai..........
Sumatif
(tanggal,bulan,tahun)(tanggal,bulan,tahun) Kemajuan

(17) Tahun(20)
(18) ..
(19)

NO

KOMPETENSI

NILAI*)

A.Pedagogik
1.
Menguasaikarakteristikpesertadidik

2.
Menguasaiteoribelajardanprinsipprinsippembelajaranyangmendidik

3.
Pengembangankurikulum

4.
Kegiatanpembelajaranyangmendidik

5.
Pengembanganpotensipesertadidik

6.
Komunikasidenganpesertadidik

7.
Penilaiandanevaluasi

B.Kepribadian
8. Bertindaksesuaidengannormaagama,hukum,sosialdankebudayaan

nasional
9.
Menunjukkanpribadiyangdewasadanteladan

10. Etoskerja,tanggungjawabyangtinggi,rasabanggamenjadiguru

C.Sosial
11. Bersikapinklusif,bertindakobyektif,sertatidakdiskriminatif

Komunikasidengansesamaguru,tenagakependidikan,orangtua,peserta
12.

didik,danmasyarakat
D.Profesional
Penguasaanmateri,struktur,konsepdanpolapikirkeilmuanyang
13.

mendukungmatapelajaranyangdiampu
14. Mengembangkankeprofesionalanmelaluitindakanyangreflektif

Jumlah(Hasilpenilaiankinerjaguru)
(22)
*)NilaidiisiberdasarkanlaporandanevaluasiPKGuru.Nilaiminimumperkompetensi=1dan
nilaimaksimum=4

..,..(23)
GuruyangDinilaiPenilaiKepalaSekolah

(.......................(24))(.......................(25))(.........................(26)

84

(26)

PETUNJUKPENGISIANFORMAT1C
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK
pengangkatansebagaiguru.
2.
(2)
TulislahNomorIndukPegawaiguruyangbersangkutan.
3.
(3)
Tulislah tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan
sebagaiKetuaProgram/KompetensiKeahlian.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut
terhitungmulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan
berdasarkanSKpengangkatansebagaiguru.
6.
(6)
Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut
bertugas.
7.
(7)
Tulislah jenis kelamin dari guru yang dinilai dengan cara mencoret huruf L
atauP.
8.
(8)
Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya.
9.
(9)
Tulislahprogramkeahlianyangdiampugutuyangdinilai.
10.
(10)
Tulislahnamainstansiatausekolahguruyangdinilai.
11.
(11)
Tuliskannomordanfaxsekolah(jikaada).
12.
(12)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
13.
(13)
Tuliskankecamatandimanasekolah/madrasahberlokasi.
14.
(14)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
15.
(15)
Tuliskanprovinsidimanasekolah/madrasahberlokasi.

(16)
Tulislah kapan mulai dilakukan penilaian dan kapan berakhirnya proses
penilaianbagigurutersebutpadatahunajaranyangbersangkutan.
3.
(17)
Pilihlah dengan memberi tanda centang (v) pada kolom yang sesuai,
penilaian formatif (awal tahun ajaran), sumatif (akhir tahun ajaran), atau
4.
(18)
penilaian kemajuan setelah guru melaksanakan PKB untuk memperbaiki
5.
(19)
kinerjanya.
6.
(20)
Tulislahtahunajaranpelaksanaanpenilaian.
7.
(21)
Tulislah hasil penilaian guru yang merupakan hasil penilaian kinerja guru
denganmenggunakanformat1B.
8.
(22)
Jumlahkan hasil nilai untuk semua kompetensi guru, sehingga memberikan
hasilnilaikinerjaguru.Bilapenilaianiniadalahpenilaiansumatif,makanilai
inilah yang kemudian dikonversikan ke dalam perolehan angka kredit guru
sesuaiPermennegpandanRB16/2009.
9.
(23)
Tulislahtempatdantanggaldilakukannyapengisianformatini.
10.
(24)
Isilahdengantandatangandannamaguruyangdinilaisebagaibuktibahwa
gurutelahmengetahuidansetujudenganhasilnilaiyangdiperoleh.
11.
(25)
Isilahdengantandatangandannamapenilai.
12.
(26)
Isilah dengan tandatangan dan nama kepala sekolah tempat guru bekerja,
sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan
hasilnilaikinerjaguru.

85

Lampiran1D
FORMATPENGHITUNGANANGKAKREDITPKGURUKELAS/MATAPELAJARAN
a. Nama

:........................(1)
NIP

:........................(2)
Tempat/TanggalLahir

:/.........................(3)
Pangkat/Jabatan/Golongan
:........................(4)
TMTsebagaiguru

:.........................(5)
MasaKerja

:........Tahun......Bulan(6)
JenisKelamin

:L/P(7)
PendidikanTerakhir/Spesialisasi :.........................(8)
:.........................(9)
ProgramKeahlianyangdiampu
b. NamaInstansi/Sekolah

:.......................(10)
Telp/Fax

:.......................(11)
Kelurahan

:.......................(12)
Kecamatan

:.......................(13)
Kabupaten/kota

:........................(14)
Provinsi

:.......................(15)

NilaiPKGURUKelas/MataPelajaran
(16)

KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPAN&RM

No.16Tahun2009denganrumus

Nilai PKG
(17)
Nilai PKG (100) =
100
Nilai PKG tertinggi
Berdasarkanhasilkonversikedalamskalanilaisesuaidenganperaturan
(18)
tersebut,selanjutnyaditetapkansebutandanpersentaseangkakreditnya
(19)
Perolehanangkakredit(untukpembelajaran)yangdihitungberdasarkan
rumusberikutini.

AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4

..,..(20)

Guruyangdinilai

((21))

Penilai

((22))

KepalaSekolah

((23))

86

PETUNJUKPENGISIANFORMAT1D

NO
NOMOR
URAIAN

KODE
1
2
3
1.
(1)
Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK
pengangkatansebagaiguru.
2.
(2)
TulislahNomorIndukPegawaiguruyangbersangkutan.
3.
(3)
Tulislah tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan
sebagaiKetuaProgram/KompetensiKeahlian.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut
terhitungmulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan
berdasarkanSKpengangkatansebagaiguru.
6.
(6)
Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut
bertugas.
7.
(7)
Tulislah jenis kelamin dari guru yang dinilai dengan cara mencoret huruf L
atauP.
8.
(8)
Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya.
9.
(9)
Tulislahprogramkeahlianyangdiampugutuyangdinilai.
10.
(10)
Tulislahnamainstansiatausekolahguruyangdinilai.
11.
(11)
Tuliskannomordanfaxsekolah(jikaada).
12.
(12)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
13.
(13)
Tuliskankecamatandimanasekolah/madrasahberlokasi.
14.
(14)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
15.
(15)
Tuliskanprovinsidimanasekolah/madrasahberlokasi.
16
(16)
DiisidenganhasilPKGURUsesuaidenganhasilPKGURUpadaformatrekap
PKGURU.
17
(17)
DiisidenganPK(GURU)yangtelahdikonversikankedalamskala0100
sesuaidenganPermennegPANdanRBNo.16Tahun2009melalui
perhitungandenganmenggunakanrumustersebut.
18
(18)
Diisi dengan sebutan dan prosentase angka kredit dari hasil PK GURU yang
telah dikonversikan dalam skala 0 100 sebagaimana ditetapkan dalam
PermennegPANdanRBNo.16Tahun2009.
19
(19)
diisikandenganperolehanangkakreditpertahunyangdihitungberdasarkan
rumus sistem paket tersebut sesuai permen tsb. Ingat JM adalah jam
mengajartatapmukaguru,danJWMadalahjamwajibmengajartatapmuka
sesuaidenganaturanyangberlaku.
RumusAngkaKreditsatutahun
=(AKKAKPKBAKP)x(JM/JWM)xNPK
4
20
(20)
Tulislahtempatdantanggaldilakukannyapengisianformatini.
21
(21)
Isilahdengantandatangandannamaguruyangdinilaisebagaibuktibahwa
gurutelahmengetahuidansetujudenganestimasihasilnilaiyangdiperoleh.
22
(22)
Isilahdengantandatangandannamapenilai.
23
(23)
Isilah dengan tanda tangan dan nama kepala sekolah tempat guru bekerja,
sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan
hasilnilaikinerjaguru.

87

88

LAMPIRAN2

INSTRUMENPKGURUBIMBINGANDAN
KONSELING/KONSELOR

89

Lampiran2A
Pernyataankompetensi,indikator,danprosespenilaiankinerja
GuruBimbingandanKonseling(BK)/Konselor
Sumber:
Peraturan Menteri Pendidikan Nasional 27/2008 tentang Standar Kualifikasi dan Kompetensi
Konselor.
BSNP versi 6.0. 11/2008 tentang Kerangka Indikator untuk Pelaporan Pencapaian Standar
NasionalPendidikan:StandarKualifikasiAkademikdanKompetensiGuru.
PeraturanMenteriNegaraPendayagunaanAparaturNegaradanReformasiBirokrasi16/2009
tentangJabatanFungsionalGurudanAngkaKreditnya.

Kompetensi
Caramenilai
Pedagogik
1. Menguasaiteoridanpraksispendidikan.
Pemantauan
2. Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilaku
Pengamatan
konseli.
3. MenguasaiesensilayananBKdalamjalur,jenis,danjenjangsatuan
Pemantauan
pendidikan.
Kepribadian
4. BerimandanbertakwakepadaTuhanYangMahaEsa.
Pemantauan
5. Menghargaidanmenjunjungtingginilainilaikemanusian,individualitas
Pemantauan
dankebebasanmemilih.
6. Menunjukkanintegritasdanstabilitaskepribadianyangkuat.
Pemantauan
7.

Menampilkankinerjaberkualitastinggi.

Pengamatan

Sosial
8.

Mengimplementasikankolaborasiinternalditempatbekerja.

Pemantauan

9.

BerperandalamorganisasidankegiatanprofesiBK.

Pemantauan

10. Mengimplementasikolaborasiantarprofesi.
Profesional
11. Menguasaikonsepdanpraksisasesmenuntukmemahamikondisi,
kebutuhandanmasalahkonseli.

Pemantauan

Pemantauan

13. MerancangprogramBK.

Pengamatan
Pemantauan
Pengamatan

14. MengimplementasikanprogramBKyangkomprehensif.

Pengamatan

15. MenilaiprosesdanhasilkegiatanBK.

Pemantauan

16. Memilikikesadarandankomitmenterhadapetikaprofessional.

Pemantauan

12. MenguasaikerangkateoritikdanpraksisBK.

17. MenguasaikonsepdanpraksispenelitiandalamBK.
Pemantauan
Pengamatan adalah kegiatan yang dinilai melalui pengamatan kinerja guru dalam pelaksanaan
layanan BK (secara klasikal, layanan bimbingan kelompok, dan/atau layanan
konselingkelompoktidaktermasuklayanankonselingindividu).
Pemantauanadalahkegiatanyangdinilaimelaluipemeriksaandokumen,wawancaradenganguru
BK/konselor selama satu semester, yang tidak dilakukan melalui pengamatan.
Khususuntuklayananindividu,Pemantauanmelaluitranskrippelaporanlayanan.

90

Kompetensi1
: Menguasaiteoridanpraksispendidikan
Jenisdancaramenilai:Pedagogik(Pemantauan)
Pernyataan
: Menguasai ilmu pendidikan dan landasan keilmuannya,
mengimplementasikan prinsipprinsip pendidikan dan proses
pembelajaran dan menguasai landasan budaya dan praksis
pendidikan (praksis adalah prinsipprinsip untuk merubah teori
menjadipraktik).

Indikator
1. Guru BK/Konselor dapat menunjukkan dalam perencanaan layanan BK, sesuai dengan
landasandanprinsipprinsippendidikansertapembelajaranyangaktif,kreatif,mandiri,dan
berpusatpadapesertadidik/konseli.
2. GuruBK/KonselordapatmenunjukkandalamperencanaanlayananBK,sesuaidenganusia,
tahapperkembangan,dankebutuhanpesertadidik/konseli.
3. Guru BK/Konselor dapat menunjukkan dalam perencanaan layanan BK, sesuai dengan
keragamanlatarbelakangbudaya,ekonomi,dansosialpesertadidik/konseli.

ProsesPenilaian
Pemantauan:
1. Perikasalah, apakah Guru BK/Konselor menyediakan program layanan BK, mempunyai
Rencana Pelaksanaan Layanan (RPL)/Satuan Layanan (Satlan)/Satuan Pendukung (Satkung)
dan data peserta didik/konseli, termasuk sosiometri (gambaran hubungan sosial
antarpesertadidik/konseli).
2. MintalahguruBK/Konselormenjelaskantentang:
a.
bagaimana pelayanan BK terhadap peserta didik/konseli sebagai makhluk individu,
sosial,susila,bekerjadanberkeTuhananYangMahaEsa;
b.
bagaimana mengembangkan layanan BK yang aktif, kreatif, mandiri, dan berpusat
padaindividu;
c.
bagaimana mengembangkan layanan BK sesuai dengan usia, tahap perkembangan,
dankebutuhanpesertadidik/konseli;dan
d.
bagaimana menerapkan layanan BK lintas budaya, ekonomi, dan sosial peserta
didik/konseli.

91

Kompetensi2

: Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilaku
konseli
Jenisdancaramenilai:Pedagogik(Pemantauan)
Pernyataan
: Mengaplikasikan kaidahkaidah perilaku manusia, perkembangan fisik
dan psikologis individu terhadap sasaran pelayanan bimbingan dan
konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidah
kepribadian, individualitas dan perbedaan konseli terhadap sasaran
pelayanan bimbingan dan konseling dalam upaya pendidikan,
mengaplikasikan kaidahkaidah belajar terhadap sasaran pelayanan
bimbingan dan konseling dalam upaya pendidikan, mengaplikasikan
kaidahkaidahkeberbakatanterhadapsasaranpelayananbimbingandan
konseling dalam upaya pendidikan, mengaplikasikan kaidahkaidah
kesehatanmentalterhadapsasaranpelayananbimbingandankonseling
dalamupayapendidikan.

Indikator
1.
2.
3.

Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan


kebutuhanperkembanganmental,emosional,fisik,dangender.
Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan
kebutuhanbakat,minat,danpotensipribadi.
Peserta didik/konseli diberi kesempatan dalam memperoleh layanan BK sesuai dengan
harapanuntukmelanjutkanpendidikandanpilihankarir.

ProsesPenilaian
SebelumPengamatan:
1. Guru BK/Konselor menyediakan program pelayanan BK, RPL/Satlan/Satkung, instrumen
nontes/angket,dandatayangdidasarkankebutuhanpesertadidik/konseli.
2. Guru BK/Konselor menjelaskan bagaimana data tersebut digunakan dalam perencanaan
programpelayananBK.

SelamaPengamatan:
Penilai mengamati program pelayanan BK secara klasikal, layanan bimbingan kelompok,
layanankonselingkelompok,danmencermatiapakahguruBK/Konselortelahmelaksanakan
pelayananBKyangsesuaidengan:
1. kebutuhanperkembanganmental,emosional,fisik,dangender;
2. kebutuhanbakat,minat,danpotensipribadi;dan
3. harapanuntukmelanjutkanpendidikandanpilihankarir.

92

Kompetensi3

: MenguasaiesensilayananBKdalamjalur,jenis,danjenjangsatuan
pendidikan
Jenisdancaramenilai:Pedagogik(Pemantauan)
Pernyataan
: Menguasaiesensibimbingandankonselingpadapendidikanformal,
nonformaldaninformal,menguasaiesensibimbingandankonseling
pada satuan jenis pendidikan umum, kejuruan, keagamaan,
menguasai esensi bimbingan dan konseling pada satuan jenjang
pendidikanusiadini,dasardanmenengah,sertatinggi.

Indikator
1. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan
padajalursatuanpendidikanformal,nonformaldaninformal.
2. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan
padajenissatuanpendidikanumum,kejuruan,keagamaan,dankhusus.
3. Layanan BK yang diprogramkan oleh guru BK/Konselor telah memenuhi esensi layanan
padajenjangsatuanpendidikanusiadini,dasardanmenengah,sertatinggi.

ProsesPenilaian
Pemantauan:
1. Guru BK/Konselor menyediakan hasil pemetaan latar belakang individu (jenis kelamin,
agama,kemampuanakademik)dankeluarga(pendidikandanpekerjaanorangtua/wali)
danmenampilangrafikhubunganantarakebutuhanlayanansesuaidatayangdimiliki.
2. Guru BK/Konselor diminta untuk menjelaskan hasil pemetaan (tampilan grafik) dan
menindaklanjutihasiltersebutterkaitdengankebutuhanlayanan.

93

Kompetensi4
: BerimandanbertakwakepadaTuhanYangMahaEsa
Jenisdancaramenilai:Kepribadian(Pemantauan)
Pernyataan
: MenampilkankepribadianyangberimandanbertakwakepadaTuhan
Yang Maha Esa, konsisten dalam menjalankan kehidupan beragama
dan toleran terhadap pemeluk agama lain, berakhlak mulia dan
berbudipekertiluhur.

Indikator
1. GuruBK/Konselorberpenampilanrapihdanbersih.
2. GuruBK/Konselorberbicaradengansantundanjujurkepadapesertadidik/konseli.
3. GuruBK/Konselorbersikapdanmendorongkepadapesertadidik/konseliuntukbersikap
toleran.
4. Guru BK/Konselor memperlihatkan konsistensi dan memotivasi peserta didik/konseli
dalammelaksanakanibadah.

ProsesPenilaian
Pemantauan:
1. Penilai mengamati penampilan guru BK/Konselor, cara berpakaian, dan cara berbicara
kepadapesertadidik/konseli.
2. Penilai mengamati sikap dan cara guru BK/Konselor dalam mendorong peserta
didik/konseliuntukbersikaptoleran.
3. Penilai mengamati konsistensi guru BK/Konselor dalam beribadah dan memotivasi
pesertadidik/konseloruntukberibadah.

94

Kompetensi5

: Menghargaidanmenjunjungtingginilainilaikemanusiaan,
individualitasdankebebasanmemilih
Jenisdancaramenilai:Kepribadian(Pemantauan)
Pernyataan
: Mengaplikasikan pandangan positif dan dinamis tentang manusia
sebagai makhluk spiritual, bermoral, sosial, individual, dan
berpotensi, menghargai dan mengembangkan potensi positif
individu pada umumnya dan konseli pada khususnya, peduli
terhadapkemaslahatanmanusiapadaumumnyadanpesertadidik
pada khususnya, menjunjung tinggi harkat dan martabat manusia
sesuai dengan hak asasinya, toleran terhadap permasalahan
konseli,bersikapdemokratis.

Indikator
1. Guru BK/Konselor merencanakan layanan BK yang mengacu kepada pengaplikasian
pandangan dinamis tentang manusia sebagai mahluk bermoral spiritual, sosial, dan
individu.
2. Pelayanan BK yang dirancang oleh Guru BK/Konselor mendorong kepada
pengembanganpotensipositifindividu.
3. Rancangan pelayanan BK mengacu kepada kebutuhan dan masukan balik peserta
didik/konseli.
4. PelayananBKdirancanguntukmengembangkansikaptolerandalammenjunjunghak
azasimanusiapadapesertadidik/konseli.

ProsesPenilaian
Pemantauan:
1. GuruBK/KonselormenyediakanprogrampelayananBK,RPL/Satlan/Satkungdandata
pesertadidik/konselisertasosiometri.
2. PenilaimemintaguruBK/Konselormenjelaskantentang:
a.
bagaimanapelayananterhadappesertadidik/konselisebagaimakhlukbermoral,
spiritual,sosialdanindividu;
b.
bagaimana mengembangkan pelayanan BK yang mendorong kepada
pengembanganpotensipositifindividu;
c.
bagaimana menerapkan pelayanan BK yang mengacu kepada kebutuhan dan
masukanbalikpesertadidik/konseli;dan
d.
bagaimana mengembangkansikaptoleranyangmenjunjung hakazasimanusia
dalamlayananBK.

95

Kompetensi6
: Menunjukkanintegritasdanstabilitaskepribadianyangkuat
Jenisdancaramenilai:Kepribadian(Pemantauan)
Pernyataan
: Menampilkan kepribadian dan perilaku yang terpuji (seperti
berwibawa,jujur,sabar,ramah,dankonsisten),menampilkanemosi
yang stabil, peka, bersikap empati, serta menghormati keragaman
danperubahan,menampilkantoleransitinggiterhadapkonseliyang
menghadapistresdanfrustasi.

Indikator
1. Guru BK/Konselor menunjukkan kepribadian, kestabilan emosi dan perilaku yang terpuji,
jujur,sabar,ramah,dankonsisten.
2. Guru BK/Konselor menunjukkan kepekaan dan bersikap empati terhadap keragaman dan
perubahan.
3. Guru BK/Konselor menampilkan toleransi tinggi terhadap peserta didik/konseli yang
menghadapistresdanfrustasi.

ProsesPenilaian
Pemantauan:
1. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh
tindakanguruBK/Konseloryangmenunjukkankepribadian,kestabilanemosi,danperilaku
terpuji,jujur,sabar,ramah,dankonsisten.
2. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh
tindakan guru BK/Konselor yang menunjukkan kepekaan dan sikap empati guru terhadap
keragamandanperubahan,baikyangbersifatmembangunmaupunsebaliknya.
3. Penilai bertanya kepada teman sejawat dan peserta didik/konseli serta meminta contoh
tindakan guru BK/Konselor yang menunjukkansikap toleransi guru terhadap peserta
didik/konseliyangsedangmenghadapistressdanfrustasi.

96

Kompetensi7
: Menampilkankinerjaberkualitastinggi
Jenisdancaramenilai:Kepribadian(Pengamatan)
Pernyataan
: Menampilkan tindakan yang cerdas, kreatif, inovatif, dan produktif,
bersemangat, berdisiplin, dan mandiri, berpenampilan menarik dan
menyenangkan,berkomunikasisecaraefektif.

Indikator
1. Guru BK/Konselor memotivasi peserta didik/konseli untuk berpartisipasi aktif dalam
layananBKyangdiberikan.
2. Guru BK/Konselor melaksanakan pelayanan BK yang efektif sesuai dengan rancangan
untukmencapaitujuanpelayananBKdalamwaktuyangtersedia.
3. GuruBK/KonselormelaksanakantugaslayananBKsecaramandiri,disiplin,dansemangat
agarpesertadidik/konseliberpartisipasisecaraaktif.

ProsesPenilaian
Sebelumpengamatan:
PenilaimemintaguruBK/KonselormenyediakanprogramBKdanRPL/Satlan/Satkungdan
menerangkantujuankegiatandanaktifitaspelayananBK.

Selamapengamatan:
1. Penilai mengamati, apakah peserta didik/konseli berpartisipasi aktif dalam kegiatan
pelayananBK.
2. Penilai mengamati, apakah peserta didik/konseli mengerti dan mengikuti prosedur
pelayananBKsesuaidenganwaktuyangdisediakan.
3. Penilai mengamati, apakah guru BK/Konselor melaksanakan kegiatan pelayanan BK
secaralancarsesuaidenganrancangandantujuanyangakandicapai.
4. Penilai mencatat jika terdapat perbedaan antara perencanaan dan pelaksanaan
pelayananBK.

Setelahpengamatan:
1. Penilai meminta penjelasan guru BK/konselor jika terdapat perbedaan antara
perencanaandanpelaksanaanpelayananBK.
2. Penilai meminta penjelasan guru BK/konselor terhadap ketercapaian pelaksanaan
pelayananBK.

97

Kompetensi8
: Mengimplementasikankolaborasiinternalditempatbekerja
Jenisdancaramenilai:Sosial(Pemantauan)
Pernyataan
: Memahami dasar, tujuan, organisasi, dan peran pihakpihak lain
(guru, wali kelas, pimpinan sekolah/madrasah, komite
sekolah/madrasah) di tempat bekerja, mengkomunikasikan dasar,
tujuan, dan kegiatan pelayanan bimbingan dan konseling kepada
pihakpihaklainditempatbekerja,bekerjasamadenganpihakpihak
terkait di dalam tempat bekerja (seperti guru, orang tua, tenaga
administrasi).

Indikator
1. Guru lain dapat menunjukkan contoh penggunaan hasil pelayanan BK untuk membantu
pesertadidik/konselidalamprosespembelajaranyangdilakukannya.
2. GuruBK/KonselormerencanakanpelayananBKdenganmenyertakanpihakpihakterkait
disekolah.
3. Guru BK/Konselor dapat menunjukkan bukti bagaimana menjelaskan program dan hasil
layananBKkepadapihakpihakterkaitdisekolah.
4. Guru BK/Konselor dapat menunjukkan bukti permintaan guru lain untuk membantu
penyelesaianpermasalahanpembelajaran.

ProsesPenilaian
Pemantauan:
1. Guru BK/Konselor menyediakan dokumen dan buktibukti lain berkaitan dengan
pelayanan BK dalam membantu peserta didik/konseli berdasarkan hasil tes peserta
didik/konselidan/ataupermintaangurulain.
2. Guru BK/Konselor menyediakan dokumen dan buktibukti lain berkaitan dengan halhal
yang telah dilakukannya dalam mengkomunikasikan rencana dan hasil pelayanan BK
kepadapihakpihakterkait.

98

Kompetensi9
: BerperandalamorganisasidankegiatanprofesiBK
Jenisdancaramenilai:Sosial(Pemantauan)
Pernyataan
: Memahami dasar, tujuan, dan AD/ART organisasi profesi bimbingan
dankonselinguntukpengembangandiridanprofesi,mentaatiKode
Etik profesi bimbingan dan konseling, aktif dalam organisasi profesi
bimbingandankonselinguntukpengembangandiridanprofesi.

Indikator
1. Guru BK/Konselor mentaati Kode Etik organisasi profesi BK (seperti MGBK, ABKIN, atau
organisasiprofesisejenislainnya).
2. GuruBK/Konselorberpartisipasiaktifdalamprosespengembangandirimelaluiorganisasi
profesiguruBK/Konselor.
3. Guru BK/Konselor dapat memanfaatkan organisasi profesi BK/Konselor untuk
membangunkolaborasidalampengembanganprogramBK.

ProsesPenilaian
Pemantauan:
1. Penilai menanyakan kepada teman seprofesi tentang kesesuaian aktifitas guru
BK/KonselordenganKodeEtikprofesi.
2. Guru BK/Konselor dapat menunjukkan bukti keterlibatan dan aktivitasnya dalam
organisasi profesi BK/Konselor (seperti MGBK, ABKIN, atau organisasi profesi sejenis
lainnya)tentangpengembangandiridankolaborasi.

99

Kompetensi10
: Mengimplementasikankolaborasiantarprofesi
Jenisdancaramenilai:Sosial(Pemantauan)
Pernyataan
: Mengkomunikasikanaspekaspekprofesionalbimbingandankonseling
kepadaorganisasiprofesilain,memahamiperanorganisasiprofesilain
dan memanfaatkannya untuk suksesnya pelayanan bimbingan dan
konseling, bekerja dalam tim bersama tenaga paraprofesional dan
profesional profesi lain, melaksanakan referal (alih tangan kasus)
kepadaahliprofesilainsesuaidengankeperluan.

Indikator
1. GuruBK/Konselordapatmenunjukkanbuktimelakukaninteraksidenganorganisasiprofesi
lain.
2. Guru BK/Konselor dapat berkolaborasi dengan institusi atau profesi lain untuk mencapai
tujuanpelayananBK.
3. Guru BK/Konselor dapat memanfaatkan keahlian lain untuk membantu penyelesaian
permasalahanpesertadidik/konselisesuaikebutuhan.

ProsesPenilaian
Pemantauan:
1. Penilai meminta guru BK/Konselor untuk menunjukkan bukti melakukan interaksi dengan
organisasiprofesilain(antaralainberupasuratkerjasama,suratketerangan,MoUdengan
pihakterkait,ataubuktifisiklainnya).
2. Guru BK/Konselor dapat menunjukkan bukti dan menjelaskan bagaimana memanfaatkan
kerjasama dengan institusi (Sekolah, Perguruan Tinggi, Kementerian Sosial, Kementerian
TenagaKerja,daninstitusilainnya)atauorganisasiprofesidalammencapaitujuanlayanan
BK.
3. Konselordapatmenunjukkanbuktidanmenjelaskanbagaimanamelaksanakankerjasama
dengan satuan pendukung alih tangan kasus (psikolog, psikiater, pekerja sosial, atau
profesilainnya)dalampenyelesaianpermasalahanpesertadidik/konseli.

Kompetensi11

: Menguasaikonsepdanpraksispenilaian(assessment)untuk

100

memahamikondisi,kebutuhan,danmasalahkonseli
Jenisdancaramenilai:Profesional(Pemantauan)
Pernyataan
: Mendeskripsikan hakikat asesmen untuk keperluan pelayanan
konseling, memilih teknik penilaian sesuai dengan kebutuhan
pelayananbimbingandankonseling,menyusundanmengembangkan
instrumen penilaian untuk keperluan bimbingan dan konseling,
mengadministrasikan asesmen untuk mengungkapkan masalah
masalah peserta didik, memilih dan mengadministrasikan teknik
penilaian pengungkapan kemampuan dasar dan kecenderungan
pribadi peserta didik, memilih dan mengadministrasikan instrumen
untuk mengungkapkan kondisi aktual peserta didik berkaitan dengan
lingkungan,mengaksesdatadokumentasitentangpesertadidikdalam
pelayanan bimbingan dan konseling, menggunakan hasil penilaian
dalam pelayanan bimbingan dan konseling dengan tepat,
menampilkantanggungjawabprofesionaldalampraktikpenilaian.

Indikator
1.
2.
3.
4.

5.
6.

7.

Guru BK/Konselor dapat mengembangkan instrumen nontes (pedoman wawancara, angket, atau
formatlainnya)untukkeperluanpelayananBK.
GuruBK/Konselordapatmengaplikasikaninstrumennontesuntukmengungkapkankondisiaktual
pesertadidik/konseliberkaitandenganlingkungan.
Guru BK/Konselor dapat mendeskripsikan penilaian yang digunakan dalam pelayanan BK yang
sesuaidengankebutuhanpesertadidik/konseli.
GuruBK/Konselordapatmemilihjenispenilaian(InstrumenTugasPerkembangan/ITP,AlatUngkap
Masalah/AUM, Daftar Cek Masalah/DCM, atau instrumen non tes lainnya) yang sesuai dengan
kebutuhanlayananbimbingandankonseling.
GuruBK/Konselordapatmengadministrasikanpenilaian(merencanakan,melaksanakan,mengolah
data)untukmengungkapkankemampuandasardankecenderunganpribadipesertadidik/konseli.
GuruBK/Konselordapatmengadministrasikanpenilaian(merencanakan,melaksanakan,mengolah
data) untuk mengungkapkan masalah peserta didik/konseli (data catatan pribadi, kemampuan
akademik,hasilevaluasibelajar,danhasilpsikotes).
Guru BK/Konselor dapat menampilkan tanggung jawab profesional sesuai dengan azas BK
(misalnyakerahasiaan,keterbukaan,kemutakhiran,dll.)dalampraktikpenilaian.

ProsesPenilaian
Pemantauan:
1. PenilaimemintaguruBK/Konseloruntukmenyediakaninstrumennontesyangtelahdikembangkan
sesuaikebutuhanpelayananBK.
2. Penilai meminta guru BK/Konselor untuk menjelaskan pengaplikasian instrumen nontes tersebut
dalammengungkapkankondisiaktualpesertadidik/konseliberkaitandenganlingkungan.
3. PenilaimemintaguruBK/Konseloruntukmenjelaskanpenilaianyangdigunakandalampelayanan
BKyangsesuaidengankebutuhanpesertadidik/konseli.
4. PenilaimemintaguruBK/Konseloruntukmenyediakanjenispenilaianyangdipilihsesuaidengan
kebutuhanlayananbimbingandankonseling.
5. Penilai meminta guru BK/Konselor untuk menyediakan hasil penilaian tentang pengungkapan
kemampuandasardankecenderunganpribadipesertadidik/konseli.
6. Penilai meminta guru BK/Konselor untuk menyediakan hasil pendukung penilaian seperti data
catatanpribadipesertadidik/konseli,kemampuanakademik/hasilevaluasibelajar,hasilpsikotes,
dll.
7. PenilaimemintaguruBK/KonseloruntukmenjelaskanpenggunaanazasBKsebagaitanggungjawab
professional.

101

Kompetensi12
: MenguasaikerangkateoretikdanpraksisBK
Jenisdancaramenilai:Profesional(PengamatandanPemantauan)
Pernyataan
: Mengaplikasikan hakikat pelayanan bimbingan dan konseling,
mengaplikasikan arah profesi bimbingan dan konseling,
mengaplikasikan dasardasar pelayanan bimbingan dan konseling,
mengaplikasikan pelayanan bimbingan dan konseling sesuai kondisi
dantuntutanwilayahkerja,mengaplikasikanpendekatan/model/jenis
pelayanan dan kegiatan pendukung bimbingan dan konseling,
mengaplikasikan dalam praktik format pelayanan bimbingan dan
konseling.

Indikator
1.
2.
3.
4.
5.
6.

Guru BK/Konselor dapat mengaplikasikan hakikat pelayanan BK (tujuan, prinsip, azas, fungsi, dan
landasan).
Guru BK/Konselor dapat menentukankan arah profesi bimbingan dan konseling (peran sebagai guru
BK/konselor).
GuruBK/KonselordapatmengaplikasikandasardasarpelayananBK.
GuruBK/KonselordapatmengaplikasikanpelayananBKsesuaikondisidantuntutanwilayahkerja.
Guru BK/Konselor dapat mengaplikasikan pendekatan /model/jenis pelayanan dan kegiatan
pendukungbimbingandankonseling.
GuruBK/Konselordapatmengaplikasikanpraktikformat(kegiatan)pelayananBK.

ProsesPenilaian
Sebelumpengamatan:
1. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan
penjelasantentangtujuan,prinsip,azas,fungsi,danlandasanyangdiaplikasikandalamprogramtsb.
2. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan
penjelasantentangdasardasarpelayananyangdiaplikasikannyadalamprogramtsb.
3. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan
penjelasan tentang kesesuaian kondisi dantuntutan wilayah kerja yang terdapat di dalam program,
RPL/Satlan.
4. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan
penjelasan tentangpendekatan/model (misalnya: trait factor, analisis transaksional, rasional emotif,
psikoanalisa, konseling behavioural, konseling individual, client centered, terapi gestalt) atau jenis
pelayanan (misalnya: jenis pelayanan informasi, orientasi, konseling individu, bimbingan
kelompok/konselingkelompok)yangdiaplikasikandalamprogram,RPL/Satlan/Satkungtersebut.
5. PenilaimemintaguruBK/Konseloruntukmenyediakanprogram,RPL/Satlan/Satkungdanmemberikan
penjelasan tentang format kegiatan yang digunakan dalam pelayanan BK (secara klasikal, layanan
bimbingankelompok,layanankonselingkelompok)tersebut.
SelamaPengamatan:
1. Penilai mengamati pelaksanaan pelayanan BK (layanan konseling kelompok dan layanan bimbingan
kelompok) untuk menilai misalnya: pendekatan/model atau jenis layanan BK dan meminta guru
BK/konselormenjelaskantentangtujuan,teknik,danhasillayananBKtsb.
2. Penilai mengamati pelaksanaan pelayanan BK (layanan konseling kelompok dan layanan bimbingan
kelompok) untuk menilai misalnya: layanan informasi, layanan orientasi, layanan konseling
perorangan, layanan bimbingan kelompok, layanan konseling kelompok) dan meminta guru
BK/konselormenjelaskantentangjenisformat,tujuan,danhasillayanantsb.
Pemantauan:
Penilai meminta transkrip pelaporan layanan konseling individu dan penjelasan tentang proses dan
hasilnya.

102

Kompetensi13
: MerancangprogramBK
Jenisdancaramenilai:Profesional(Pengamatan)
Pernyataan
: Menganalisiskebutuhankonseli,menyusunprogrambimbingandan
konseling yang berkelanjutan berdasar kebutuhan konseli secara
komprehensif dengan pendekatan perkembangan, menyusun
rencana pelaksanaan program bimbingan dan konseling,
merencanakan sarana dan biaya penyelenggaraan program
bimbingandankonseling.

Indikator
1. GuruBK/Konselordapatmenganalisiskebutuhanpesertadidik/konseli.
2. Guru BK/Konselor dapat menyusun program pelayanan BK yang berkelanjutan berdasar
kebutuhan peserta didik/konseli secara komprehensif dengan pendekatan
perkembangan.
3. GuruBK/KonselordapatmenyusunrencanapelaksanaanprogrampelayananBK.
4. Guru BK/Konselor dapat merencanakan sarana dan biaya penyelenggaraan program
pelayananBK.

ProsesPenilaian

Sebelumpengamatan:
1. PenilaimemintaguruBK/Konseloruntukmenyediakandokumenhasilasesmendanatau
hasil belajar serta meminta guru BK/konselor mendeskripsikan kesesuaian antara
kebutuhanpesertadidik/konselidenganhasilasesmenatauhasilbelajartersebut.
2. PenilaimemintaguruBK/KonseloruntukmenyediakandaftarkegiatanpelayananBKsatu
semesterterakhirdanmemintaguruBK/konselormenunjukkanbahwapraktikpelayanan
tsbdilaksanakansecarakomprehensifdanberkelanjutan.
3. Penilai meminta guru BK/Konselor untuk menjelaskan tentang program pelayanan BK
yang meliputi program tahunan, program semester, program bulanan, mingguan, dan
program harian (RPL/Satlan/Satkung) dan meminta guru BK/konselor menjelaskan
keterkaitan antara programprogram tersebut dan strategi penyusunannya (bagaimana
programtersebutdisusun).
SelamaPengamatan:
1. Penilai mengamati pelaksanaan pelayanan BK, misalnya: layanan informasi, layanan
orientasi,layananbimbingankelompok,layanankonselingkelompok).
2. PenilaimengamatibagaimanaguruBK/Konselorberinteraksidenganpesertadidik/konseli
dalam proses pelayanan BK termasuk sejauhmana guru BK/konselor memberikan
kesempatankepadapesertadidik/konseliuntukberpartisipasiaktif.
SetelahPengamatan:
Penilai meminta guru BK/Konselor menjelaskan kesesuaian antara kebutuhan peserta
didik/konselidenganlayananBKyangdiberikan.

103

Kompetensi14
: MengimplementasikanprogramBKyangkomprehensif
Jenisdancaramenilai:Profesional(Pengamatan)
Pernyataan
: Melaksanakan program bimbingan dan konseling, melaksanakan
pendekatan kolaboratif dalam pelayanan bimbingan dan konseling,
memfasilitasi perkembangan akademik, karier, personal, dan sosial
konseli, mengelola sarana dan biaya program bimbingan dan
konseling.

Indikator
1.
2.
3.
4.

GuruBK/KonselordapatmelaksanakanprogrampelayananBK.
Guru BK/Konselor dapat melaksanakan pendekatan kolaboratif dengan pihak terkait dalam
pelayananBK.
GuruBK/Konselordapatmemfasilitasiperkembanganakademik,karier,personal/pribadi,dansosial
pesertadidik/konseli.
GuruBK/KonselordapatmengelolasaranadanbiayaprogrampelayananBK.

ProsesPenilaian
Sebelumpengamatan:
1. Penilai meminta guru BK/konselor menyediakan program pelayanan BK yang meliputi program
tahunan,programsemester,programbulanan,mingguan,danprogramharian(RPL/Satlan/Satkung).
2. Penilai meminta guru BK/Konselor menjelaskan bagaimana program tsb dilaksanakan melalui
berbagaijenislayanandankegiatanpendukung.
3. Penilai meminta guru BK/Konselor untuk menunjukkan adanya kerja sama dengan pihak terkait
dalampelaksanaannya.
4. Penilai meminta guruBK/Konselor menunjukkan bagianmana dari program tsb yang memfasilitasi
perkembanganakademik,karir,personal,dansosialpesertadidik/konseli.
5. PenilaimemintaguruBK/Konseloruntukmenjelaskanbagaimanasaranadanbiayayangadadikelola
dalampelaksanaanprogramtersebut.

SelamaPengamatan:
Penilai mengamati pelaksanaan pelayanan BK (misalnya: layanan informasi,orientasi, bimbingan
kelompok, konseling kelompok) dan bagaimana guru BK/Konselor melaksanakan pelayanan BK
termasuk:
1. Berapalamawaktuyangdiperlukanuntukmelakukansetiapkegiatan/aktifitaspelayananBK.
2. ApakahguruBK/KonselormenyesuaikanjenislayananBKsesuaikebutuhanpesertadidik/konseli.
3. Apakah semua layanan BK dapat membantu peserta didik/konseli untuk mencapai tujuan
pelayanan.
4. Bagaimana guru BK/Konselor mengelola aktifitas pelayanan BK (misalnya apakah tujuan
pelayananBKdapattercapaisesuaidenganRPL/Satlan/Satkung).
5. Bagaimana guru BK/Konselor menggunakan media pelayanan BK (misalnya komputer, film,
gambar,komik,danmedialainnya).
6. SeberapaterampilguruBK/KonselormenggunakanmediapelayananBKtersebut.

SetelahPengamatan:
1. Penilaimemilihsecararandomsebanyaklimaorangpesertadidik/konseli.
2. Penilai menanyakan bagaimana guru BK/konselor membimbing mereka untuk mencapai
keberhasilanpembelajaran/akademik,pemilihankarir,dan/ataupenyelesaianmasalahpribadidan
social.
3. Penilai meminta guru BK/konselor menjelaskan aktifitas pelayanan BK yang berhasil atau kurang
berhasil.
4. jikaadalayananyangtidaksesuaidenganrencanapelayananBK,penilaimemintaguruBK/konselor
memberikanalasanberdasarkankebutuhanpesertadidik/konselidanteoriBK.

Kompetensi15

: MenilaiprosesdanhasilkegiatanBK

104

Jenisdancaramenilai:Profesional(Pemantauan)
Pernyataan
: Melakukan evaluasi hasil, proses, dan program bimbingan dan
konseling, melakukan penyesuaian proses pelayanan bimbingan dan
konseling, menginformasikan hasil pelaksanaan evaluasi pelayanan
bimbingan dan konseling kepada pihak terkait, menggunakan hasil
pelaksanaan evaluasi untuk merevisi dan mengembangkan program
bimbingandankonseling.

Indikator
1. GuruBK/KonselordapatmelakukanevaluasiprosesdanhasilprogrampelayananBK.
2. Guru BK/Konselor dapat melakukan penyesuaian kebutuhan peserta didik/konseli dalam
prosespelayananBK.
3. Guru BK/Konselor dapat menginformasikan hasil pelaksanaan evaluasi pelayanan BK
kepadapihakterkait.
4. Guru BK/Konselor dapat menggunakan hasil pelaksanaan evaluasi untuk merevisi dan
mengembangkanprogrampelayananBKberdasarkananalisiskebutuhan.

ProsesPenilaian
Pemantauan:
1. PenilaimemintaguruBK/konselormenyediakandatahasildanlaporan(lapelprog)evaluasi
programpelayananBK.
2. Penilai meminta guru BK/konselor untuk menjelaskan proses pelayanan BK yang sesuai
dengankebutuhanpesertadidik/konseli.
3. Penilai meminta guru BK/konselor menunjukkan bukti dan menjelaskan bagaimana hasil
layanan BK diinformasikan kepada pihak terkait sesuai dengan kebutuhan (misalnya
pesertadidik/konseliybs,kepalasekolah,walikelas,gurumatapelajaran,danorangtua)
danmenjagakerahasiaandiripesertadidik/konseli.
4. Penilai meminta guru BK/konselor menjelaskan bagaimana hasil evaluasi pelaksanaan
programpelayananBKdanbagianbagianmanadariprogramtersebutyangharusdirevisi
dandikembangkanuntukpelayananBKselanjutnya.
5. Penilai memilih secara acak sebanyak lima orang peserta didik/konseli dan bertanya
apakah guru BK/konselor mendiskusikan hasil dan kegunaan evaluasi untuk penyesuaian
programlayananBKdengankebutuhanmasingmasingpesertadidik/konseli.

105

Kompetensi16
: Memilikikesadarandankomitmenterhadapetikaprofesional
Jenisdancaramenilai:Profesional(Pengamatan)
Pernyataan
: Memberdayakan kekuatan pribadi, dan keprofesionalan guru
BK/konselor, meminimalkan dampak lingkungan dan keterbatasan
pribadi guru BK/konselor, menyelenggarakan pelayanan sesuai dengan
kewenangan dan kode etik profesional guru BK/konselor,
mempertahankan obyektivitas dan menjaga agar tidak larut dengan
masalah peserta didik, melaksanakan referal sesuai dengan keperluan,
peduli terhadap identitas profesional dan pengembangan profesi,
mendahulukankepentinganpesertadidikdaripadakepentinganpribadi
guruBK/konselor.

1.
2.
3.
4.
5.
6.
7.

Indikator
GuruBK/Konselordapatmemberdayakankekuatanpribadi,dankeprofesionalanguruBK/konselor.
GuruBK/KonselordapatmeminimalisirdampaklingkungandanketerbatasanpribadiguruBK/konselor.
Guru BK/Konselor dapat menyelenggarakan pelayanan BK sesuai dengan kewenangan dan kode etik
profesionalguruBK/konselor.
Guru BK/Konselor dapat mempertahankan objektivitas dan menjaga agar tidak larut dengan masalah
pesertadidik/konseli.
Guru BK/Konselor dapat melaksanakan layanan pendukung sesuai kebutuhan peserta didik/konseli
(misalnyaalihtangankasus,kunjunganrumah,konferensikasus,instrumenbimbingan,himpunandata)
GuruBK/Konselordapatmenghargaiidentitasprofesionaldanpengembanganprofesi.
GuruBK/Konselordapatmendahulukankepentinganpesertadidik/konselidaripadakepentinganpribadi
guruBK/konselor.

ProsesPenilaian
Pemantauan:
1. Penilai meminta guru BK/Konselor menyediakanhasil evaluasi diri program PKB. Penilai mengevaluasi
dokumentersebut.
2. Penilai meminta guru BK/Konselor mendeskripsikan kekuatan diri dan bagaimana kekuatan tersebut
dimanfaatkanbagisuksesnyapelayananBK.
3. Penilai meminta guru BK/Konselor mendeskripsikan keterbatasan diri dan lingkungan (termasuk
prasaranadansarana)dalampelayananBK,sertaupayameminimalkandampakketerbatasantersebut.
4. PenilaimemintaguruBK/KonselormengidentifikasikewenanganguruBK/konselorsesuaidenganKode
EtikpelaksanaanpelayananBK.
5. Penilai meminta guru BK/Konselor menyediakan minimal satu laporan pelaksanaan program layanan
(lapelprog).Penilaimengevaluasilaporantersebut.
6. Penilai meminta guru BK/Konselor untuk menjelaskan perlu tidaknya masalah peserta didik/konseli
dialihtangankankepadapihaklain.
7. Penilai meminta guru BK/Konselor mendeskripsikan identitas dan pengembangan profesi BK serta
bagaimanakesungguhanguruBK/KonselordalammelaksanakanpelayananBKtersebut.
8. Penilai meminta guru BK/Konselor menjelaskan dan membuktikan apakah guru BK/Konselor
mengutamakan kebutuhan peserta didik/konseli meskipun harus mengorbankan sesuatu (misalnya
waktu).
9. Penilai meminta guru BK/Konselor untuk menjelaskan tentang upayanya dalam menghimpun dan
menjagakerahasiaanpermasalahanpesertadidik/konseli.
10. Penilai meminta Kepala Sekolah untuk menjelaskan apakah guru BK/Konselor bekerja sesuai dengan
etikaprofesiBK.
11. PenilaimemintaKepalaSekolahuntukmenerangkanbagaimanapekerjaanguruBK/konselormencapai
standaryangdiharapkanolehkepalasekolahdan/ataukomitesekolah.

106

Kompetensi17
: MenguasaikonsepdanpraksispenelitiandalamBK
Jenisdancaramenilai:Profesional(Pemantauan)
Pernyataan
: Mendeskripsikan berbagai jenis dan metode penelitian, mampu
merancang penelitian bimbingan dan konseling, melaksanakan
penelitian bimbingan dan konseling, memanfaatkan hasil penelitian
dalam bimbingan dan konseling dengan mengakses jurnal pendidikan
danbimbingandankonseling.

Indikator
1.
2.
3.
4.

GuruBK/KonselordapatmendeskripsikanjenisdanmetodepenelitiandalamBK.
GuruBK/KonselormampumerancangpenelitiandalamBK.
GuruBK/KonselordapatmelaksanakanpenelitiandalamBK.
GuruBK/KonselordapatmemanfaatkanhasilpenelitiandalamBKdenganmengaksesjurnal
yangrelevan.

ProsesPenilaian
Pemantauan:
1. Penilai meminta guru BK/Konselor untuk mendeskripsikan berbagai jenis dan metoda
penelitian,khususnyayangdapatdanperludilaksanakandalamprofesiBK.
2. Penilai meminta guru BK/Konselor mengemukakan satu permasalahan bidang BK terkait
denganpelayananBKdisekolahyangperluditeliti.
3. Penilai meminta guru BK/Konselor menjelaskan langkahlangkah dalam merancang
penelitiantentangmasalahtersebut.
4. Penilai meminta guru BK/Konselor menyediakan bukti penelitian yang telah
dilaksanakannyasertamenjelaskangarisbesarprosesdanisipenelitian.
5. Penilai meminta guru BK/Konselor menyediakan laporan hasil penelitian dari jurnal atau
sumberlainterkaitpelayananBKdisekolah.
6. PenilaimemintaguruBK/Konselormenjelaskanketerkaitandankegunaanhasilpenelitian
tersebutdalamkegiatanpelayananBKdisekolah.
7. Penilai meminta guru BK/Konselor menjelaskan manfaat hasil penelitian terkait dengan
programPKByangdirencanakan.

107

Lampiran2B

LAPORANDANEVALUASI
PENILAIANKINERJAGURUBIMBINGANDANKONSELING/KONSELOR

:______________________________________________(1)

NamaGuru

NIP/NomorSeriKarpeg
:________________________/_____________________(2)

Pangkat/GolonganRuang
:________________________/_____________________(3)
TerhitungMulaiTanggal

NUPTK/NRG

:________________________/_____________________(4)

Namasekolah dan

:________________________________________________
Alamatsekolah

:_______________________________________________(5)

Tanggalmulaibekerja
disekolahini

:______________________________________________(6)

Bulan

Tahun

Periodepenilaian

:_________________sampai___________________(7)

(tanggal,bulan,tahun)
(tanggal,bulan,tahun)

PERSETUJUAN(8)
(Persetujuaniniharusditandatanganiolehpenilaidanguruyangdinilai)

Penilai dan guru yang dinilai menyatakan telah membaca dan mamahami semua aspek yang
ditulis/dilaporkandalamformatinidanmenyatakansetuju.

Namaguru

Namapenilai

Tanda

Tandatangan
tangan

Tanggal
___bulan____tahun_______

108

Kompetensi1 :Menguasaiteoridanpraksispendidikan
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(23)
Dokumendanbahanlain
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(34)

(25)

PenilaianuntukKompetensi1:Menguasaiteoridanpraksispendidikan.
Skor
Indikator
1. GuruBK/Konselordapatmenunjukkandalam
perencanaanlayananBK,sesuaidenganlandasan
danprinsipprinsippendidikanserta
pembelajaranyangaktif,kreatif,mandiri,dan
berpusatpadapesertadidik/konseli.
2. GuruBK/Konselordapatmenunjukkandalam
perencanaanlayananBK,sesuaidenganusia,
tahapperkembangan,dankebutuhanpeserta
didik/konseli.
3. GuruBK/Konselordapatmenunjukkandalam
perencanaanlayananBK,sesuaidengan
keragamanlatarbelakangbudaya,ekonomi,dan
sosialpesertadidik/konseli.
Totalskoruntukkompetensi1
Skormaksimumkompetensi1=jumlahindikator2
Persentase=(totalskor/6)100%
Nilaiuntukkompetensi1
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

2
(26)

(27)
6(28)
(29)

(30)

109

Kompetensi2:Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilakukonseli
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

PenilaianuntukKompetensi2:Mengaplikasikanperkembanganfisiologisdanpsikologisserta
perilakukonseli.
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. Pesertadidik/konselidiberikesempatandalam
0
1
2
memperolehlayananBKsesuaidengankebutuhan
perkembanganmental,emosional,fisik,dangender.
2. Pesertadidik/konselidiberikesempatandalam
0
1
2
memperolehlayananBKsesuaidengankebutuhan
bakat,minat,danpotensipribadi.
3. Pesertadidik/konselidiberikesempatandalam
0
1
2
memperolehlayananBKsesuaidenganharapan
untukmelanjutkanpendidikandanpilihankarir.
Totalskoruntukkompetensi2
(27)
Skormaksimumkompetensi2=jumlah110indikator2 6(28)
Persentase=(totalskor/6)100%
(29)
Nilaiuntukkompetensi2

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

110

(26)

Kompetensi3 :Menguasaiesensipelayananbimbingandankonselingdalamjalur,

jenis,danjenjangsatuanpendidikan
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

21)

PenilaianuntukKompetensi3:Menguasaiesensipelayananbimbingandankonselingjalur,
jenis,danjenjangsatuanpendidikan.
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. LayananBKyangdiprogramkanolehguruBK/
Konselortelahmemenuhiesensilayananpadajalur
satuanpendidikanformal,nonformaldaninformal.
2. LayananBKyangdiprogramkanolehguruBK/
Konselortelahmemenuhiesensilayananpadajenis
satuanpendidikanumum,kejuruan,keagamaan,
dankhusus.
3. LayananBKyangdiprogramkanolehguruBK/
Konselortelahmemenuhiesensilayananpada
jenjangsatuanpendidikanusiadini,dasardan
menengah,sertatinggi.
Totalskoruntukkompetensi3
Skormaksimumkompetensi3=jumlahindikator2
Persentase=(totalskor/6)100%
Nilaiuntukkompetensi3
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

(26)

(27)
6(28)
(29)

(30)

111

Kompetensi4 :BerimandanbertakwakepadaTuhanYangMahaEsa
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi4:BerimandanbertakwakepadaTuhanYangMahaEsa.
Skor
Indikator

1. GuruBK/Konselorberpenampilanrapihdan
bersih.
2. GuruBK/Konselorberbicaradengansantundan
jujurkepadapesertadidik/konseli.
3. GuruBK/Konselorbersikapdanmendorong
kepadapesertadidik/konseliuntukbersikap
toleran.
4. GuruBK/Konselormemperlihatkankonsistensi
danmemotivasipesertadidik/konselidalam
melaksanakanibadah.
Totalskoruntukkompetensi4
Skormaksimumkompetensi4=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi4
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

(26)

(27)
8(28)
(29)

(30)

112

Kompetensi5 :Menghargaidanmenjunjungtingginilainilaikemanusiaan,

individualitasdankebebasanmemilih
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi5: Menghargaidan menjunjung tingginilainilaikemanusiaan,


individualitasdankebebasanmemilih.
Skor
Indikator

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

1. GuruBK/KonselormerencanakanlayananBKyang
mengacukepadapengaplikasianpandangan
dinamistentangmanusiasebagaimahlukbermoral
spiritual,sosial,&individu.
2. PelayananBKyangdirancangolehGuru
BK/Konselormendorongkepadapengembangan
potensipositifindividu.
3. RancanganpelayananBKmengacukepada
kebutuhandanmasukanbalikpeserta
didik/konseli.
4. PelayananBKdirancanguntukmengembangkan
sikaptolerandalammenjunjunghakazasimanusia
padapesertadidik/konseli.
Totalskoruntukkompetensi5
Skormaksimumkompetensi5=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi5
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

(26)

(27)
8(28)
(29)

(30)

113

Kompetensi6 :Menunjukkanintegritasdanstabilitaskepribadianyangkuat
NamaGuru
:(9)
NamaPenilai :(10)

Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(23)
(24)

(25)

PenilaianuntukKompetensi6:Menunjukkanintegritasdanstabilitaskepribadianyangkuat.
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

1. GuruBK/Konselormenunjukkankepribadian,
kestabilanemosidanperilakuyangterpuji,jujur,
sabar,ramah,dankonsisten.
2. GuruBK/Konselormenunjukkankepekaandan
bersikapempatiterhadapkeragamandan
perubahan.
3. GuruBK/Konselormenampilkantoleransitinggi
terhadappesertadidik/konseliyangmenghadapi
114tressdanfrustasi.
Totalskoruntukkompetensi6
Skormaksimumkompetensi6=jumlahindikator2
Persentase=(totalskor/6)100%
Nilaiuntukkompetensi6
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Terpenuhi
seluruhnya

(26)

(27)
6(28)
(29)

(30)

114

Kompetensi7 :Menampilkankinerjaberkualitastinggi
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan:

(21)

Tindaklanjutyangdiperlukan:

(22)

115

PenilaianuntukKompetensi7:Menampilkankinerjaberkualitastinggi.
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

1. GuruBK/Konselormemotivasipeserta
didik/konseliuntukberpartisipasiaktifdalam
layananBKyangdiberikan.
2. Guru BK/Konselor melaksanakan pelayanan BK
yang efektif sesuai dengan rancangan untuk
mencapaitujuanpelayananBKdalamwaktuyang
tersedia.
3. GuruBK/KonselormelaksanakantugaslayananBK
secaramandiri,disiplin,dansemangatagar
pesertadidik/konseliberpartisipasisecaraaktif.
Totalskoruntukkompetensi7
Skormaksimumkompetensi7=jumlahindikator2
Persentase=(totalskor/6)100%
Nilaiuntukkompetensi7
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Terpenuhi
seluruhnya

(26)

(27)
6(28)
(29)

(30)

116

Kompetensi8 :Mengimplementasikankolaborasiinternalditempatbekerja
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(19)
Dokumendanbahanlain
(20)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(21)

Penilaian untuk Kompetensi 8: Mengimplementasikan kolaborasi internal di tempat


bekerja.
Skor
Indikator

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

1. Gurulaindapatmenunjukkancontohpenggunaan
hasilpelayananBKuntukmembantupeserta
0
1
2
didik/konselidalamprosespembelajaranyang
dilakukannya.
2. GuruBK/KonselormerencanakanpelayananBK
denganmenyertakanpihakpihakterkaitdi
0
1
2
sekolah.
3. GuruBK/Konselordapatmenunjukkanbukti

bagaimanamenjelaskanprogramdanhasil
0
1
2
layananBKkepadapihakpihakterkaitdisekolah.
4. GuruBK/Konselordapatmenunjukkanbukti
permintaangurulainuntukmembantu
0
1
2
penyelesaianpermasalahanpembelajaran.
Totalskoruntukkompetensi8
(27)
Skormaksimumkompetensi8=jumlahindikator2 8(28)
Persentase=(totalskor/8)100%
(29)
Nilaiuntukkompetensi8

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

(26)

117

Kompetensi9 :BerperandalamorganisasidankegiatanprofesiBK
NamaGuru
:(9)
NamaPenilai :(10)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi9:BerperandalamorganisasidankegiatanprofesiBK.
Skor
Indikator

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

1. GuruBK/KonselormentaatiKodeEtikorganisasi

profesiBK(sepertiMGBK,ABKIN,atauorganisasi
0
1
2
profesisejenislainnya).
2. GuruBK/Konselorberpartisipasiaktifdalam

prosespengembangandirimelaluiorganisasi
0
1
2
profesiguruBK/Konselor.
3. GuruBK/Konselordapatmemanfaatkan
organisasiprofesiBK/Konseloruntukmembangun
0
1
2
kolaborasidalampengembanganprogramBK.
Totalskoruntukkompetensi9
(27)
Skormaksimumkompetensi9=jumlahindikator2 6(28)
Persentase=(totalskor/6)100%
(29)
Nilaiuntukkompetensi9

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

(26)

118

Kompetensi10:Mengimplementasikankolaborasiantarprofesi
NamaGuru
:(9)
NamaPenilai :(10)

Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
Catatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(25)

PenilaianuntukKompetensi10:Mengimplementasikankolaborasiantarprofesi.
Skor
Indikator
1. GuruBK/Konselordapatmenunjukkanbukti
melakukaninteraksidenganorganisasiprofesilain.
2. GuruBK/Konselordapatberkolaborasidengan
institusiatauprofesilainuntukmencapaitujuan
pelayananBK.
3. GuruBK/Konselordapatmemanfaatkankeahlian
lainuntukmembantupenyelesaianpermasalahan
pesertadidik/konselisesuaikebutuhan.
4. GuruBK/Konselordapatmenunjukkanbukti
melakukaninteraksidenganorganisasiprofesilain.
Totalskoruntukkompetensi10
Skormaksimumkompetensi10=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi10
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

(26)

(27)
8(28)
(29)

(30)

119

Kompetensi11:Menguasaikonsepdanpraksispenilaian(assessment)untukmemahamikondisi,
kebutuhan,danmasalahkonseli
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
(23)
Dokumendanbahanlain
(24)
yangdiperiksa
Catatan:TanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)
(25)

Penilaian untuk Kompetensi 11: Menguasai konsep dan praksis penilaian (assessment) untuk
memahamikondisi,kebutuhan,danmasalahkonseli.
Skor
Tidakada
Indikator
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)
1. GuruBK/Konselordapatmengembangkaninstrumennon
tes (pedoman wawancara, angket, atau format lainnya)
0
1
2
untukkeperluanpelayananBK.
2. Guru BK/Konselor dapat mengaplikasikan instrumen non
tes untuk mengungkapkan kondisi aktual peserta
0
1
2
didik/konseliberkaitandenganlingkungan.
3. Guru BK/Konselor dapat mendeskripsikan penilaian yang
digunakan dalam pelayanan BK yang sesuai dengan
0
1
2
kebutuhanpesertadidik/konseli.
4. Guru BK/Konselor dapat memilih jenis penilaian
(Instrumen Tugas Perkembangan/ITP, Alat Ungkap

Masalah/AUM,DaftarCekMasalah/DCM,atauinstrumen
0
1
2
nontes lainnya) yang sesuai dengan kebutuhan layanan
bimbingandankonseling.
5. Guru BK/Konselor dapat mengadministrasikan penilaian
(merencanakan, melaksanakan, mengolah data) untuk
0
1
2
mengungkapkan kemampuan dasar dan kecenderungan
pribadipesertadidik/konseli.
6. Guru BK/Konselor dapat mengadministrasikan penilaian
(merencanakan, melaksanakan, mengolah data) untuk
mengungkapkan masalah peserta didik/konseli (data
0
1
2
catatan pribadi, kemampuan akademik, hasil evaluasi
belajar,danhasilpsikotes).
7. Guru BK/Konselor dapat menampilkan tanggung jawab
profesionalsesuaidenganazasBK(misalnyakerahasiaan,
0
1
2
keterbukaan,kemutakhiran,dll.)dalampraktikpenilaian.
Totalskoruntukkompetensi11
(27)
Skormaksimumkompetensi11=jumlahindikator2
14(28)
Persentase=(totalskor/14)100%
(29)
Nilaiuntukkompetensi11

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

120

(26)

Kompetensi12:MenguasaikerangkateoretikdanpraksisBK
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(11)
(12)

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan:

(15)
(16)

(17)
Tindaklanjutyangdiperlukan:

(18)

Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(23)
(24)

(25)

121

PenilaianuntukKompetensi12:MenguasaikerangkateoretikdanpraksisBK.
Skor
Indikator

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

1. GuruBK/Konselordapatmengaplikasikanhakikat
pelayananBK(tujuan,prinsip,azas,fungsi,dan
0
1
2
landasan).
2. GuruBK/Konselordapatmenentukankanarah

profesibimbingandankonseling(peransebagaiguru
0
1
2
BK/konselor).
3. GuruBK/Konselordapatmengaplikasikandasar
0
1
2
dasarpelayananBK.
4. GuruBK/Konselordapatmengaplikasikanpelayanan
0
1
2
BKsesuaikondisidantuntutanwilayahkerja.
5. GuruBK/Konselordapatmengaplikasikan
pendekatan/model/jenispelayanandankegiatan
0
1
2
pendukungbimbingandankonseling.
6. GuruBK/Konselordapatmengaplikasikanpraktik
0
1
2
format(kegiatan)pelayananBK.
Totalskoruntukkompetensi12
(27)
Skormaksimumkompetensi12=jumlahindikator2
12(28)
Persentase=(totalskor/12)100%
(29)
Nilaiuntukkompetensi12

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

122

(26)

Kompetensi13:MerancangprogramBK
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
(11)
Dokumendanbahanlain
(12)
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
(15)
Dokumendanbahanlain
(16)
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidik/konseliselamapengamatan:

(17)
Tindaklanjutyangdiperlukan:

(18)

SetelahPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan:

(19)
(20)

(21)
Tindaklanjutyangdiperlukan:

(22)

123

PenilaianuntukKompetensi13:MerancangprogramBK.
Skor
Indikator
1. GuruBK/Konselordapatmenganalisiskebutuhan
pesertadidik/konseli.
2. GuruBK/Konselordapatmenyusunprogram
pelayananBKyangberkelanjutanberdasar
kebutuhanpesertadidik/konselisecara
komprehensifdenganpendekatanperkembangan.
3. GuruBK/Konselordapatmenyusunrencana
pelaksanaanprogrampelayananBK.
4. GuruBK/Konselordapatmerencanakansaranadan
biayapenyelenggaraanprogrampelayananBK.
Totalskoruntukkompetensi13
Skormaksimumkompetensi13=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi13
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi
bukti(Tidak
sebagian
terpenuhi)

Terpenuhi
seluruhnya

2
(26)

(27)
8(28)
(29)

(30)

124

Kompetensi14:MengimplementasikanprogramBKyangkomprehensif
NamaGuru
:(9)
NamaPenilai :(10)

SebelumPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
TanggapanPenilaiterhadapdokumendan/atauketeranganguru:

(11)
(12)

(13)
Tindaklanjutyangdiperlukan:

(14)

SelamaPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Kegiatan/aktivitasgurudanpesertadidikselamapengamatan:

(15)
(16)

(17)
Tindaklanjutyangdiperlukan:

(18)
SetelahPengamatan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Tanggapan/jawabanguruterhadappertanyaan/klarifikasipenilaiselamapertemuan:

(19)
(20)

(21)
Tindaklanjutyangdiperlukan:

(22)

125

PenilaianuntukKompetensi14:MengimplementasikanprogramBKyangkomprehensif.
Skor
Indikator
1. GuruBK/Konselordapatmelaksanakanprogram
pelayananBK.
2. GuruBK/Konselordapatmelaksanakanpendekatan
kolaboratifdenganpihakterkaitdalampelayanan
BK.
3. GuruBK/Konselordapatmemfasilitasi
perkembanganakademik,karier,personal/pribadi,
dansosialpesertadidik/konseli.
4. GuruBK/Konselordapatmengelolasaranadanbiaya
programpelayananBK.
Totalskoruntukkompetensi14
Skormaksimumkompetensi14=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi14
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

(26)

(27)
8(28)
(29)

(30)

126

Kompetensi15:MenilaiprosesdanhasilkegiatanBK
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Tanggapandankegiatan/aktivitasguruselamapemantauan:

(23)
(24)

(25)

PenilaianuntukKompetensi15:MenilaiprosesdanhasilkegiatanBK.
Skor
Indikator
1. GuruBK/Konselordapatmelakukanevaluasiproses
danhasilprogrampelayananBK.
2. GuruBK/Konselordapatmelakukanpenyesuaian
kebutuhanpesertadidik/konselidalamproses
pelayananBK.
3. GuruBK/Konselordapatmenginformasikanhasil
pelaksanaanevaluasipelayananBKkepadapihak
terkait.
4. GuruBK/Konselordapatmenggunakanhasil
pelaksanaanevaluasiuntukmerevisidan
mengembangkanprogrampelayananBK
berdasarkananalisiskebutuhan.
Totalskoruntukkompetensi15
Skormaksimumkompetensi15=jumlahindikator2
Persentase=(totalskor/8)100%
Nilaiuntukkompetensi15
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

2
(26)

(27)
8(28)
(29)

(30)

127

Kompetensi16:Memilikikesadarandankomitmenterhadapetika128professional
NamaGuru
:(9)
NamaPenilai :(10)
Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
Tanggapandankegiatan/aktivitasguruselamapemantauan:

(23)
(24)

(25)

PenilaianuntukKompetensi16:Memilikikesadarandankomitmenterhadapetika
professional.
Skor
Indikator
1. GuruBK/Konselordapatmemberdayakankekuatan
pribadi,dankeprofesionalanguruBK/konselor.
2. GuruBK/Konselordapatmeminimalisirdampak
lingkungandanketerbatasanpribadiguru
BK/konselor.
3. GuruBK/Konselordapatmenyelenggarakan
pelayananBKsesuaidengankewenangan128rofessi
etikp128rofesionalguruBK/konselor.
4. GuruBK/Konselordapatmempertahankan
objektivitasdanmenjagaagartidaklarutdengan
masalahpesertadidik/konseli.
5. GuruBK/Konselordapatmelaksanakanlayanan
pendukungsesuaikebutuhanpesertadidik/konseli
(misalnyaalihtangankasus,kunjunganrumah,
konferensikasus,128instrumenbimbingan,
himpunandata).
6. GuruBK/Konselordapatmenghargaiidentitas
p128rofesionaldanpengembanganprofesi.
7. GuruBK/Konselordapatmendahulukankepentingan
pesertadidik/konselidaripadakepentinganpribadi
guruBK/konselor.
Totalskoruntukkompetensi16
Skormaksimumkompetensi16=jumlahindikator2
Persentase=(totalskor/14)100%
Nilaiuntukkompetensi16
(0%<X25%=1;25%<X50%=2;
50%<X75%=3;75%<X100%=4)

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

(26)

(27)
14(28)
(29)

(30)

128

Kompetensi17:MenguasaikonsepdanpraksispenelitiandalamBK
NamaGuru
:(9)
NamaPenilai :(10)

Pemantauan
Tanggal
Dokumendanbahanlain
yangdiperiksa
CatatandanTanggapanPenilaiterhadapdokumendan/atauketeranganguru
(catatkegiatanyangdilakukan)

(23)
(24)

(25)

129

PenilaianuntukKompetensi17:MenguasaikonsepdanpraksispenelitiandalamBK.
Skor
Indikator

Tidakada
Terpenuhi Terpenuhi
bukti(Tidak
sebagian Seluruhnya
terpenuhi)

1. GuruBK/Konselordapatmendeskripsikanjenisdan

0
1
2
metodepenelitiandalamBK.
2. Guru BK/Konselor mampu merancang penelitian
0
1
2
dalamBK.
3. GuruBK/Konselordapatmelaksanakanpenelitian
0
1
2
dalamBK.
4. GuruBK/Konselordapatmemanfaatkanhasil
0
1
2
penelitiandalamBKdenganmengaksesjurnalyang
relevan.
Totalskoruntukkompetensi17
(27)
Skormaksimumkompetensi17=jumlahindikator2 8(28)
Persentase=(totalskor/8)100%
(29)
Nilaiuntukkompetensi17

(0%<X25%=1;25%<X50%=2;
(30)
50%<X75%=3;75%<X100%=4)

130

(26)

PETUNJUKPENGISIANFORMAT2B
NO NOMOR
URAIAN
KODE
1
2
3
1.
(1)
TulislahnamaPegawaiNegeriSipilyangdinilaisesuaidenganyangtercantum
dalamSKpengangkatanpertamasebagaiCPNS.
2.
(2)
TulislahNomorIndukPegawaidanNomorKarpegPNSyangbersangkutan.
3.
(3)
Tulislah pangkat dan golongan ruang terakhir PNS tersebut terhitung mulai
tanggalberlakunyaSK.
4.
(4)
Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan) yang
merupakan Nomor Registrasi bagi Pendidik dan Tenaga Kependidikan pada
jalur pendidikan formal maupun nonformal jenjang pendidikan dasar dan
menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK dan PLB, serta
nomor registrasi guru/setelah guru yang bersangkutan memiliki sertifikat
pendidik(NRG).
5.
(5)
Tulislah dengan jelas Nama Sekolah tempat guru bekerja berikut alamatnya
sebagaiSatuanAdministrasiPangkalguruyangbersangkutan.
6.
(6)
Tulislah sejak kapan guru bekerja pada sekolah sebagai Satuan Admimistrasi
Pangkalyangbersangkutan.
7.
(7)
Tulislahwaktumulaidilakukanpenilaiandanakhirpelaksanaanpenilaianbagi
gurutermaksudpadatahunajarantertentu.
8.
(8)
Tulislah nama guru yang dinilai dan nama penilai yang melakukan penilaian
kinerja guru, selanjutnya tandatangani secara bersama pada ruang yang
tersedia sebagai tanda persetujuan bersama terhadap hasil penilaian, serta
tulis tanggal bulan dan tahun saat menyatakan persetujuan terhadap hasil
penilaian.
9.
(9)
CukupJelas.
10.
(10)
CukupJelas.
11.
(11)
Tulislahtanggalsaatmelakukanpengamatanterhadapguruyangdinilaidan
pengamatanterhadapdokumendokumenyangdiperlukandalampenilaian.
12.
(12)
Tuliskandokumendanbahanapasajayangdiperiksa.
13.
(13)
Tulislahtanggapanpenilaiterhadapdokumendanbahanyangtelahdiperiksa
sertatanggapanguruataspertanyaanyangdiajukanolehpenilai.
14.
(14)
Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah memeriksa
dokumen,bahan,danberdiskusidenganguruyangdinilai.
15.
(15)
Tulislah tanggal saat melakukan pengamatan terhadap kegiatan guru dalam
pelaksanaanprosesbimbingandankonseling.
16.
(16)
Tulislah dokumen dan bahan lain yang juga diamati selama melakukan
pengamatan kegiatan guru dalam melaksanakan proses bimbingan dan
konseling.

17.
(17)
Tulislah tanggapan terhadap aktivitas guru dan peserta didik selama masa
pengamatandalamprosesbimbingandankonseling.
18.
(18)
Tulislah halhal yang perlu ditindaklanjuti oleh penilai setelah melakukan
pengamatanprosesbimbingandankonseling.
19.
(19)
Tulislah tanggal saat melakukan diskusi dengan guru setelah melakukan
pengamatan terhadap kegiatan guru dalam melaksanakan proses bimbingan
dankonseling.
20.
(20)
Tulislah dokumen dan bahan pendukung yang diperiksa setelah melakukan
pengamatan terhadap kegiatan guru dalam melaksanakan proses bimbingan
dankonseling.

131

NO
21.

NOMOR
KODE
(21)

22.

(22)

23.
24.

(23)
(24)

25.

(25)

26.

(26)

27.
28.
29.

(27)
(28)
(29)

30.

(30)

URAIAN
Tulislahtanggapanpenilaiterhadapdokumenyangdiperlukandantanggapan
guru terhadap pertanyaanpertanyaan yang diberikan oleh penilai terkait
denganpelaksanaankegiatanprosesbimbingandankonseling.
Tulislah tindak lanjut yang diperlukan oleh penilai untuk meningkatkan
kualitasgurudalampelaksanaanprosesbimbingandankonseling.
Tulislahtanggalsaatmelakukanpemantauanterhadapguruyangyangdinilai.
Tulislah dokumen dan/atau bahan yang diperiksa selama melakukan
pemantauanterhadapguruyangdinilai.
Tulislah tanggapan penilai terhadap hasil pemantauan kegiatan guru yang
dinilai.
Berikanskor0atau1atau2terhadapindikatorindikatoryangmenunjukkan
kompetensi guru yang dinilai sebagai hasil evaluasi terhadap dokumen dan
tanggapangurusebelumpengamatandan/atauselamapengamatandan/atau
setelahpengamatandan/ataupemantauan.
Tulislahtotalhasilskorsetiapindikatorpadakompetensiyangbersangkutan.
Angkainimenunjukkanskormaksimumpadakompetensitertentu.
Hitungdantulislahhasilpenilaiankompetensitertentudengancaramembagi
total skor yang diperoleh (nomor kode 27) dengan skor maksimum pada
kompetensitertentu(nomorkode28)dikalikanseratuspersen(100%).
Tulislahnilaikinerjagurudenganmengkonversihasilpersentase(nomorkode
29) ke dalam angka 1 atau 2 atau 3 atau 4 dengan menggunakan ketentuan
perhitungansebagaiberikut:
Nilai1untuk0%<X<25%
Nilai2untuk25%<X<50%
Nilai3untuk50%<X<75%
Nilai4untuk75%<X<100%

132

Lampiran2C
REKAPHASILPENILAIANKINERJAGURUBIMBINGANDANKONSELING/KONSELOR
a. Nama

:........................(1)
NIP

:........................(2)
Tempat/TanggalLahir
:/.........................(3)
Pangkat/Jabatan/Golongan
:........................(4)
TMTsebagaiguru

:........................(5)
MasaKerja

:........Tahun..Bulan(6)
JenisKelamin

:L/P(7)
PendidikanTerakhir/Spesialisasi:..........................(8)
ProgramKeahlianyangdiampu :.........................(9)
b. NamaInstansi/Sekolah

:.........................(10)
Telp/Fax

:.........................(11)
Kelurahan

:.........................(12)
Kecamatan

:.........................(13)
Kabupaten/kota

:.........................(14)
Provinsi

:.........................(15)

Periodepenilaian(16)
..........sampai..........
(tanggal,bulan,tahun)(tanggal,bulan,tahun)

Formatif
Sumatif
Kemajuan

(18)
(19)

Tahun(20)
..

No.

Kompetensi

Nilai*)

Pedagogik
1
2
3

Menguasaiteoridanpraksispendidikan.
Mengaplikasikanperkembanganfisiologisdanpsikologissertaperilakukonseli.
MenguasaiesensipelayananBKdalamjalur,jenis,danjenjangsatuanpendidikaan.

Kepribadian
v4
5

BerimandanbertakwakepadaTuhanYangMahaEsa.
Menghargaidanmenjunjungtingginilainilaikemanusian,individualitasdan
kebebasanmemilih.
Menunjukkanintegritasdanstabilitaskepribadianyangkuat.
Menampilkankenerjaberkualitastinggi.

Mengimplimentasikankolaborasiinternalditempatbekerja.

9
10

BerperandalamorganisasidankegiatanprofesiBK.
Mengimplimentasikolaborasiantarprofesi.

6
7

Sosial
(26)

Profesional
11
12
13
14
15
16
17

Menguasaikonsepdanpraksispenilaian(assessment) untukmemahamikondisi,
kebutuhandanmasalahkonseli.
MenguasaikerangkateoritikdanpraksisBK.
MerancangprogramBK.
MengimplementasikanprogramBKyangkomprehensif.
Menilaiprosesdanhasilkegiatanbimbingandankonseling.
Memilikikesadarandankomitmenterhadapetikaprofesional.
Menguasaikonsepdanpraksispenelitiandalam BK.

Jumlah(Hasilpenilaiankinerjaguru)

(22)

*)Nilaidiisiberdasarkanlaporandanevaluasi.Nilaiminimumperkompetensi=1dannilaimaksimum=4.

.,(23)
Guruyangdinilai

Penilai

KepalaSekolah

(........................(24))

(...............................(25))
(.............................(26))

133

PETUNJUKPENGISIANFORMAT2C
NO NOMOR
URAIAN

KODE
1
2
3
1.
(1)
Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK
pengangkatansebagaiguru.
2.
(2)
TulislahNomorIndukPegawaiguruyangbersangkutan.
3.
(3)
TulislahtempatdantanggallahirguruyangdinilaisesuaiSKpengangkatan.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitung
mulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan
berdasarkanSKpengangkatansebagaiguru.
6.
(6)
Tulislahsejakkapan(berapatahundanberapabulan)gurutersebutbertugas.
7.
(7)
TulislahjeniskelamindariguruyangdinilaidengancaramencorethurufLatauP.
8.
(8)
Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya.
9.
(9)
Tulislahprogramkeahlianyangdiampuguruyangdinilai.
10.
(10)
Tulislahnamainstansiatausekolahguruyangdinilai.
11.
(11)
Tuliskannomordanfaxsekolah(jikaada).
12.
(12)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
13.
(13)
Tuliskankecamatandimanasekolah/madrasahberlokasi.
14.
(14)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
15.
(15)
Tuliskanprovinsidimanasekolah/madrasahberlokasi.
16.
(16)
Tulislah kapan guru mulai dilakukan penilaian dan kapan berakhirnya proses
penilaianbagigurutersebutpadatahunajaranyangbersangkutan.
17.
(17)
Pilihlahdenganmemberitandacentangvpadakolomyangsesuai,penilaian
formatif(awaltahunajaran),sumatif(akhirtahunajaran),ataupenilaian
18.
(18)
kemajuansetelahgurumelaksanakanPKBuntukmemperbaikikinerjanya.
19.
(19)
20.
(20)
Tulislahtahunajaranpelaksanaanpenilaian.
21.
(21)
Tulislahhasilpenilaianguruyangmerupakanhasilpenilaiankinerjagurudengan
menggunakanformat1B.
22.
(22)
Jumlahkanhasilnilaiuntuksemuakompetensiguru,sehinggamemberikanhasil
nilai kinerja guru. Bila penilaian ini adalah penilaian sumatif, maka nilai inilah
yang kemudian dikonversikan ke dalam perolehan angka kredit guru sesuai
PermennegpandanRB16/2009.
23.
(23)
Tulislahtempatdantanggaldilakukannyapengisianformatini.
24.
(24)
Isilahdengantandatangandannamaguruyangdinilaisebagaibuktibahwaguru
telahmengetahuidansetujudenganhasilnilaiyangdiperoleh.
25.
(25)
Isilahdengantandatangandannamapenilai.
26.
(26)
Isilah dengan tandatangan dan nama kepala sekolah tempat guru bekerja,
sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasil
nilaikinerjaguru.

134

Lampiran2D
FORMATPENGHITUNGANANGKAKREDITPKGURUBIMBINGANDANKONSELING/KONSELOR
a. Nama

:........................(1)
NIP

:........................(2)
Tempat/TanggalLahir

:/.........................(3)
Pangkat/Jabatan/Golongan
:........................(4)
TMTsebagaiguru

:........................(5)
MasaKerja

:........Tahun..Bulan(6)
JenisKelamin

:L/P(7)
PendidikanTerakhir/Spesialisasi :.........................(8)
:........................(9)
ProgramKeahlianyangdiampu
b. NamaInstansi/Sekolah

:......................(10)
Telp/Fax

:.......................(11)
Kelurahan

:.......................(12)
Kecamatan

:.......................(13)
Kabupaten/kota

:.......................(14)
Provinsi

:......................(15)

NilaiPKGURUBimbingandanKonseling/Konselor.
(16)

KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPAN&RM
(17)
No.16Tahun2009denganrumus:

Nilai PKG
Nilai PKG (100) =
100
Nilai PKG tertinggi
Berdasarkanhasilkonversikedalamskalanilaisesuaidenganperaturan

tersebut,selanjutnyaditetapkansebutandanprosentaseangkakreditnya.
(18)
Perolehanangkakredit(bimbingandankonseling/konselor)yangdihitung

berdasarkanrumusberikutini.
(19)
AngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4

Jakarta..........................................,..............(20)

Guruyangdinilai

Penilai

KepalaSekolah

(........................(21))

(..........................(22))
(.............................(23))

135

PETUNJUKPENGISIANFORMAT2D
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama guru yang dinilai sesuai dengan yang tercantum dalam SK
pengangkatansebagaiguru.
2.
(2)
TulislahNomorIndukPegawaiguruyangbersangkutan.
3.
(3)
TulislahtempatdantanggallahirguruyangdinilaisesuaiSKpengangkatan
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir guru tersebut terhitung
mulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/ golongan
berdasarkanSKpengangkatansebagaiguru.
6.
(6)
Tulislahsejakkapan(berapatahundanberapabulan)gurutersebutbertugas.
7.
(7)
TulislahjeniskelamindariguruyangdinilaidengancaramencorethurufLatauP.
8.
(8)
Tulislahkualifikasipendidikanterakhirgurubesertaspesialisasinya.
9.
(9)
Tulislahprogramkeahlianyangdiampuguruyangdinilai.
10.
(10)
Tulislahnamainstansiatausekolahguruyangdinilai.
11.
(11)
Tuliskannomordanfaxsekolah(jikaada).
12.
(12)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
13.
(13)
Tuliskankecamatandimanasekolah/madrasahberlokasi.
14.
(14)
Tuliskankelurahandimanasekolah/madrasahberlokasi.
15.
(15)
Tuliskanprovinsidimanasekolah/madrasahberlokasi.
16
(16)
DiisidenganhasilPKGURUsesuaidenganhasilPKGURUpadaformatrekapPK
GURU.
17
(17)
DiisidenganPK(GURU)yangtelahdikonversikankedalamskala0100sesuai
denganPermennegPANdanRBNo.16Tahun2009melaluiperhitungandengan
menggunakanrumustersebut.
18
(18)
DiisidengansebutandanprosentaseangkakreditdarihasilPKGURUyangtelah
dikonversikan dalam skala 0 100 sebagaimana ditetapkan dalam Permenneg
PANdanRBNo.16Tahun2009.

19
(19)
diisikan dengan perolehan angka kredit per tahun yang dihitung berdasarkan
rumus sistem paket tersebut sesuai permen tersebut. (Ingat JM adalah jumlah
konseli yang dibimbing oleh guru BK/Konselor dan JWM adalah jumlah konseli
yangwajibdibimbingsesuaiperaturan.
RumusAngkaKreditsatutahun=(AKKAKPKBAKP)x(JM/JWM)xNPK
4

20
(20)
Tulislahtempatdantanggaldilakukannyapengisianformatini.
21
(21)
Isilahdengantandatangandannamaguruyangdinilaisebagaibuktibahwaguru
telahmengetahuidansetujudenganestimasihasilnilaiyangdiperoleh.
22
(22)
Isilahdengantandatangandannamapenilai
23
(23)
Isilah dengan tanda tangan dan nama kepala sekolah tempat guru bekerja,
sebagai bukti bahwa kepala sekolah telah mengetahui dan setuju dengan hasil
nilaikinerjaguru.

136

LAMPIRAN3

INSTRUMENPKGURU
DENGANTUGASTAMBAHANYANGRELEVAN
DENGANFUNGSISEKOLAH/MADRASAH

137

Lampiran3A
INSTRUMENPENILAIANKINERJAKEPALASEKOLAH(IPPKS)

A. PETUNJUKPENILAIAN
1. Penilaian kinerja kepala sekolah merupakan penilaian berbasis bukti dan
menggunakanpendekatan360.
2. Buktibuktidapatberupadata,dokumen,kondisilingkunganfisiksekolah,perilakudan
budaya dan lainlain yang dapat diidentifikasi oleh penilaian melalui pengkajian,
pengamatan,danpenggalianinformasidaripihakpihakyangterkaitdisekolahseperti
guru,pegawai,komitesekolah,danpesertadidik.
3. Penilaiharusmencatatsemuabuktiyangteridentifikasipadatempatyangdisediakan
padamasingmasingkriteriapenilaian.Buktibuktiyangdimaksuddapatberupa:
a. Buktiyangteramati(tangibleevidences)seperti:
Dokumendokumentertulis.
Kondisi srana/prasarana (hardware dan/atau software) dan lingkungan
sekolah.
Foto,gambar,slide,video.
Produkproduksiswa.
b. Buktiyangtakteramati(intangibleevidences)seperti
Sikapdanperilakukepalasekolah.
Budayadaniklimsekolah.
Buktibuktiinidapatdiperolehmelaluipengamatan,wawancaradenganpemangku
kepentingan pendidikan (guru, komite, siswa, mitra dunia usaha dan dunia
industri).
4. Penilaian dilakukan dengan cara memberikan skor pada masingmasing kriteria
berdasarkankelengkapandankeabsahanbuktiyangrelevendanteridentifikasi.
5. Skor penilaian dinyatakan dengan angka 4, 3, 2, atau 1 dengan ketentuan sebagai
berikut:
a. Skor 4 diberikan apabila kepala sekolah mampu menunjukkan buktibukti yang
lengkap dan sangat meyakinkan bahwa kepala sekolah yang bersangkutan
berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai.
b. Skor 3 diberikan apabila kepala sekolah mampu menunjukkan buktibukti yang
lengkap dan cukup meyakinkan bahwa kepala sekolah yang bersangkutan
berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai.
c. Skor 2 diberikan apabila kepala sekolah menunjukkan buktibukti yang kurang
lengkap dan cukup meyakinkan bahwa yang bersangkutan berkinerja sesuai
denganmasingmasingkriteriakomponenyangdinilai.
d. Skor 1 diberikan apabila ditemukan bukti yang sangat terbatas dan kurang
meyakinkanatautidakditemukanbuktibahwakepalasekolahyangbersangkutan
berkinerjasesuaidenganmasingmasingkriteriakomponenyangdinilai.

6. HasilPenilaiandinyatakanrentangnilai1sampaidengan100yangdibedakanmenjadi
empat kategori penilaian yaitu Amat Baik, Baik, Cukup, Sedang dan Kurang
denganketentuansebagaiberikut:

138

NKKS

Kategori

91100
AmatBaik
7690
Baik
6175
Cukup
5160
Sedang
50
Kurang
Untuk menentukan nilai akhir diperlukan konversi dari Skor penilaian yang memiliki
rentangan 6 sampai dengan 24 menjadi Nilai Kinerja Kepala Sekolah/Madrasah
(NKKS/M) dengan rentangan 25 sampai dengan 100 dengan menggunakan rumus
sebagaiberikut:
NKKS = Total Skor Rata-Rata/ 24 x 100

139

B. FORMATIDENTITASDIRI

IDENTITASKEPALASEKOLAHYANGDINILAI
a. Nama

:........................(1)
NIP/No.SeriKarpeg

:/......................(2)
Tempat/TanggalLahir
:/.........................(3)
Pangkat/Jabatan/Golongan
:........................(4)
TMTsebagaiguru/Kepala
Sekolah

:/........................(5)
NUPTK/NRG

:/........................(6)
MasaKerja

:Tahun......Bulan(7)
JenisKelamin

:
L/P(8)
PendidikanTerakhir/Spesialisasi :..........................(9)
ProgramKeahlianyangdiampu :........................(10)
b. NamaInstansi/Sekolah
:.........................(11)
Telp/Fax

:.........................(12)
Kelurahan

:........................(13)
Kecamatan

:.........................(14)
Kota/Kabupaten

:........................(15)
Provinsi

:.......................(16)
IDENTITASPENILAI
a. Nama

:........................(17)
NIP

:........................(18)
b. SKPenugasan(Jikaada)
Nomor

:........................(19)
Tanggal

:........................(20)
Berlakusampaidengan
:........................(21)

.,,.........(22)
Penilai,

KepalaSekolahyangdinilai,

.................................

..(23)
NIP.......

NIP....

140

C. FORMATPENILAIANKINERJA

1. Kompetensi
:KepribadiandanSosial(PKKS1)
BUKTIYANG
SKOR
KRITERIA
TERIDENTIFIKASI(24)
(25)
1. Berakhlakmulia,mengembangkanbudaya

1234
dantradisiakhlakmulia,danmenjadi
teladanakhlakmuliabagikomunitasdi
sekolah/madrasah.
2. Melaksanakantugaspokokdanfungsi

1234
sebagaikepalasekolahdenganpenuh
kejujuran,ketulusan,komitmen,dan
integritas.
3. Bersikapterbukadalammelaksanakantugas
1234
pokokdanfungsisebagaikepala
sekolah/madrasah.
4. Mengendalikandiridalammenghadapi

1234
masalahdantantangansebagaikepala
sekolah/madrasah.
5. Berpartisipasidalamkegiatansosial

1234
kemasyarakatan.
6. Tanggapdanpeduliterhadapkepentingan

1234
orangataukelompoklain.
7. Mengembangkandanmengelolahubungan
1234
sekolah/madrasahdenganpihaklaindiluar
sekolahdalamrangkamendapatkan
dukunganide,sumberbelajar,dan
pembiayaansekolah/madrasah.
JumlahSkor
(26)
SKORRATARATA=JUMLAHSKOR:7=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

141

2. Kompetensi

:KepemimpinanPembelajaran(PKKS2)

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Bertindaksesuaidenganvisidanmisi

1234
sekolah/madrasah.
2. Merumuskantujuanyangmenantangdiri

1234
sendiridanoranglainuntukmencapai
standardyangtinggi.
3. Mengembangkansekolah/madrasah

1234
menujuorganisasipembelajar(learning
organization).
4. Menciptakanbudayadaniklim

1234
sekolah/madrasahyangkondusifdan
inovatifbagipembelajaran.
5. Memegangteguhtujuansekolahdengan

1234
menjadicontohdanbertindaksebagai
pemimpinpembelajaran
6. Melaksanakankepemimpinanyang

1234
inspiratif.
7. Membangunrasasalingpercayadan

1234
memfasilitasikerjasamadalamrangka
untukmenciptakankolaborasiyangkuat
diantarawargasekolah/madrasah
8. Bekerjakerasuntukmencapaikeberhasilan
1234
sekolah/madrasahsebagaiorganisasi
pembelajaryangefektif.
9. Mengembangankurikulumdankegiatan

1234
pembelajaransesuaidenganvisi,misi,dan
tujuansekolah.
10. Mengelolapesertadidikdalamrangka

1234
pengembangankapasitasnyasecara
optimal.
JumlahSkor
(26)
SKORRATARATA=JUMLAHSKOR:10=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

142

3. Kompetensi

:PengembanganSekolah(PKKS3)
KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Menyusunrencanapengembangan
1234
sekolah/madrasahjangkapanjang,menengah,
danpendekdalamrangkamencapaivisi,misi,
dantujuansekolah/madrasah.
2. Mengembangkanstrukturorganisasisekolah/

1234
madrasahyangefektifdanefisiensesuai
dengankebutuhan.
3. Melaksanakanpengembangansekolah/

1234
madrasahsesuaidenganrencanajangka
panjang,menengah,danjangkapendek
sekolahmenujutercapainyavisi,misi,dan
tujuansekolah.
4. Mewujudkanpeningkatankinerjasekolahyang
1234
signifikansesuaidenganvisi,misi,tujuan
sekolahdanstandardnasionalpendidikan.
5. Melakukanmonitoring,evaluasi,danpelaporan
1234
pelaksanaanprogramkegiatan
sekolah/madrasahdenganproseduryang
tepat.
6. Merencanakandanmenindaklanjutihasil

1234
monitoring,evaluasi,danpelaporan.
7. Melaksanakanpenelitiantindakansekolah

1234
dalamrangkameningkatkankinerja
sekolah/madrasah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:7=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

143

4. Kompetensi

:ManajemenSumberDaya(PKKS4)
KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Mengeloladanmendayagunakanpendidikdan
1234
tenagakependidikansecaraoptimal.
2. Mengeloladanmendayagunakansaranadan

1234
prasaranasekolah/madrasahsecaraoptimal
untukkepentinganpembelajaran.
3. Mengelolakeuangansekolah/madrasahsesuai
1234
denganprinsipprinsipefisiensi,transparansi,
danakuntabilitas.
4. Mengelolalingkungansekolahyangmenjamin
1234
keamanan,keselamatan,dankesehatan.
5. Mengelolaketatausahaansekolah/madrasah

1234
dalammendukungpencapaiantujuansekolah/
madrasah.
6. Mengelolasisteminformasisekolah/madrasah
1234
dalammendukungpenyusunanprogramdan
pengambilankeputusan.
7. Mengelolalayananlayanankhusus

1234
sekolah/madrasahdalammendukungkegiatan
pembelajarandankegiatanpesertadidikdi
sekolah/madrasah.
8. Memanfaatkanteknologisecaraefektifdalam

1234
kegiatanpembelajarandanmanajemen
sekolah/madrasah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:8=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

144

5. Kompetensi

:Kewirausahaan(PKKS5)
KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Menciptakaninovasiyangbermanfaatbagi
1234
pengembangansekolah/madrasah.
2. Memilikimotivasiyangkuatuntuksukses

1234
dalammelaksanakantugaspokokdan
fungsinyasebagaipemimpinpembelajaran.
3. Memotivasiwargasekolahuntuksukses

1234
dalammelaksanakantugaspokokdan
fungsinyamasingmasing.
4. Pantangmenyerahdanselalumencarisolusi
1234
terbaikdalammenghadapikendalayang
dihadapisekolah/madrasah.
5. Menerapkannilaidanprinsipprinsip

1234
kewirausahaandalammengembangkan
sekolah/madrasah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:5=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

145

6. Kompetensi

:SupervisiPembelajaran(PKKS6)
KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Menyusunprogramsupervisiakademikdalam
1234
rangkapeningkatanprofesionalismeguru.
2. Melaksanakansupervisiakademikterhadap

1234
gurudenganmenggunakanpendekatandan
tekniksupervisiyangtepat.
3. Menilaidanmenindaklanjutikegiatansupervisi
1234
akademikdalamrangkapeningkatan
profesionalismeguru.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:3=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

146

REKAPITULASIHASILPENILAIANKINERJAKEPALASEKOLAH

No

KompetensiPenilaian

Skorratarata
(29)

Kode

1. KepribadiandanSosial

PKKS1

2. Kepemimpinan

PKKS2

3. PengembanganSekolah/Madrasah

PKKS3

4. PengelolaanSumberDaya

PKKS4

5. Kewirausahaan

PKKS5

6. Supervisi

PKKS6

Total

(30)

NKKS

=TotalSkorRatarata/24X100=................x100=...............(31)

KepalaSekolah(33)
yangdinilai,

Nama
NIP

,(32)
Penilai,(34)

Nama
NIP

147

PETUNJUKPENGISIANFORMAT3A
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama Kepala Sekolah yang dinilai sesuai dengan yang
tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil.
2.
(2)
TulislahNomorIndukPegawaiKepalaSekolahyangbersangkutan.
3.
(3)
TulislahtempatdantanggallahirKepalaSekolahyangdinilaisesuai
SKpengangkatansebagaiPegawaiNegeriSipil.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir Kepala
SekolahtersebutterhitungmulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/
golonganberdasarkanSKpengangkatansebagaiGurudansebagai
KepalaSekolah.
6.
(6)
Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala
Sekolahtersebuttelahbertugassebagaiguru.
7.
(7)
Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan)
yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga
Kependidikan pada jalur pendidikan formal maupun nonformal
jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI,
SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Registrasi Guru
(NRG)setelahyangbersangkutanmemilikisertifikatpendidik.
8.
(8)
Tulislah jenis kelamin Kepala Sekolah yang dinilai dengan cara
mencorethurufLatauP
9.
(9)
Tulislah kualifikasi pendidikan terakhir Kepala Sekolah beserta
spesialisasinya.
10.
(10)
TulislahprogramkeahlianyangdiampuKepalaSekolahyangdinilai
11.
(11)
TulislahnamainstansiatausekolahsebagaitempatbekerjaKepala
Sekolahyangdinilai
12.
(12)
Cukupjelas
13.
(13)
Cukupjelas
14.
(14)
Cukupjelas
15.
(15)
Cukupjelas
16.
(16)
Cukupjelas
17.
(17)
Tulislahnamapenilai
18.
(18)
TulislahNomorIndukPenilaiyangbersangkutan
19.
(19)
Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala
Sekolah(jikaada)
20.
(20)
Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala
Sekolah
21.
(21)
Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK
penugasansebagaipenilaikinerjaKepalaSekolah
22.
(22)
Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri
23.
(23)
Bubuhkan tanda tangan, nama jelas, dan NIP penilai dan Kepala
Sekolahyangdinilai.

148

24.

NOMOR
KODE
(24)

25.

(25)

26.

(26)

27.

(27)

28.

(28)

29.

(29)

30.
31.

(30)
(31)

32.

(32)

33.

(33)

34.

(34)

NO

URAIAN
Tulislah bukti yang relevan dan teridentifikasi, sesuai masing
masingkriteriapadasetiapkompetensiyangdinilaidalampenilaian
KepalaSekolah.
Berikanskoruntukmasingmasingkriteriaberdasarkanbuktiyang
relevanyangteridentifikasi.
Jumlahkan semua skor kriteria pada kompetensi dalam penilaian
kinerjaKepalaSekolah.
Hitunglah skor ratarata setiap kompetensi hasil penilaian kinerja
Kepala Sekolah dengan cara membagi jumlah skor dengan
banyaknyakriteriakomponenyangbersangkutan.
Tulislahdeskripsikinerjayangtelahdilakukankepalasekolahuntuk
masingmasing kompetensi berdasarkan kriteria, bukti fisik yang
teramati,danskorrataratakomponentersebut.
Pindahkan skor ratarata keenam kompetensi dalam penilaian
kinerjaKepalaSekolahkedalamformatrekapitulasihasilpenilaian
kinerjaKepalaSekolah.
JumlahkansemuaskorkomponenpenilaiankinerjaKepalaSekolah
Hitunglah nilai NKKS dengan cara membagi jumlah semua skor
komponen penilaian kinerja Kepala Sekolah dengan 24 dan
mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai
(bilangan)dalamduadesimal.
Tulislah nama kota, tanggal, bulan, dan tahun pengisian format
rekapitulasihasilpenilaiankinerjaKepalaSekolah.
Tulislah nama, NIP, dan bubuhkan tandatangan Kepala Sekolah
yangdinilai.
Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja
KepalaSekolah.

149

Lampiran3B

INSTRUMENPENILAIANKINERJAWAKILKEPALASEKOLAH(IPKWKS)

A.

1.
2.
3.

4.

5.
6.

7.

PETUNJUKPENILAIAN
Penilaiankinerjawakilkepalasekolahdilakukanolehkepalasekolah.
Penilaiankinerjawakilkepalasekolahmerupakanpenilaianberbasisbukti.
Buktibuktidapatberupadata,dokumen,kondisilingkunganfisiksekolah,perilakudan
budaya dan lainlain yang dapat diidentifikasi oleh penilaian melalui pengkajian,
pengamatan,danpenggalianinformasidaripihakpihakyangterkaitdisekolahseperti
guru,pegawai,danpesertadidik.
Penilaiharusmencatatsemuabuktiyangteridentifikasipadatempatyangdisediakan
padamasingmasingkriteriapenilaian.Buktibuktiyangdimaksuddapatberupa:
a. Buktiyangteramati(tangibleevidences)seperti:
Dokumendokumentertulis
Kondisi srana/prasarana (hardware dan/atau software) dan lingkungan
sekolah
Foto,gambar,slide,video.
Produkproduksiswa
b. Buktiyangtakteramati(intangibleevidences)seperti
Sikapdanperilakuwakilkepalasekolah
Budayadaniklimsekolah
Buktibuktiinidapatdiperolehmelaluipengamatan,wawancaradenganpemangku
kepentinganpendidikan(guru,siswa).
Penilaian dilakukan dengan cara memberikan skor pada masingmasing kriteria
berdasarkankelengkapandankeabsahanbuktiyangrelevendanteridentifikasi.
Skor penilaian dinyatakan dengan angka 4, 3, 2, atau 1 dengan ketentuan sebagai
berikut:
a. Skor 4 diberikan apabila wakil kepala sekolah mampu menunjukkan buktibukti
yang lengkap dan sangat meyakinkan bahwa wakil kepala sekolah yang
bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang
dinilai.
b. Skor 3 diberikan apabila wakil kepala sekolah mampu menunjukkan buktibukti
yang lengkap dan cukup meyakinkan bahwa wakil kepala sekolah yang
bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang
dinilai.
c. Skor 2 diberikan apabila wakil kepala sekolah menunjukkan buktibukti yang
kurang lengkap dan cukup meyakinkan bahwa yang bersangkutan berkinerja
sesuaidenganmasingmasingkriteriakomponenyangdinilai.
d. Skor 1 diberikan apabila ditemukan bukti yang sangat terbatas dan kurang
meyakinkan atau tidak ditemukan bukti bahwa wakil kepala sekolah yang
bersangkutan berkinerja sesuai dengan masingmasing kriteria komponen yang
dinilai.

HasilPenilaiandinyatakanrentangnilai1sampaidengan100yangdibedakanmenjadi
empat kategori penilaian yaitu Amat Baik, Baik, Cukup, Sedang dan Kurang
denganketentuansebagaiberikut:

150

NKKS

Kategori

91100
7690
6175
5160
50

AmatBaik
Baik
Cukup
Sedang
Kurang

Untuk menentukan nilai akhir diperlukan konversi dari Skor penilaian yang memiliki
rentangan5sampaidengan20menjadiNilaiKinerjaWakilKepalaSekolah/Madrasah
(NKWKS/M) dengan rentangan 20 sampai dengan 100 dengan menggunakan rumus
sebagaiberikut:

NKWKS = Total Skor Rata-rata/ 20 x 100

151

B. FORMATIDENTITASDIRI

IDENTITASWAKILKEPALASEKOLAHYANGDINILAI
a. Nama

:........................(1)
NIP/NomorSeriKarpeg

:/......................(2)

Tempat/TanggalLahir

:/.........................(3)

Pangkat/Jabatan/Golongan

:.......................(4)

TMTsebagaiguru/
WakilKepalaSekolah

:/......................(5)

MasaKerja

:Tahun.........Bulan(6)

NUPTK/NRG

:...................................................................(7)

JenisKelamin

L/P(8)

PendidikanTerakhir/Spesialisasi :........................(9)
ProgramKeahlianyangdiampu :......................(10)
b. NamaInstansi/Sekolah

:......................(11)

Telp/Fax

:.....................(12)

Kelurahan

:......................(13)

Kecamatan

:......................(14)

Kota/Kabupaten

:......................(15)

Provinsi

:.....................(16)

IDENTITASPENILAI
a. Nama

:........................(17)

NIP

:........................(18)

b. SKPenugasan(Jikaada)
Nomor

:........................(19)

Tanggal

:........................(20)

Berlakusampaidengan

:........................(21)

Penilai

.,,.........(22)
WakilKepalaSekolahyangdinilai

...................................
NIP.......

(23)
NIP....

152

C. FORMATPENILAIANKOMPONENKINERJA

1. Kompetensi1
:KepribadiandanSosial(PKWKS1)

BUKTIYANG
TERIDENTIFIKASI
(24)

KRITERIA

SKOR
(25)

1. Berakhlakmulia,mengembangkanbudaya
1234
dantradisiakhlakmulia,danmenjadi
teladanakhlakmuliabagikomunitasdi
sekolah/madrasah.
2. Melaksanakantugaspokokdanfungsi

1234
sebagaikepalasekolahdenganpenuh
kejujuran,ketulusan,komitmen,dan
integritas.
3. Bersikapterbukadalammelaksanakan

1234
tugaspokokdanfungsisebagaikepala
sekolah/madrasah.
4. Mengendalikandiridalammenghadapi

1234
masalahdantantangansebagaikepala
sekolah/madrasah.
5. Berpartisipasidalamkegiatansosial

1234
kemasyarakatan.
6. Tanggapdanpeduliterhadapkepentingan
1234
orangataukelompoklain.
7. Mengembangkandanmengelolahubungan
1234
sekolah/madrasahdenganpihaklaindiluar
sekolahdalamrangkamendapatkan
dukunganide,sumberbelajar,dan
pembiayaansekolah/madrasah.
JumlahSkor
(26)
SKORRATARATA=JUMLAHSKOR:7=
(27)

DeskripsiKinerjayangTelahDilakukan:(28)

153

2. Kompetensi

:Kepemimpinan(PKWKS2)

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Bertindaksesuaidenganvisidanmisi

1234
sekolah/madrasah.
2. Merumuskantujuanyangmenantangdiri

1234
sendiridanoranglainuntukmencapai
standardyangtinggi.
3. Mengembangkansekolah/madrasahmenuju
1234
organisasipembelajaran(learning
organization).
4. Menciptakanbudayadaniklim

1234
sekolah/madrasahyangkondusifdaninovatif
bagipembelajaran.
5. Memegangteguhtujuansekolahdengan

1234
menjadicontohdanbertindaksebagai
pemimpinpembelajaran.
6. Melaksanakankepemimpinanyanginspiratif.
1234
7. Membangunrasasalingpercayadan

1234
memfasilitasikerjasamadalamrangkauntuk
menciptakankolaborasiyangkuatdiantara
wargasekolah/madrasah
8. Bekerjakerasuntukmencapaikeberhasilan

1234
sekolah/madrasahsebagaiorganisasi
pembelajaryangefektif.
9. Mengembangankurikulumdankegiatan

1234
pembelajaransesuaidenganvisi,misi,dan
tujuansekolah.
10. Mengelolapesertadidikdalamrangka

1234
pengembangankapasitasnyasecaraoptimal.
JumlahSkor
(26)
SKORRATARATA=JUMLAHSKOR:10=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

154

3. Kompetensi

:PengembanganSekolah(PKWKS3)

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Menyusunrencanapengembangan

1234
sekolah/madrasahjangkapanjang,menengah,
danpendekdalamrangkamencapaivisi,misi,
dantujuansekolah/madrasah.
2. Mengembangkanstrukturorganisasisekolah/

1234
madrasahyangefektifdanefisiensesuaidengan
kebutuhan.
3. Melaksanakanpengembangansekolah/

1234
madrasahsesuaidenganrencanajangka
panjang,menengah,danjangkapendeksekolah
menujutercapainyavisi,misi,dantujuan
sekolah.
4. Mewujudkanpeningkatankinerjasekolahyang
1234
signifikansesuaidenganvisi,misi,tujuan
sekolahdanstandardnasionalpendidikan.
5. Melakukanmonitoring,evaluasi,danpelaporan
1234
pelaksanaanprogramkegiatan
sekolah/madrasahdenganproseduryangtepat.
6. Merencanakandanmenindaklanjutihasil

1234
monitoring,evaluasi,danpelaporan.
7. Melaksanakanpenelitiantindakansekolah

1234
dalamrangkameningkatkankinerja
sekolah/madrasah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:7=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

155

4. Kompetensi

:Kewirausahaan(PKWKS4)

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Menciptakaninovasiyangbermanfaatbagi

1234
pengembangansekolah/madrasah.
2. Memilikimotivasiyangkuatuntuksuksesdalam
1234
melaksanakantugaspokokdanfungsinyasebagai
pemimpinpembelajaran.
3. Memotivasiwargasekolahuntuksuksesdalam

1234
melaksanakantugaspokokdanfungsinyamasing
masing.
4. Pantangmenyerahdanselalumencarisolusi

1234
terbaikdalammenghadapikendalayangdihadapi
sekolah/madrasah.
5. Menerapkannilaidanprinsipprinsip

1234
kewirausahaandalammengembangkan
sekolah/madrasah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:5=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

156

5. Kompetensi
:BidangTugasWakasek(PKWKS5)

a. WakasekBidangAkademik
KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Mengeloladanmendayagunakanpendidikdan
1234
tenagakependidikansecaraoptimal.
2. Memanfaatkanteknologisecaraefektifdalam

1234
kegiatanpembelajaran.
3. Menyusunprogramsupervisiakademikdalam

1234
rangkapeningkatanprofesionalismeguru.
4. Melaksanakansupervisiakademikterhadapguru
1234
denganmenggunakanpendekatandanteknik
supervisiyangtepat.
5. Menilaidanmenindaklanjutikegiatansupervisi

1234
akademikdalamrangkapeningkatan
profesionalismeguru.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:5=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

157

b. Wakasekbidangkesiswaan

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Mengelolapesertadidikdalamrangka

1234
pengembangankapasitasnyasecaraoptimal
sesuaiminatdanbakatmasingmasing.
2. Mengelolalayananlayanankhusus

1234
sekolah/madrasahdalammendukung
kegiatanpembelajarandankegiatanpeserta
didikdisekolah/madrasah.

3. Melaksanakanbimbingankegiatankegiatan

1234
kesiswaan.
4. Menegakkandisiplindantatatertibsiswa.

1234
JumlahSkor
(26)
SkorRataRata=JumlahSkor:4=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

158

c. WakasekbidangSaranadanPrasarana

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Mengeloladanmendayagunakansaranadan

1234
prasaranasekolah/madrasahsecaraoptimaluntuk
kepentinganpembelajaran.
2. Mengelolalingkungansekolahyangmenjamin

1234
keamanan,keselamatan,dankesehatan.
3. Mengelolasisteminformasisekolah/madrasah

1234
dalammendukungpenyusunanprogramdan
pengambilankeputusan.

JumlahSkor
(26)
SkorRataRata=JumlahSkor:3=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

159

d. WakasekbidangHumas

KRITERIA

BUKTIYANG
TERIDENTIFIKASI
(24)

SKOR
(25)

1. Membangunjejaringkerjasamadenganpihak

1234
luar.
2. Mengelolahubungansekolah/madrasah

1234
denganpihaklaindiluarsekolahdalamrangka
mendapatkandukunganide,sumberbelajar,
danpembiayaansekolah/madrasah.
3. Mempublisasikankebijakan,programsekolah
1234
danprestasisekolahpadapihakdiluarsekolah.
JumlahSkor
(26)
SkorRataRata=JumlahSkor:3=
(27)
DeskripsiKinerjayangTelahDilakukan:(28)

160

D. REKAPITULASIHASILPENILAIANKINERJAWAKILKEPALASEKOLAH

No

KomponenPenilaian

SkorRatarata
(29)

Kode

1. KepribadiandanSosial

PKWKS1

2. Kepemimpinan

PKWKS2

3. PengembanganSekolah/Madrasah

PKWKS3

4. Kewirausahaan

PKWKS4

5. BidangTugas

PKWKS5

Total

(30)

NKWKS/M=TotalSkorRatarata/20X100=................x100=..........................(31)

WakilKepalaSekolah(33)
yangdinilai,

Nama
NIP

,(32)
Penilai,(34)

Nama
NIP

161

PETUNJUKPENGISIANFORMAT3B
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama Wakil Kepala Sekolah yang dinilai sesuai dengan yang
tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil.
2.
(2)
Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang
bersangkutan.
3.
(3)
Tulislah tempat dan tanggal lahir Wakil Kepala Sekolah yang dinilai
sesuaiSKpengangkatansebagaiPegawaiNegeriSipil.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir Wakil Kepala
SekolahtersebutterhitungmulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/
golonganberdasarkanSKpengangkatansebagaiGurudanSKsebagai
WakilKepalaSekolah.
6.
(6)
Tulislah sejak kapan (berapa tahun dan berapa bulan) Wakil Kepala
Sekolahtersebuttelahbertugassebagaiguru.
7.
(7)
TulislahNUPTK(NomorUnikPendidikdanTenagaKependidikan)yang

merupakanNomorRegistrasibagiPendidikdanTenagaKependidikan
padajalurpendidikanformalmaupunnonformaljenjangpendidikan
dasardanmenengah,mulaiTK/RA,SD/MI,SMP/MTs,SMA/MA,SMK
dan PLB, serta Nomor Restgrasi Guru (NRG) setelah yang
bersangkutanmemilikisertifikatpendidik.
8.
(8)
Tulislah jenis kelamin Wakil Kepala Sekolah yang dinilai dengan cara
mencorethurufLatauP.
9.
(9)
Tulislah kualifikasi pendidikan terakhir Wakil Kepala Sekolah beserta
spesialisasinya.
9.
(10)
Tulislah program keahlian yang diampu Wakil Kepala Sekolah yang
dinilai.
11.
(11)
Tulislah nama instansi atau sekolah sebagai tempat bekerja Wakil
KepalaSekolahyangdinilai.
12.
(12)
Cukupjelas.
13.
(13)
Cukupjelas.
14.
(14)
Cukupjelas.
15.
(15)
Cukupjelas.
16.
(16)
Cukupjelas.
17.
(17)
Tulislahnamapenilai.
18.
(18)
TulislahNomorIndukPenilaiyangbersangkutan.
19.
(19)
Tulislah Nomor SK penugasan sebagai penilai kinerja Wakil Kepala
Sekolah(jikaada).
20.
(20)
Tulislah tanggal SK penugasan sebagai penilai kinerja Wakil Kepala
Sekolah.
21.
(21)
Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK
penugasansebagaipenilaikinerjaWakilKepalaSekolah.
22.
(22)
Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri

162

23.

NOMOR
KODE
(23)

24.

(24)

25.

(25)

26.

(26)

27.

(27)

28.

(28)

29.

(29)

30.

(30)

31.

(31)

32.

(32)

33.

(33)

34.

(34)

NO

URAIAN
Bubuhkantandatangan,namajelas,danNIPpenilaidanWakilKepala
Sekolahyangdinilai.
Tulislah bukti yang relevan dan teridentifikasi sesuai masingmasing
kriteria pada setiap kompetensi yang dinilai dalam penilaian Wakil
KepalaSekolah.
Berikan skor untuk masingmasing kriteria berdasarkan bukti yang
relevanyangteridentifikasi.
Jumlahkan semua skor kriteria pada kompetensi dalam penilaian
kinerjaWakilKepalaSekolah.
Hitunglah skor ratarata kompetensi yang dinilai dalam penilaian
kinerja Wakil Kepala Sekolah dengan cara membagi jumlah skor
denganbanyaknyakriteriakomponenyangbersangkutan.
Tulislah deskripsi kinerja yang telah dilakukan untuk masingmasing
kompetensi berdasarkan kriteria, bukti fisik yang teramati, dan skor
rataratauntukkompetensitersebut.
Pindahkan skor ratarata kelima kompetensi dalam penilaian kinerja
keformatrekapitulasihasilpenilaiankinerjaWakilKepalaSekolah.
Jumlahkan semua skor kompetensi dlam penilaian kinerja Wakil
KepalaSekolah.
Hitunglah nilai NKWKS dengan cara membagi jumlah semua skor
kompetensi dalam penilaian kinerja Wakil Kepala Sekolah dengan 20
dan mengalikannya dengan 100. Jabarkan sehingga diperoleh nilai
(bilangan)dalamduadesimal.
Tulislah nama kota, tanggal, bulan, dan tahun pengisian format
rekapitulasihasilpenilaiankinerjaWakilKepalaSekolah.
Tulislahnama,NIP,danbubuhkantandatanganWakilKepalaSekolah
yangdinilai.
Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja Wakil
KepalaSekolah.

163

Lampiran3C
INSTRUMENPENILAIANKINERJAKEPALAPERPUSTAKAAN(IPKKPS/M)

A. PETUNJUKPENILAIAN
1. Penilaipenilaiankinerjaguruyangditugaskansebagaikepalaperpustakaansekolah
terdiri atas Kepala sekolah atau Wakil Kepala sekolah Bidang sarana/prasarana
atauWakilKepalasekolahlingkupsekolahyangbersangkutan.
2. Petugas penilai adalah orang yang kompetenyang telah ditugaskan dengan surat
tugasdarikepalasekolahdantelahmengikutipembekalanpenilaiankinerjaguru
yangditugaskansebagaikepalaperpustakaansekolah.
3. Setiappenilaiwajib:(1)memberikanpenilaian,secaraobyektifberbasisbukti,(2)
berkoordinasidenganpihakterkait(gurusebagaikepalaperpustakaansekolah),(3)
memberikan komentar dan rekomendasi, dan menghitung hasil penilaian dan
membuatlaporan.
4. Pengumpulan data dan informasi dilakukan melalui: (1) Observasi. Dilakukan
dengan cara mengamati lingkungan perpustakaan baik secara fisik maupun
nonfisik (persepsi pengguna) perpustakaan sekolah; (2) Wawancara. Dilakukan
dengan mewawancarai guru yang diberi tugas sebagai kepala perpustakaan
sekolah serta sumbersumber yang relevan, antara lain kepala sekolah, wakasek,
guru, siswa, dan staf tata usaha; dan (3) Dokumen. Dilakukan dengan cara
menelaahdokumendokumenyangadakaitannyadengankegiatanyangdilakukan
kepalaperpustakaansekolah.
5. Perhitungan skor kinerja guru yang diberi tugas sebagai kepala perpustakaan
sekolah terdiri atas 6 (enam) dimensi kinerja dengan 10 (sepuluh) jenis kegiatan
yang bersumber dari standar kompetensi kepala perpustakaan sekolah
(Permendiknas No. 25 Tahun 2008). Berdasarkan indikatorindikator yang dinilai
padajeniskegiatan,penilaimemberikanskordenganrentangan1sampai4.
6. Rumus Perhitungan Penilaian Kinerja Guru yang diberi tugas sebagai Kepala
PerpustakaanSekolahadalahsebagaiberikut.

perolehanSkor
NA=x100
(Indikatoryangdinilai)(4)

Keterangan:
NA
=NilaiAkhirKinerja

7. Nilai akhir (NA) yang telah dihitung, maka kinerja guru dengan tugas tambahan
sebagaikepalaperpustakaansekolahdapatdiklasifikasikansebagaiberikut:
No
Klasifikasi
NilaiAkhirKinerja
1 Sangatbaik
91100
2 Baik
7690
3 Cukup
6175
4 Sedang
5160
5 Kurang
0 50

164

8. Nilai akhir (NA) yang telah diklasifikasikan dalam 5 (lima) diatas, kemudian
dikonversikankepadaangkakredityangtelahditentukandengancaraperhitungan
sebagaiberikut:
a. Nilaisangatbaikdiberikanangkakredit125%darijumlahangkakredityang
dicapaisetiaptahun.
b. Nilaibaikdiberikanangkakredit100%darijumlahangkakredityangdicapai
setiaptahun.
c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang
dicapaisetiaptahun.
d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit
yangdicapaisetiaptahun.
e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit
yangdicapaisetiaptahun.

165

B. FORMATIDENTITASDIRI

IDENTITASKEPALAPERPUSTAKAANYANGDINILAI
a. Nama

:....................(1)

NIP/NomorSeriKarpeg

:.....................(2)

Tempat/TanggalLahir

:/......................(3)

Pangkat/Jabatan/Golongan

:.....................(4)

TMTsebagaiguru/
KepalaPerpustakaan

:/....................(5)

MasaKerja

:.......Tahun....Bulan(6)

NUPTK/NRG

:...................................../......................(7)

JenisKelamin

L/P(8)

PendidikanTerakhir/Spesialisasi :.......................(9)
b. NamaInstansi/Sekolah

:.......................(10)

Telp/Fax

:.......................(11)

Kelurahan

:.......................(12)

Kecamatan

:.......................(13)

Kota/Kabupaten

:.......................(14)

Provinsi

:......................(15)

a. Nama

:........................(16)

NIP

:........................(17)

IDENTITASPENILAI

b. SKPenugasan(Jikaada)
Nomer

:........................(18)

Tanggal

:........................(19)

Berlakusampaidengan

:........................(20)

Penilai

.,,.......(21)

KepalaPerpustakaanyangdinilai

...................................

NIP.......

NIP....

(22)

166

C. FORMATPENILAIANKOMPONENKINERJA

1. Kompetensi:Merencanakankegiatanperpustakaansekolah/madrasah

BuktiYang
Skor
Kriteria
Terindentifikasi
(24)
(23)
1. Merencanakanprogram

1
2
3 4
pengembangankoleksi.
2. Merencanakanpengembangan

1
2
3 4
saranadanprasarana.
3. Merencanakanpengembangan

1
2
3 4
SDMtenagaperpustakaan.
4. Merencanakananggaran.

1
2
3 4
5. Merencanakanprogram

1
2
3 4
pengembangankoleksi
perpustakaan.
6. Merencanakanprogrampromosi

1
2
3 4
perpustakaan.
7. Merencanakanpengembangan

1
2
3 4
programkualifikasitenaga
perpustakaanperpustakaan.
8. Merencanakanpengembangan

1
2
3 4
programkompetensitenaga
perpustakaanperpustakaan.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:8=(26)
DeskripsiKinerjayangTelahDilakukan(27)

167

2. Kompetensi:Melaksanakanprogramperpustakaansekolah/madrasah

Kriteria

BuktiYang
Teridentifikasi
(23)

Skor
(24)

1. Melaksanakanprogram
1 2 3
4
pengembangankoleksi.
2. Melaksanakanpengembangan

1 2 3
4
saranadanprasarana.
3. Melaksanakanpengembangan

1 2 3
4
SDMtenagaperpustakaan.
4. Merealisasikananggaran

1 2 3
4
sesuaidenganprogram.
5. Menginventarisasibukubuku

1 2 3
4
perpustakaan.
6. Mengawasikeluarmasuknya

1 2 3
4
bukudaripeminjam.
7. Mengoptimalkanpembuatan

1 2 3
4
catalog.
8. Mengoptimalkanpenyusunan

1 2 3
4
ataupenempatanbukubuku
sesuaidenganperuntukannya.
9. Mendatapengunjungdan

1 2 3
4
penggunaperpustakaandalam
bentukgrafik.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:9=(26)
DeskripsiKinerjayangTelahDilakukan(27)

168

3. Kompetensi:Mengevaluasiprogramperpustakaansekolah/madrasah

BuktiYang
Skor
Krtiteria
Teridentifikasi
(24)
(23)
1. Mengevaluasiprogram

1 2 3
4
pengembangankoleksi.
2. Mengevaluasipengembangan

1 2 3
4
saranadanprasarana.
3. Mengevaluasipengembangan

1 2 3
4
SDMtenagaperpustakaan.
4. Mengevaluasianggaransesuai

1 2 3
4
denganprogram.
5. Mengevaluasiisirbukubuku

1 2 3
4
perpustakaan.
6. Mengevaluasikeluarmasuknya

1 2 3
4
bukudaripeminjam.
7. Mengevaluasipembuatan

1 2 3
4
katalog.
8. Mengevaluasipenyusunanatau

1 2 3
4
penempatanbukubukusesuai
denganperuntukannya.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:8=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

169

4. Kompetensi:Mengembangkankoleksiperpustakaansekolah/madrasah

BuktiYang
Skor
Krieteria
Teridentifikasi
(24)
(23)
1. MenyusunPengembanganKoleksi

1 2 3 4
(CollectionDevelopmentPolicy).
2. Menggunakanberbagaialatbantu

1 2 3 4
seleksiuntukpemilihanbahan
perpustakaan.
3. Melakukansurveykebutuhankoleksi

1 2 3 4
penggunaperpustakaan.
4. Menyeleksikoleksisesuaidengan

1 2 3 4
KebijakanPengembanganKoleksi
5. Mengkoordinasipemilihanbahan

1 2 3 4
perpustakaanbekerjasamadengan
tenagapendidik/gurubidangstudi.
6. Memilihkoleksiyangberagamyang

1 2 3 4
memenuhikebutuhankurikulum.
7. Melakukanpengadaanbahan

1 2 3 4
perpustakaan.
8. Mendayagunakanteknologiinformasi

1 2 3 4
untukkeperluanperawatanbahan
perpustakaan.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:8=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

170

5. Kompetensi:Mengorganisasilayananjasainformasiperpustakaan

BuktiYang
Skor
Kriteria
Teridentifikasi
(24)
(23)
1. Mengorganisasipenyusunandeskripsi

1
2
3 4
bibliografis(pengkatalogan)sesuai
denganstandarAACR(Anglo
AmericanCatalogingRules).
2. Mengorganisasipenentuanklasifikasi

1
2
3 4
menggunakanDeweyDecimal
Classification.
3. Mengorganisasipenentuantajuk

1
2
3 4
subyek.
4. Mengorganisasipengelolaandata

1
2
3 4
bibliografis.
5. Mengorganisasipemanfaatan

1
2
3 4
teknologiinformasidankomunikasi
untukpengorganisasiandan
penelusuraninformasi.
6. Mengorganisasipenyusunanprogram

1
2
3 4
layananjasainformasi.
7. Mengorganisasipenyelenggaraan

1
2
3 4
layananjasasirkulasi.
8. Mengorganisasibimbingan

1
2
3 4
penggunaanperpustakaanbagi
penggunaperpustakaan(User
instruction).
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:8=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

171

6. Kompetensi:Menerapkanteknologiinformasidankomunikasi

BuktiYang
Skor
Kriteria
Teridentifikasi
(24)
(23)
1. Melakukananalisiskebutuhaninformasi

1
2
3 4
penggunaperpustakaan.
2. Melaksanakanpenerapanteknologi

1
2
3 4
informasidalampengelolaan
perpustakaan.
3. Membimbingpenggunaperpustakaan

1
2
3 4
dalampemanfaatanteknologiinformasi
dalammemfasilitasiprosesbelajar
mengajar.
4. Membantupenggunaperpustakaan

1
2
3 4
dalammemanfaatkanteknologi
informasidankomunikasi(internet).
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:4
(26)
DeskripsiKinerjayangTelahDilakukan(27)

172

7. Komponen:Mempromosikanperpustakaan&literasiinformasi

BuktiYang
SKOR
Kriteria
Teridentifikasi
(24)
(23)
1. Mengidentifikasikemampuandasar

1
2
3
4
literasiinformasipengguna
perpustakaansekolah.
2. Menyusunpanduanmateri

1
2
3
4
bimbinganliterasiinformasisesuai
dengankebutuhanpengguna.
3. Membimbingpenggunamencapai

1
2
3
4
kemampuanliterasiinformasi.
4. Mempromosikankegiatanminat

1
2
3
4
bacakomunitassekolah/madrasah.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

173

8. Kompetensi: Mengembangkan kegiatan perpustakaan sebagai sumber belajar


kependidikan

BuktiYang
Skor
Kriteria
Teridentifikasi
(24)
(23)
1. Mengembangkanvisidanmisi

1
2
3
4
perpustakaansekolahberdasarkan
tujuandanfungsi
sekolah/madrasahdalamkonteks
pendidikannasional.
2. Mengembangkanprogram

1
2
3
4
perpustakaansekolahdalam
mendukungpelaksanaan
kurikulum.
3. Mengembangkanpedoman

1
2
3
4
perpustakaansebagaisumber
belajar.
4. Mengembangkanpedomanbelajar

1
2
3
4
mandiri.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

174

9. Kompetensi:Memilikiintegritasdanetoskerja

BuktiYang
Skor
Kriteria
Teridentifikasi
(24)
(23)
1. Kedisiplinan.

1
2
3
4
2. Kerapian.

1
2
3
4
3. Kesopanan/Kesantunan/

1
2
3
4
Keramahan.
4. Kepedulian.

1
2
3
4
5. Berinteraksidengankomunitas

1
2
3
4
sekolah/madrasah.
6. Bekerjasamadengangurudalam

1
2
3
4
mengembangkanpembelajaran
sekolah/madrasah.
7. Membangunkomunikasidengan

1
2
3
4
komunitassekolah/madrasah.
8. Menjalinkerjasamainternaldan

1
2
3
4
eksternalperpustakaansekolah.
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:8=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

175

10. Kompetensi:Mengembangkanprofesionalitaskepustakawanan

BuktiYang
Skor
Kriteria
Teridentifikasi
(24)
(23)
1. Membuatkaryatulisdibidangilmu

1
2
3
4
perpustakaandaninformasi.
2. Meresensi/meresumebuku.

1
2
3
4
3. Membuatindeks.

1
2
3
4
4. Membuatbibliografi.

1
2
3
4
JUMLAHSKOR
(25)
SKORRATARATA=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan(27)

176

D. REKAPITULASIHASILPENILAIANKINERJAKEPALAPERPUSTAKAAN

KOMPETENSI

SKOR
(28)

1
2
3
4
5
6
7
8

Merencanakanprogramperpustakaansekolah/madrasah.
Melaksanakanprogramperpustakaansekolah/madrasah.
Mengevaluasiprogramperpustakaansekolah/madrasah.
Gembangkankoleksiperpustakaansekolah/madrasah.

Mengorganisasilayananjasainformasiperpustakaan.

Menerapkanteknologiinformasidankomunikasi.

Mempromosikanperpustakaan&literasiinformasi.

Mengembangkankegiatanperpustakaansebagaisumber
belajarkependidikan.
9 Memilikiintegritasdanetoskerja.

10 Mengembangkanprofesionalitaskepustakawanan.

JUMLAHSKOR
(29)

NilaiAkhir=JumlahSkor/40X100=................x.........................(30)

KepalaPerpustakaan(32)Penilai(33)
yangdinilai,

Nama
Nama
NIP
NIP

,(31)
KepalaSekolah(34)

Nama
NIP

177

PETUNJUKPENGISIANFORMAT3C
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
TulislahnamaKepalaPerpustakaanyangdinilaisesuaidenganyang
tercantumdalamSKpengangkatansebagaiPegawaiNegeriSipil.
2.
(2)
Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang
bersangkutan.
3.
(3)
TulislahtempatdantanggallahirKepalaPerpustakaanyangdinilai
sesuaiSKpengangkatansebagaiPegawaiNegeriSipil.
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir PNS
tersebutterhitungmulaitanggalberlakunyaSK.
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/
golongan berdasarkan SK pengangkatan sebagai guru dan SK
sebagaiKepalaPerpustakaan.
6.
(6)
Tulislah NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan)
yang merupakan Nomor Registrasi bagi Pendidik dan Tenaga
Kependidikan pada jalur pendidikan formal maupun nonformal
jenjang pendidikan dasar dan menengah, mulai TK/RA, SD/MI,
SMP/MTs, SMA/MA, SMK dan PLB, serta Nomor Restgrasi Guru
(NRG)setelahyangbersangkutanmemilikisertifikatpendidik.
7.
(7)
Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala
PerpustakaantersebuttelahbekerjasebagaiKepalaPerpustakaan
8.
(8)
TulislahjeniskelaminKepalaPerpustakaanyangdinilaidengancara
mencorethurufLatauP.
9.
(9)
Tulislah kualifikasi pendidikan terakhir Kepala Perpustakaan
besertaspesialisasinya.
10.
(10)
TulislahnamainstansiatausekolahsebagaitempatbekerjaKepala
Perpustakaanyangdinilai.
11.
(11)
Cukupjelas.
12.
(12)
Cukupjelas.
13.
(13)
Cukupjelas.
14.
(14)
Cukupjelas.
15.
(15)
Cukupjelas.
16.
(16)
Tulislahnamapenilai.
17.
(17)
TulislahNomorIndukPenilaiyangbersangkutan.
18.
(18)
Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala
Perpustakaan(jikaada).
19.
(19)
Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala
Perpustakaan.
20.
(20)
Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK
penugasansebagaipenilaikinerjaKepalaPerpustakaan.
21.
(21)
Tulislahtanggal,bulan,dantahunpengisianformatidentitasdiri.
22.
(22)
Bubuhkan tandatangan, nama jelas, dan NIP penilai dan Kepala
Perpustakaanyangdinilai.

178

23.

NOMOR
KODE
(23)

24.

(24)

25.

(25)

26.

(26)

27.

(27)

28.

(28)

29.

(29)

30.

(30)

31.

(31)

32.

(32)

33.

(33)

34.

(34)

NO

URAIAN
Tulislahbuktiyangrelevandanteridentifikasisesuaimasingmasing
kriteriapadasetiapkompetensiyangdinilaidalampenilaianKepala
Perpustakaan.
Berikanskoruntukmasingmasingkriteriaberdasarkanbuktiyang
relevanyangteridentifikasi.
Jumlahkan semua skor kriteria pada kompetensi dalam penilaian
kinerjaKepalaPerpustakaan.
HitunglahskorrataratakompetensidalampenilaiankinerjaKepala
Perpustakaan dengan cara membagi jumlah skor dengan
banyaknyakriteriakomponenyangbersangkutan.
Tulislahdeskripsikinerjayangtelahdilakukanuntukmasingmasing
kompetensiberdasarkankriteria,buktifisikyangteramati,danskor
rataratakompetensitersebut.
Pindahkanskorrataratakesepuluhkompetensiyangdinilaidalam
penilaian kinerja ke dalam format rekapitulasi hasil penilaian
kinerjaKepalaPerpustakaan.
JumlahkansemuaskorkompetensidalampenilaiankinerjaKepala
Perpustakaan.
HitunglahnilaiNilaiAkhirdengancaramembagijumlahsemuaskor
kompetensi dalam penilaian kinerja Kepala Perpustakaan dengan
40 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh
nilai(bilangan)dalamduadesimal.
Tulislah nama kota, tanggal, bulan, dan tahun pengisian format
rekapitulasihasilpenilaiankinerjaKepalaPerpustakaan.
Tulislah nama, NIP, dan bubuhkan tandatangan Kepala
Perpustakaanyangdinilai.
Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja
KepalaPerpustakaan.
Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

179

KINERJAKEPALAPERPUSTAKAAN
FormatPersetujuanHasilPenilaianKinerjaKepalaPerpustakaan
HASILPENILAIANKINERJAGURUYANGBERTUGASSEBAGAIKEPALAPERPUSTAKAAN
SEKOLAH

1 Nama
: (1)
: /(2)
2 NIP/Karpeg
3
4
5
6
7
8
9
10
11

12
13

Tempat,TanggalLahir
: (3)
PangkatGolongan/Golongan
: (4)
JabatanFungsionalGuru
: (5)
JenisKelamin
: (6)
MasaKerjasebagaiguru
: (7)
MasaKerjaKepalaPerpustakaan
: (8)
PendidikanTerakhir
: (9)
PelatihanBidangPerpustakaan
: (10)
NamaSekolah
: (11)
:

Telp/Fax
:

Kelurahan
:

Kecamatan
:

Kota/Kabupaten
: (12)
Provinsi
NUPTKdanNRG
: /(13)
PeriodePenilaian
:
sampai

PERSETUJUAN(14)
(PersetujuaniniharusditandatanganiolehPenilaidanGuruyangdinilai)
PenilaidanguruyangdinilaimenyatakantelahmembacadanmemahamisemuaIndikator
yang ditulis/dilaporkan dalam form ini dan menyatakan: SETUJU/TIDAK SETUJU (coret
yangbukanpilihan)
NamaPenilai
(15a) NamaKepala
(16a)

Perpustakaan

TandaTangan
(15b) TandaTangan
(16b)
Tanggal

(15c) Tanggal

(16c)

180

PETUNJUKPENGISIANFORMATPERSETUJUANHASILPENILAIANKINERJA
KEPALAPERPUSTAKAAN
NO
1
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.

12.

13.
14.

15.
16.

NOMOR
KODE
2
(1)

URAIAN

3
Tulislah nama Kepala Perpustakaan yang dinilai sesuai dengan yang
tercantumdalamSKpengangkatansebagaiKepalaPerpustakaan
(2)
Tulislah Nomor Induk Pegawai dan Nomor Kartu Pegawai yang
bersangkutan
(3)
Tulislah tempat dan tanggal lahir Kepala Perpustakaan yang dinilai
sesuaiSKpengangkatansebagaiKepalaPerpustakaan
(4)
Tulislah pangkat dan golongan ruang terakhir Kepala Perpustakaan
tersebutterhitungmulaitanggalberlakunyaSK
(5)
Tulis jabatan fungsional guru yang diberi tugas tambahan sebagai
KepalaPerpustakaan
(6)
Tulislah jenis kelamin Kepala Perpustakaan yang dinilai dengan cara
mencorethurufLatauP
(7)
Tulislahmasakerja(berapatahundanberapabulan)guruyangdinilai
(8)
Tulislah sejak kapan (berapa tahun dan berapa bulan) guru tersebut
bekerjasebagaiKepalaPerpustakaan.
(9)
Tulislah kualifikasi pendidikan terakhir Kepala Perpustakaan beserta
spesialisasinya.
(10)
Tulislahjenispelatihanbidangperpustakaanyangpernahdiikuti
(11)
Tulislah nama instansi atau sekolah sebagai tempat bekerja Kepala
Perpustakaanyangdinilai

Cukupjelas

Cukupjelas

Cukupjelas

Cukupjelas

Cukupjelas
(12)
TulislahNUPTK(NomorUnikPendidikdanTenagaKependidikan)yang
merupakanNomorRegistrasibagiPendidikdanTenagaKependidikan
pada jalur pendidikan formal maupun nonformal jenjang pendidikan
dasar dan menengah, mulai TK/RA, SD/MI, SMP/MTs, SMA/MA, SMK
danPLB,sertaNomorRestgrasiGuru(NRG)setelahyangbersangkutan
memilikisertifikatpendidik.
(13)
Tulislah tanggal, bulan, dan tahun periode penilaian kinerja Kepala
Perpustakaandimaksud
(14)
TulislahpernyataanpersetujuandaripenilaidanKepalaPerpustakaan
yang dinilai dengan cara mencoret kata SETUJU atau mencorat kata
TIDAKSETUJU.
(15a),
Bubuhkan nama jelas dan tandatangan Kepala Perpustakaan yang
(15b),(15c) dinilaisertatanggalpersetujuanhasilpenilaiankinerja.
(16a),
Bubuhkan nama jelas, tandatangan penilai serta tanggal persetujuan
(16b),(16c), hasilpenilaiankinerjaKepalaPerpustakaan.

Lampiran3D

181


INSTRUMENPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL(IPKKLS/M)

A. PETUNJUKPENILAIAN
1. Petugas penilaian kinerja kepala laboratorium/bengkel adalah Kepala
sekolah,dimana kepala laboratorium/bengkel bertugas. Guru dan siswa sebagai
pengguna laboratorium/bengkel dapat juga dilibatkan sebagai responden yang
tujuannya untuk lebih mendalami kinerja dari guru dengan tugas tambahan
sebagaikepalalaboratorium/bengkelsekolah.
2. Petugas penilai adalah kepala sekolah yang kompeten dan telah mengikuti
pembekalan bagaimana menggunakan instrumen penilaian kinerja kepala
laboratorium.
3. Setiappetugaspenilaianwajib:(i)Memberikanpenilaian,secaraobjektifberbasis
bukti;(ii)Berkoordinasidenganpihakterkait(gurukepalalaboratorium/bengkel);
(iii)Memberikankomentardanrekomendasiperbaikan;dan(iv)Menghitunghasil
penilaiandanmembuatlaporan.

4. Pengumpulan data dan informasi dilakukan melalui beberapa cara agar


mendapatkan penilaian yang objektif yaitu: (i) Observasi dilakukan dengan cara
mengamati lingkungan sekitar laboratorium/bengkel, baik internal maupun
eksternaldanmencatathalyangpositifdanhalyangnegatifterkaittugaskepala
laboratorium/bengkel; (ii) Wawancara dilakukan dengan mewawancarai sumber
sumber yang relevan, antara lain kepala sekolah, wakasek, guru dan siswa
pemakai fasilitas laboratorium/bengkel dan staf tata usaha yang terkait; dan (iii)
Studi Dokumentasi dilakukan dengan cara menelaah dokumendokumen dan
catatan yang ada kaitannya dengan pengelolaan kepala laboratorium/bengkel
sesuaidenganstandar.
5. Skalapenilaianmasingmasingkomponendinyatakandenganangka4,3,2,atau1
denganketentuansebagaiberikut:
Skor 4, diberikan apabila kepala sekolah mampu menunjukkan buktibukti
yang lengkap dan sangat meyakinkan bahwa kepala sekolah yang
bersangkutan secara konsisten atau selalu berkinerja sesuai dengan masing
masingindikatorkomponenyangdinilai.
Skor3,diberikanapabilakepalasekolahmampumenunjukkanbuktibuktiyang
meyakinkanbahwakepalasekolahyangbersangkutanlebihbanyakberkinerja
sesuaidenganmasingmasingindikatorkomponenyangdinilai.
Skor 2, diberikan apabila kepala sekolah menunjukkan buktibukti tidak
meyakinkan bahwa yang bersangkutan berkinerja sesuai dengan masing
masingindikatorkomponenyangdinilai.
Skor 1, diberikan apabila tidak ditemukan bukti bahwa kepala sekolah yang
bersangkutan berkinerja sesuai dengan masingmasing indikator komponen
yangdinilai.
6. RumusPerhitunganPenilaianKinerjaGurusebagaiKepalaLaboratorium/bengkel:
PS
PerolehanSkor
SA==

KriteriaKinerjaKK

SA (SA1+SA2+SA3+SA4+SA5+SA6+SA7)
182

NAK=x100=x100

Ax4

28

Keterangan:
SA =JumlahSkorKomponenKinerjaratarata(SA1s.dSA7)
PS =JumlahPerolehanSkorsetiapKomponen
KK =JumlahKriteriaKinerjasetiapKomponen
A
=AspekKinerja
NAK =NilaiAkhirKinerja
7. Klasifikasi Nilai Akhir. Adapun Nilai Akhir (NA) yang telah dihitung, maka kinerja
gurudengantugastambahansebagaikepalabengkeldapatdiklasifikasikansebagai
berikut:
No
Klasifikasi
NilaiAkhirKinerja
1 Sangatbaik
91100
2 Baik
7690
3 Cukup
6175
4 Sedang
5160
5 Kurang
050
8. Nilai Akhir Kinerja (NAK) yang telah diklasifikasikan dalam 5 (lima) level di atas,
kemudian dikonversikan angka kredit yang telah ditentukan dengan cara
perhitungansebagaiberikut:
a. Nilaisangatbaikdiberikanangkakredit125%darijumlahangkakredityang
harusdicapaisetiaptahun.
b. Nilai baik diberikan angka kredit 100% dari jumlah angka kredit yang harus
dicapaisetiaptahun.
c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang
harusdicapaisetiaptahun.
d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit
yangharusdicapaisetiaptahun.
e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit
yangharusdicapaisetiaptahun.

183

B. FORMATIDENTITASDIRI

IDENTITASKEPALALABORATORIUM/BENGKELYANGDINILAI

a. Nama

:..........................(1)
NIP

Tempat/TanggalLahir

:..........................(2)

:/...........................(3)

Pangkat/Jabatan/Golongan

:........................(4)

TMTsebagaiguru

:.......................(5)

MasaKerja

:......Tahun..Bulan(6)

JenisKelamin

L/P(7)

PendidikanTerakhir/Spesialisasi :..........................(8)
JenisLaboratorium/bengkelyang
dikelola(Fisika,KImia,dsb)
b. NamaInstansi/Sekolah

:.........................(9)
:........................(10)

Telp/Fax

:........................(11)

Kelurahan

:........................(12)

Kecamatan

:........................(13)

Kota/Kabupaten

:........................(14)

Provinsi

:.......................(15)

IDENTITASPENILAI
a. Nama

:.........................(16)

NIP

:.........................(17)

b. SKPenugasan(Jikaada)
Nomor

:.........................(18)

Tanggal

:.........................(19)

Berlakusampaidengan

:.........................(20)

Penilai,

...................................
NIP.......

.,,............(21)

KepalaLaboratorium/Bengkelyangdinilai,

........(22)
NIP....

184

C. FORMATPENILAIANKINERJA

1. Kompetensi:Kepribadian
NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

SKOR
(24)

1.

Berperilakuarifdalambertindakdan
1 2 3 4
memecahkanmasalah
2. Berperilakujujuratassemua

1 2 3 4
informasikedinasan
3. Menunjukkankemandiriandalam

1 2 3 4
bekerjadibidangnya
4. Menunjukkanrasapercayadiriatas

1 2 3 4
keputusanyangdiambil
5. Berupayameningkatkankemampuan
1 2 3 4
diridibidangnya
6. Bertindaksecarakonsistensesuai

dengannormaagama,hukum,sosial,
1 2 3 4
danbudayanasionalIndonesia
7. Berperilakudisiplinataswaktudan

1 2 3 4
aturan
8. Bertanggungjawabterhadaptugas

1 2 3 4
9. Tekun,teliti,danhatihatidalam

1 2 3 4
melaksanakantugas
10. Kreatifdalammemecahkanmasalah
yangberkaitandengantugas
1 2 3 4
profesinya
11. Berorientasipadakualitasdan

kepuasanlayananpemakai
1 2 3 4
laboratorium/bengkel
PerolehanSkor(PS)
(25)
Skorratarata(SA1)=PerolehanSkor:11=
(26)
DeskripsiKinerjaYangTelahDilakukan:(27)

185

2. Kompetensi:Sosial

BUKTIYANG
TERIDENTIFIKASI
(23)

NO.

KRITERIAKINERJA

1.

Menyadarikekuatandankelemahan
baikdirimaupunstafnya

2.

Memilikiwawasantentangpihaklain
yangdapatdiajakkerjasama
Bekerjasamadenganberbagaipihak
secaraefektif

3.

SKOR
(24)
1

4.

Berkomunikasidenganberbagai

pihaksecarasantun,empatik,dan
1
2 3 4
efektif
5. Memanfaatkanberbagaiperalatan

TeknologiInformasidankomunikasi
1
2 3 4
(TIK)untukberkomunikasi
PerolehanSkor(PS)
(25)
Skorratarata(SA2)=PerolehanSkor:5=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

186

3. Kompetensi:PengorganisasianGuru/Laboran/Teknisi

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

Mengkoordinasikankegiatan

praktikumdenganguru
2. Merumuskanrinciantugas

teknisidanlaboran
3. Menentukanjadwalkerjateknisi
danlaboran
4. Mensupervisiteknisidan

laboran
5. Menilaihasilkerjateknisidan

laboran
6. Menilaikinerjateknisidan

laboranlaboratorium/bengkel
PerolehanSkor(PS)
SkorAspekratarata(SA3)=PerolehenSkor:6=
DeskripsiKinerjayangTelahDilakukan:

SKOR
(24)
1

4
(25)
(26)
(27)

187

4. Kompetensi:PengelolaandanAdministrasi

NO.

KRITERIAKINERJA

1.

Menyusunprogrampengelolaan
laboratorium/bengkel
Menyusunjadwalkegiatan
laboratorium/bengkel
Menyusunrencanapengembangan
laboratorium/bengkel
Menyusunproseduroperasistandar
(POS)kerjalaboratorium/bengkel
Mengembangkansistemadministrasi
laboratorium/bengkel
Menyusunjadwalkegiatan
laboratorium/bengkel
Menyusunlaporankegiatan
laboratorium/bengkel

2.
3.
4.
5.
6.
7.

PerolehanSkor(PS)

BUKTIYANG
TERIDENTIFIKASI
(23)

SKOR
(24)
1

4
(25)

SkorAspekratarata(SA4)=PerolehanSkor:7=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

188

5. Kompetensi:PengelolaanPemantauandanEvaluasi

BUKTIYANG
SKOR
NO.
KRITERIAKINERJA
TERIDENTIFIKASI
(24)
(23)
1. Memantaukondisidankeamanan

bahansertaalat
1
2 3 4
laboratorium/bengkel
2. Memantaukondisidankeamanan

1
2 3 4
bangunanlaboratorium/bengkel
3. Memantaupelaksanaankegiatan

1
2 3 4
laboratorium/bengkel
4. Membuatlaporanbulanandan

tahunantentangkondisidan
1
2 3 4
pemanfaatanlaboratorium/bengkel
5. Membuatlaporansecaraperiodic

1
2 3 4
6. Mengevaluasiprogram

laboratorium/bengkeluntuk
1
2 3 4
perbaikanselanjutnya
7. Menilaikegiatan

1
2 3 4
laboratorium/bengkel
PerolehanSkor(PS)
(25)
SkorAspekratarata(SA5)=PerolehanSkor:7=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

189

6. Kompetensi:PengembangandanInovasi

NO.
1

KRITERIAKINERJA

BUKTIYANG
TERIDENTIFIKASI
(23)

SKOR
(24)

Mengikutiperkembanganpemikiran
tentangpemanfaatankegiatan
1 2 3 4
laboratorium/bengkelsebagaiwahana
pendidikan
2 Menerapkanhasilinovasiataukajian

1 2 3 4
laboratorium/bengkel
3 Merancangkegiatan

laboratorium/bengkeluntukpendidikan
1 2 3 4
danpenelitian
4 Melaksanakankegiatan

laboratorium/bengkeluntuk
1 2 3 4
kepentinganpendidikandanpenelitian
5 Mempublikasikankaryatulisilmiahhasil
1 2 3 4
kajian/inovasilaboratorium/bengkel
PerolehanSkor(PS)
(25)
SkorAspekratarata(SA6)=PerolehanSkor:5=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

190

7. Kompetensi:PengelolaanLingkungandanP3

NO.

KRITERIAKINERJA

BUKTIYANG
TERIDENTIFIKASI
(23)

SKOR
(24)

Menyusunpanduan/penuntun

1 2 3
4
(manual)praktikum
Menetapkanketentuanmengenai
2. kesehatandankeselamatankerja
1 2 3
4
(K3)
Menerapkanketentuanmengenai
3. kesehatandankeselamatankerja
1 2 3
4
(K3)
Menerapkanprosedurpenanganan
4.
1 2 3
4
bahanberbahayadanberacun
Memantaubahanberbahayadan

5. beracun,sertaperalatan
1 2 3
4
keselamatankerja
PerolehanSkor(PS)
(25)
SkorAspekratarata(SA7)=PerolehanSkor:5=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

1.

191

D. REKAPITULASIHASILPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL

KOMPETENSI
SKOR
(28)
1 Kepribadian

2 Sosial

3 PengorganisasianGuru/Laboran/Teknisi

4 PengelolaandanAdministrasi

5 PengelolaanPemantauandanEvaluasi

6 PengembangandanInovasi

7 PengelolaanLingkungandanP3

JUMLAHSKOR
(29)

NilaiAkhir=JumlahSkor/28X100=................x.............................(30)

,(31)

KepalaLaboratorium/Bengkel(32)Penilai(33)
KepalaSekolah(34)
yangdinilai,

Nama
Nama
Nama
NIP
NIP
NIP

192

PETUNJUKPENGISIANFORMAT3D
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislah nama Kepala Laboratorium/Bengkel yang dinilai sesuai
dengan yang tercantum dalam SK pengangkatan sebagai Kepala
Laboratorium/Bengkel
2.
(2)
Tulislah Nomor Induk Pegawai Kepala Laboratorium/Bengkel yang
bersangkutan
3.
(3)
Tulislah tempat dan tanggal lahir Kepala Laboratorium/Bengkel
yang dinilai sesuai SK pengangkatan sebagai Kepala
Laboratorium/Bengkel
4.
(4)
Tulislah pangkat, jabatan, dan golongan ruang terakhir Kepala
Laboratorium/Bengkeltersebutterhitungmulaitanggalberlakunya
SK
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/
golongan berdasarkan SK pengangkatan sebagai Kepala
Laboratorium/Bengkel
6.
(6)
Tulislah sejak kapan (berapa tahun dan berapa bulan) Kepala
Laboratorium/Bengkeltersebutbertugas.
7.
(7)
Tulislah jenis kelamin Kepala Laboratorium/Bengkel yang dinilai
dengancaramencorethurufLatauP
8.
(8)
Tulislah
kualifikasi
pendidikan
terakhir
Kepala
Laboratorium/Bengkelbesertaspesialisasinya.
9.
(9)
Tulislah jenis Laboratorium/Bengkel yang dikelola Kepala
Laboratorium/Bengkelyangdinilai
10.
(10)
TulislahnamainstansiatausekolahsebagaitempatbekerjaKepala
Laboratorium/Bengkelyangdinilai
11.
(11)
Cukupjelas
12.
(12)
Cukupjelas
13.
(13)
Cukupjelas
14.
(14)
Cukupjelas
15.
(15)
Cukupjelas
16.
(16)
Tulislahnamapenilai
17.
(17)
TulislahNomorIndukPegawaipenilaiyangbersangkutan
18.
(18)
Tulislah Nomor SK penugasan sebagai penilai kinerja Kepala
Laboratorium/Bengkel(jikaada)
19.
(19)
Tulislah tanggal SK penugasan sebagai penilai kinerja Kepala
Laboratorium/Bengkel
20.
(20)
Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK
penugasansebagaipenilaikinerjaKepalaLaboratorium/Bengkel
21.
(21)
Tulislahtanggal,bulan,dantahunpengisianformatini
22.
(22)
Bubuhkan tanda tangan, nama jelas, dan NIP penilai dan Kepala
Laboratorium/Bengkelyangdinilai.

193

23.

NOMOR
KODE
(23)

24.

(24)

25.

(25)

26.

(26)

27.

(27)

28.

(28)

29.

(29)

30.

(30)

31.

(31)

32.

(32)

33.

(33)

34.

(34)

NO

URAIAN
Tulislah bukti yang relevan dan teridentifikasi, sesuai masing
masingkriteriapadasetiapkompetensiyangdinilaidalampenilaian
KepalaLaboratorium/Bengkel
Berikanskoruntukmasingmasingkriteriaberdasarkanbuktiyang
relevanyangteridentifikasi
Jumlahkan semua skor kriteria pada kompetensi dalam penilaian
kinerjaKepalaLaboratorium/Bengkel
HitunglahskorrataratakompetensidalampenilaiankinerjaKepala
Laboratorium/Bengkel dengan cara membagi jumlah skor dengan
banyaknyakriteriayangbersangkutan
Tulislahdeskripsikinerjayangtelahdilakukanuntukmasingmasing
kompetensiberdasarkankriteria,buktifisikyangteramati,danskor
rataratakompetensitersebut.
Pindahkan skor ratarata ketujuh kompetensi dalam penilaian
kinerja ke dalam format rekapitulasi hasil penilaian kinerja Kepala
Laboratorium/Bengkel
JumlahkansemuaskorkompetensidalampenilaiankinerjaKepala
Laboratorium/Bengkel
Hitunglah Nilai Akhir dengan cara membagi jumlah semua skor
kompetensipenilaiankinerjaKepalaLaboratorium/Bengkeldengan
28 dan mengalikannya dengan 100. Jabarkan sehingga diperoleh
nilai(bilangan)dalamduadesimal.
Tulislah nama kota, tanggal, bulan, dan tahun pengisian format
rekapitulasihasilpenilaiankinerjaKepalaLaboratorium/Bengkel
Tulislah nama, NIP, dan bubuhkan tandatangan Kepala
Laboratorium/Bengkelyangdinilai.
Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja
KepalaLaboratorium/Bengkel.
Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

194

FORMATTAMBAHANPENILAIANKINERJAKEPALALABORATORIUM/BENGKEL
FormatWawancara

WAWANCARAPENDALAMAN(GURUTEMANSEJAWAT*/SISWA*)

//

Jams/d
Namaguruyangdinilai
Tanggal

Waktuwawancara
wawancara
Petunjuk:
Wawancara dilakukan untuk pedalaman hasil observasi dan studi dokumentasi. Wawancara
sebaiknya dilakukan tidak terlalu formal. Penilai dapat mengawali wawancara dengan menulis
KRITERIA yang ingin didalami pada kotak dibawah ini. Kemudian penilai meminta respon pada
guru atau siswa yang biasa menggunakan fasilitas laboratorium/bengkel sekolah untuk
memberikanpenjelasansingkat.PenilaimencatathalpentingyangdariKRITERIAyangditanyakan.

1. ASPEKKEPRIBADIAN(A1).
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?
Catatanjawabangurutemansejawat*/siswa*:
...............................................................................
...............................................................................
...............................................................................

2. ASPEKSOSIAL(A2)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?
Catatanjawabangurutemansejawat/siswa)*:
..............................................................................
...............................................................................
...............................................................................
*(coretyangtidakperlu)

3. ASPEKPENGORGANISASIANGURU,LABORAN/TEKNISI(A3)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?
Catatanjawabangurutemansejawat/siswa)*:
..............................................................................
...............................................................................
...............................................................................

195

4. ASPEKPENGELOLAANPROGRAMDANADMINISTRASI(A4)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?
Catatanjawabangurutemansejawat*/siswa*:
..............................................................................
...............................................................................
...............................................................................

5. ASPEKPENGELOLAANPEMANTAUANDANEVALUASI(A5)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?
Catatanjawabangurutemansejawat/siswa)*:
...............................................................................
..............................................................................
..............................................................................

6. ASPEKPENGEMBANGANDANINOVASI(A6)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?

Catatanjawabangurutemansejawat/siswa)*:
...............................................................................
...............................................................................
...............................................................................

7. ASPEKLINGKUNGANDANK3(A7)
Pertanyaan:(Kriteriayangperludidalami)
1................................................................?
2................................................................?
3................................................................?

Catatanjawabangurutemansejawat/siswa)*:
...............................................................................
...............................................................................
...............................................................................

........,.......20...
Penilai,

NIP.................

*)coretyangtidakperlu

196

8. FormatBeritaAcara

BERITAACARA

Padahariini,.........tanggal.......bulan......tahun...,bertempatdi........
..................mulaipukul.....s/d......telahdilaksanakankonsultasi
PenilaianKinerjaGurudengantugastambahansebagai............

Guru yang dinilai menyatakan, bahwa hasil penilaian kenerja guru terkait
sebagai .............. telah dibaca dan dipahami berdasarkan aspek dan kriteria yang
tercantumdalaminstrumenpenilaiankinerja,selanjutnyaasesimenyatakan:
SETUJU/TIDAKSETUJU)*

Demikianlah berita acara ini dibuat dengan benar dan sesuai dengan keadaan
yangsebenarbenarnya.

NamaPenilai

TandaTangan

Tanggal

NamaGuru
yangdinilai

*)coretyangbukanpilihan

TandaTangan

Tanggal

197

Lampiran3E

INSTRUMENPENILAIANKINERJAKETUAPROGRAMKEAHLIAN
A. PETUNJUKPENILAIAN
1. Petugas penilaian kinerja Ketua Program Keahlian dapat secara individu atau
berbentuk tim yang terdiri atas Kepala sekolah dan atau Wakil Kepala Sekolah.
Bidang sarana/prasarana dan atau Wakil Kepala Sekolah lingkup sekolah yang
ditunjuk. Guru dan siswa pada lingkup program keahlian dapat juga dilibatkan
sebagai responden untuk lebih mendalami kinerja ketua program keahlian di
sekolah.
2. Petugas penilai adalah orang yang kompetenyang telah ditugaskan dengan surat
tugasdarikepalasekolahsertatelahmengikutipembekalan.
3. Setiap petugas wajib: (i) Memberikan penilaian secara objektif berbasis bukti; (ii)
Berkoordinasi dengan pihak terkait; (iii) Menghitung hasil penilaian, dan (iv)
membuatlaporan.
4. Pengumpulan data dan informasi dilakukan melalui beberapa cara agar
mendapatkan penilaian yang objektif yaitu: (i) Observasi dilakukan dengan cara
mengamati hal yang positif dan hal yang negatif terkait tugas ketua program
keahlian; (ii) Wawancara dilakukan dengan mewawancarai sumbersumber yang
relevan,antaralainkepalasekolah,wakilkepalasekolah,gurudanpesertadididk
dan staf tata usaha yang terkait; dan (iii) Studi Dokumen dilakukan dengan cara
menelaahdokumendokumendancatatanyangadakaitannyadenganpengelolaan
ketuaprogramkeahliansesuaistandar.
5. Skala penilaian masingmasing kriteria dinyatakan dengan angka 4, 3, 2, atau 1
denganketentuansebagaiberikut:
Skor 4 diberikan apabila ketua program/kompetensi keahlian mampu
menunjukkan buktibukti yang lengkap dan sangat meyakinkan bahwa yang
bersangkutan berkinerja sesuai dengan masingmasing kriteria kinerja yang
dinilai atau yang bersangkutan selalu melaksanakan pekerjaan sebagaimana
pernyataankriteriakinerjaatauhasilkinerjanyabermutusangattinggi.
Skor 3 diberikan apabila ketua program/kompetensi keahlian mampu
menunjukkan buktibukti yang meyakinkan bahwa yang bersangkutan
berkinerjasesuaidenganmasingmasingkriteriakinerjayangdinilaiatauyang
bersangkutanseringmelaksanakanpekerjaansebagaimanapernyataankriteria
kinerjaatauhasilkinerjanyabermututinggi.
Skor 2 diberikan apabila ketua program/kompetensi keahlian menunjukkan
buktibukti yang kurang atau tidak meyakinkan bahwa yang bersangkutan
berkinerjasesuaidenganmasingmasingkriteriakinerjayangdinilaiatauyang
bersangkutan kadang melaksanakan pekerjaan sebagaimana pernyataan
kriteriakinerjaatauhasilkinerjanyabermutusedang.
Skor 1 diberikan apabila tidak ditemukan bukti bahwa ketua program/
kompetensi keahlian berkinerja sesuai dengan masingmasing kriteria kinerja
yangdinilaiatauyangbersangkutanjarangatautidakpernahmelaksanakan
pekerjaan sebagaimana pernyataan kriteria kinerja atau hasil kinerjanya
bermuturendah.

6. RumusperhitunganpenilaiankinerjagurusebagaiKetuaProgram
198


NAKn
NAK=x100

(KK)x4

(A1+A2+AK3+A4+A5+A6+A7+A8)
NAK=x100

32

Keterangan:
NAK =NilaiAkhirKinerja
An
=NilaiRataratasetiapkompetensi
KK
=KriteriaKinerja

7. Nilaiakhirkinerja(NAK)yangtelahdihitungdiklasifikasikansebagaiberikut:
No
Klasifikasi
NilaiAkhirKinerja
1 Sangatbaik
91100
2 Baik
7690
3 Cukup
6175
4 Sedang
5160
5 Kurang
050

8. Nilai Akhir Kinerja (NAK) yang telah diklasifikasikan dalam 5 (lima level) diatas,
kemudiandikonversikankepadaangkakredityangtelahditentukandengancara
perhitungansebagaiberikut:
a. Nilaisangatbaikdiberikanangkakredit125%darijumlahangkakredityang
harusdicapaisetiaptahun.
b. Nilai baik diberikan angka kredit 100% dari jumlah angka kredit yang harus
dicapaisetiaptahun.
c. Nilaicukupdiberikanangkakreditsebesar75%darijumlahangkakredityang
harusdicapaisetiaptahun.
d. Nilai sedang diberikan angka kredit sebesar 50% dari jumlah angka kredit
yangharusdicapaisetiaptahun.
e. Nilai kurang diberikan angka kredit sebesar 25% dari jumlah angka kredit
yangharusdicapaisetiaptahun.

199

B. FORMATIDENTITASDIRI

IDENTITASKETUAPROGRAMKEAHLIAN
a. Nama

:........................(1)
NIP

Tempat/TanggalLahir

:........................(2)

:/.........................(3)

Pangkat/Jabatan/Golongan

:........................(4)

TMTsebagaiguru

:........................(5)

MasaKerja

:........Tahun....Bulan(6)

JenisKelamin

L/P(7)

PendidikanTerakhir/Spesialisasi :.......................(8)
ProgramKeahlianyangdiampu :.......................(9)
b. NamaInstansi/Sekolah

:.......................(10)

Telp/Fax

:.......................(11)

Kelurahan

:.......................(12)

Kecamatan

:.......................(13)

Kota/Kabupaten

:.......................(14)

Provinsi

:......................(15)

IDENTITASPENILAI
a. Nama

:........................(16)

NIP

:........................(17)

b. SKPenugasan(Jikaada)
Nomor

:........................(18)

Tanggal

:........................(19)

Berlakusampaidengan

:.........................(20)

Penilai,

...................................
NIP.......

.,,..........(21)

KetuaProgramKeahlianyangdinilai,

(22)
NIP....

200

C. FORMATPENILAIANKINERJA

1. KompetensiKepribadian

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

SKALASKOR
(24)

Berperilakuarifdalambertindak
1 2 3 4
danmemecahkanmasalah
2. Berperilakujujuratassemua

1 2 3 4
informasikedinasan
3. Menunjukkankemandirian

1 2 3 4
dalambekerjadibidangnya
4. Menunjukkanrasapercayadiri

1 2 3 4
ataskeputusanyangdiambil
5. Bertindaksecarakonsisten

sesuaidengannormaagama,
1 2 3 4
201ocia,201ocial,danbudaya
nasionalIndonesia
6. Berperilakudisiplinataswaktu

1 2 3 4
danaturan
JUMLAHSKORASPEK1
(25)
SKORRATARATA(A1)=JUMLAHSKOR:6=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

201

2. KompetensiSosial

NO.

KRITERIAKINERJA

1.

Menyadarikekuatandan
kelemahanbaikdirimaupun
stafnya
Memilikiwawasantentang
pihaklainyangdapatdiajak
kerjasama
Bekerjasamadenganberbagai
pihaksecaraefektif

2.

3.

BUKTIYANG
TERIDENTIFIKASI
(23)

SKALASKOR
(24)
1

4.

Berkomunikasidengan

berbagaipihaksecarasantun,
1 2 3 4
empatik,danefektif
JUMLAHSKORASPEK2
(25)
SKORRATARATA(A2)=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

202

3. KompetensiPerencanaan

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

SKALASKOR
(24)

Menyusunrencanakegiatan
tahunanlingkupprogram/
1 2 3 4
kompetensikeahlianpadaformat
yangtelahdisediakanolehsekolah
2. Menyusunkebutuhanalatdan

bahanpraktikpadalingkup
program/kompetensikeahlian
1 2 3 4
padaformatyangtelahdisediakan
olehsekolah
3. Melibatkangurulaindalam

menyusunrencanakegiatan
1 2 3 4
tahunanpadalingkup
program/kompetensikeahlian
4. Dalamrencanakegiatantahunan

terkandungunsurpengembangan
1 2 3 4
program/kompetensikeahlian
5 Menganalisisketercapaianrencana

kegiatantahunanlingkup
program/kompetensikeahlian
1 2 3 4
padaformatyangtelahdisediakan
olehsekolah
JUMLAHSKORASPEK3
(25)
SKORRATARATA(A3)=JUMLAHSKOR:5=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

203

4. KompetensiPengelolaanPembelajaran

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

SKALASKOR
(24)

Mengkoordinasikankegiatan
pengembangankurikulum
sepertimenyusunsilabusdan
1 2 3 4
RPPpadalingkupprogram/
kompetensikeahlian
2. Mengkoordinasikankegiatan

pembelajarandalamrangka
1 2 3 4
menciptakaniklimkerjayang
kondusif.
3. Menyediakanmediapresentasi

denganmenggunakankomputer
1 2 3 4
dandigitalprojector
4. Menyediakan/mengelola

ketersediaanbahanajaruntuk
1 2 3 4
pembelajaran
5 Memotivasipesertadidikdalam

pembelajarandan
1 2 3 4
pengembangankapasitas
pesertadidik.
6 Mengkoordinasikankegiatan

pesertadidikdalam
pembelajarandan

pengembangankapasitas
pesertadidik.
JUMLAHSKORASPEK4
(25)
SKORRATARATA(A4)=JUMLAHSKOR:6=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

204

5. KompetensiPengelolaanSumberDayaManusia

BUKTIYANG
SKALASKOR
NO.
KRITERIAKINERJA
TERIDENTIFIKASI
(24)
(23)
1. Menyusunjadwalmengajarguru

padalingkupprogram/
1 2 3 4
kompetensikeahlian
2. Melakukanpembagiantugas

kepalabengkel/sanggar/
laboratoriumdanatau
1 2 3 4
teknisi/laboranpadalingkup
program/kompetensikeahlian
3. Memberikanmotivasipositif

kepadaguru,kepala
bengkel/sanggar/laboratorium
1 2 3 4
danteknisi/laborandalam
melaksanakantugasnya.
4. Melakukankoordinasikegiatan

guru,kepalabengkel/
sanggar/laboratoriumdan
1 2 3 4
teknisi/laborandalam
melaksanakantugasnya.
JUMLAHSKORASPEK5
(25)
SKORRATARATA(A5)=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

205

6. KompetensiPengelolaanSaramaPrasarana

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

SKALASKOR
(24)

Menyusunjadwalpenggunaan
bengkel/sanggar/laboratorium
1 2 3 4
padalingkup
program/kompetensikeahlian
2. Memilikiperangkatadminsitrasi

pengelolaansaranadan
prasarana
1 2 3 4
bengkel/sanggar/laboratorium
dalamrangkatertibadministrasi
saranadanprasarana.
3. Mengkoordinasikan

pemeliharaankondisisaranadan
prasaranabengkel/sanggar/
1 2 3 4
laboratoriumdengankepala
bengkel/sanggar/laboratorium
danatauteknisi/laboran
4. Mengkoordinasikankebersihan

ruangan,gedungdanhalaman
1 2 3 4
denganpetugaskebersihan
JUMLAHSKORASPEK6

(25)
SKORRATARATA(A6)=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

206

7. KompetensiPengelolaanKeuangan

NO.
1.

2.

3.

4.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA
Memilikirencanaanggarandan
pendapatanprogram/kompetensi
keahlian
Memilikiperangkatadministrasi
keuanganlingkupprogram/
kompetensikeahlian.
Menggunakandanasecaraefektif
danefisienuntukkegiatandan
kemajuanprogram/kompetensi
keahlianyangdiampunya.
Mendelegasikanpengelolaan
keuangankepadabendahara

SKALASKOR
(24)
1

JUMLAHSKORASPEK7
(25)
SKORRATARATA(A7)=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

207

8. KompetensiEvaluasidanPelaporan

NO.

BUKTIYANG
TERIDENTIFIKASI
(23)

KRITERIAKINERJA

1.

SKALASKOR
(24)

Memantaupelaksanaan
kegiatanpembelajaranpada
1 2 3 4
lingkupprogram/kompetensi
keahlian
2. Memantauketersediaandan

kondisialatdanbahan
1 2 3 4
praktikum
3. Menyusunlaporankeuangan

padalingkupprogram/
1 2 3 4
kompetensikeahlian
4. Menyusunlaporankegiatan

tahunanpadalingkupprogram/
1 2 3 4
kompetensikeahlian
JUMLAHSKORASPEK8
(25)
SKORRATARATA(A8)=JUMLAHSKOR:4=
(26)
DeskripsiKinerjayangTelahDilakukan:(27)

208

D. REKAPITULASIHASILPENILAIANKINERJAKETUAPROGRAMSEKOLAH/MADRASAH

KOMPETENSI
SKOR
(28)
1 Kepribadian

2 Sosial

3 Perencanaan

4 PengelolaanPembelajaran

5 PengelolaanSumberDayaManusia

6 PengelolaanSaramaPrasarana

7 PengelolaanKeuangan

8 EvaluasidanPelaporan

JUMLAHSKOR
(29)

NILAIAKHIR:

(A1+A2+A3+A4+A5+A6+A7+A8)
NA =
X 100

32

NA
= . X 100 =
(30)
32

KlasifikasiNilaiAkhir=.(AmatBaik,Baik,Sedang,Kurang)

,(31)

KetuaProgramKeahlian(32)
Penilai(33)
KepalaSekolah(34)
yangdinilai,

Nama
Nama
Nama
NIP
NIP
NIP

209

PETUNJUKPENGISIANFORMAT
NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
TulislahnamaKetuaProgramKeahlianyangdinilaisesuaidenganyang
tercantumdalamSKpengangkatansebagaiKetuaProgramKeahlian
2.
(2)
Tulislah Nomor Induk Pegawai Ketua Program Keahlian yang
bersangkutan
3.
(3)
TulislahtempatdantanggallahirKetuaProgramKeahlianyangdinilai
sesuaiSKpengangkatansebagaiKetuaProgramKeahlian
4.
(4)
Tulislahpangkat,jabatan,dangolonganruangterakhirKetuaProgram
KeahliantersebutterhitungmulaitanggalberlakunyaSK
5.
(5)
Tulislah terhitung mulai tanggal berlakunya pangkat/jabatan/
golongan berdasarkan SK pengangkatan sebagai Ketua Program
Keahlian
6.
(6)
Tulislahsejakkapan(berapatahundanberapabulan)KetuaProgram
Keahliantersebutbertugas
7.
(7)
TulislahjeniskelaminyangsesuaiKetuaProgramKeahlianyangdinilai
dengancaramencorethurufLatauP
8.
(8)
Tulislah kualifikasi pendidikan terakhir Ketua Program Keahlian
besertaspesialisasinya.
9.
(9)
TulislahprogramkeahlianyangdiampuKetuaProgramKeahlianyang
dinilai
10.
(10)
Tulislah nama instansi atau sekolah Ketua Program Keahlian yang
dinilai
11.
(11)
Cukupjelas
12.
(12)
Cukupjelas
13.
(13)
Cukupjelas
14.
(14)
Cukupjelas
15.
(15)
Cukupjelas
16.
(16)
Tulislahnamapenilai
17.
(17)
TulislahNomorIndukPenilaiyangbersangkutan
18.
(18)
Tulislah Nomor SK penugasan sebagai penilai kinerja Ketua Program
Keahlian(jikaada)
19.
(19)
Tulislah tanggal SK penugasan sebagai penilai kinerja Ketua Program
Keahlian
20.
(20)
Tulislah sampai kapan (tanggal, bulan, dan tahun) berlakunya SK
penugasansebagaipenilaikinerjaKetuaProgramKeahlian
21.
(21)
Tulislahtanggal,bulan,dantahunpengisianformatini
22.
(22)
Bubuhkan tandatangan, nama jelas, dan NIP penilai dan Ketua
ProgramKeahlianyangdinilai.
23.
(23)
Tulislah bukti yang relevan dan teridentifikasi sesuai masingmasing
kriteria pada setiap kompetensi yang dinilai dalam penilaian Ketua
ProgramKeahlian
24.
(24)
Berikan skor untuk masingmasing kriteria berdasarkan bukti yang
relevanyangteridentifikasi

210

NO
25.
26.

27.

28.

29.
30.

31.
32.
33.
34.

NOMOR
URAIAN
KODE
(25)
Jumlahkan semua skor kriteria pada kompetensi dalam penilaian
kinerjaKetuaProgramKeahlian
(26)
Hitunglah skor ratarata kompetensi dalam penilaian kinerja Ketua
Program Keahlian dengan cara membagi jumlah skor dengan
banyaknyakriteriakompetensiyangbersangkutan
(27)
Tulislah deskripsi kinerja yang telah dilakukan untuk masingmasing
kompetensi berdasarkan kriteria, bukti fisik yang teramati, dan skor
rataratakompetensitersebut.
(28)
Pindahkan skor ratarata kedelapan kompetensi dalam penilaian
kinerja ke dalam format rekapitulasi hasil penilaian kinerja Ketua
ProgramKeahlian
(29)
Jumlahkan semua skor kompetensi dalam penilaian Ketua Program
Keahlian
(30)
Hitunglah Nilai Akhir (NA) dengan cara membagi jumlah semua skor
kompetensi dalam penilaian kinerja Ketua Program Keahlian dengan
32danmengalikannyadengan100.Jabarkansehinggadiperolehnilai
(bilangan)dalamduadesimal.
(31)
Tulislah nama kota, tanggal, bulan, dan tahun pengisian format
rekapitulasihasilpenilaiankinerjaKetuaProgramKeahlian
(32)
Tulislah nama, NIP, dan bubuhkan tandatangan Ketua Program
Keahlianyangdinilai.
(33)
Tulislah nama, NIP, dan bubuhkan tandatangan penilai kinerja Ketua
ProgramKeahlian.
(34)
Tulislahnama,NIP,danbubuhkantandatanganKepalaSekolah.

211

212

LAMPIRAN4

FORMATPERHITUNGAN
ANGKAKREDITTUGASTAMBAHAN

213

FORMATREKAPITULASIHASILPENILAIANKINERJAGURUDENGANTUGASTAMBAHAN
SEBAGAI:.............................................(1)

a. Namaguruyangdinilai

:...........................................(2)
NIP
:...........................................(3)
Tempat/TanggalLahir
:/............................................(4)
Pangkat/Jabatan/Golongan
:...........................................(5)
TMT
:...........................................(6)
Tahunmulaibekerjasebagaiguru :(7)
MasaKerjasebagaiguru

:.......Tahun......Bulan(8)
Mulaimengembantugastambahan :(9)
:.......Tahun......Bulan(10)
Masakerjatugastambahan
JenisKelamin

:L/P(11)
PendidikanTerakhir/Spesialisasi
:..............................................(12)
ProgramKeahlianyangdiampu
:............................................(13)
b. NamaSekolah/madrasah
:............................................(14)
Alamat

:............................................(15)
Kelurahan

:............................................(16)
Kecamatan

:............................................(17)

:............................................(18)
Kabupaten/kota
Provinsi

:...........................................(19)
Telp/fax

:.(20)

NilaiPKGURUuntuk:
(21)
Pembelajaran/Pembimbingan
(22)
Tugastambahansebagai..(1)
KonversinilaiPKGURUkedalamskala0100sesuaiPermennegPANdanRBNo.16Tahun2009
Nilai PKG (skala 100) =

Nilai PKG
100
Nilai PKG Maksimum

(23)
Pembelajaran/Pembimbingan
(24)
Tugastambahansebagai.(1)
SebutandanprosentaseangkakreditsesuaidenganPermennegPANdanRBNo.16Tahun2009
Sebutan(25)
Pembelajaran/Pembimbingan
Sebutan(27)
Tugastambahansebagai..(1)
Perolehanangkakredit(pembelajaran/pembimbingan)pertahunbagigurudengan
tugastambahansebagai..(1)
(AKKAKPKBAKP)x(JM/JWM)xNPK
AngkaKreditpertahun=x..%(29)
4
Perolehanangkakredittugastambahanpertahunsebagai.(1)
(AKKAKPKBAKP)xNPK
AngkaKreditpertahun=x...%(31)
4
Totalperolehanangkakredittahun.(33)

(26)
(28)

(30)

(32)
(34)

..,..(35)
Guruyangdinilai

((36))

Penilai

((37))

KepalaDinasKab/Kota

((38))

214


PETUNJUKPENGISIANFORMATREKAPITULASIHASILPENILAIANKINERJAGURU
DENGANTUGASTAMBAHAN

NOMOR
URAIAN
KODE
1.
(1)
IsikantugastambahanyangdiembanolehGuruyangdinilai
2.
(2)
Tuliskan nama guru yang dinilai sesuai dengan yang tercantum dalam SK
pengangkatansebagaiguru.
3.
(3)
TuliskanNomorIndukPegawaiguruyangbersangkutan.
4.
(4)
Tuliskan tempat dan tanggal lahir guru yang dinilai sesuai SK pengangkatan
sebagaiguru.
5.
(5)
Tuliskanpangkat,jabatan,dangolonganruangterakhirgurutersebutterhitung
mulaitanggalberlakunyaSKpengangkatansebagaipemberiantugastambahan.
6.
(6)
Tuliskan terhitung mulai tanggal berlakunya pangkat/jabatan/golongan
berdasarkanSKpengangkatantugastambahanyangdiemban.
7.
(7)
Tuliskantahunmulaibekerjasebagaigurudisekolahini.
8.
(8)
Tuliskanmasakerjasebagaiguru(berapatahundanberapabulan).
9.
(9)
Tuliskanmulaikapangurumengembantugastambahantersebut
10.
(10)
Tuliskan masa kerja guru dalam mengamban tugas tambahan (berapa tahun,
berapabulan)
11.
(11)
TuliskanjeniskelaminguruyangdinilaidengancaramencorethurufLatauP.
12.
(12)
Tuliskankualifikasipendidikanterakhirgurubesertaspesialisasinya.
13.
(13)
Tuliskanprogramkeahlianyangdiampuguruyangdinilai.
14.
(14)
Tuliskannamasekolah/madrasahtempatbertugasnyaguruyangdinilai.
15.
(15)
Tuliskanalamatsekolah/madrasahtempatbertugasnyaguruyangdinilai.
16.
(16)
Tuliskanlokasikelurahansekolah/madrasah.
17.
(17)
Tuliskanlokasikecamatansekolah/madrasah.
18.
(18)
Tuliskanlokasikabupaten/kotasekolah/madrasah.
19.
(19)
Tuliskanlokasiprovinsisekolah/madrasah.
20.
(20)
Tuliskannomortelepondanfaxsekolah/madrasah.
21.
(21)
IsikanhasilPKGURUsesuaiformatrekapPKGURUsubunsur
pembelajaran/pembimbingan.
22.
(22)
DiisidenganhasilPKGURUsesuaiformatrekapPKGURUdengantugas
tambahanyangsesuai.
23.
(23)
IsikannilaiPKGURUsubunsurpembelajaran/pembimbinganyangtelah
dikonversikedalamskala0100sesuaiPermennegPANdanRBNo.16Tahun
2009melaluiperhitunganmenggunakanrumus:
Nilai PKG
Nilai PKG (skala 100) =
100

NO

Nilai PKG Maksimum

Keterangan:
Nilai PKG skala 100 adalah nilai PK GURU subunsur
pembelajaran/pembimbingan atau tugas tambahan yang relevan dengan
fungsisekolah/madrasahdalamskala0100(sesuaiPermennegPANdanRB
No.16Tahun2009).

215

NO

NOMOR
KODE

24.

(24)

25.

(25)

26.

(26)

27.

(27)

28.

(28)

29.

(29)

30.

(30)

URAIAN
NilaiPKGadalahnilaitotalPKGURUsubunsurpembelajaran/pembimbingan
atau tugas tambahan yang relevan dengan fungsi sekolah/madrasah yang
diperolehsebelumdiubahkedalamskala0100.
Nilai PKG maksimum adalah nilai tertinggi PK GURU, untuk pembelajaran
adalah
56
(= 14 x 4), untuk pembimbingan adalah 68 (= 17 x 4) atau untuk tugas
tambahan yang relevan dengan fungsi sekolah/madrasah sesuai dengan
instrumenmasingmasing.
IsikannilaiPKGURUuntuktugastambahanyangtelahdikonversikedalamskala
0100sesuaidenganPermennegPANdanRBNo.16Tahun2009melalui
perhitungandenganmenggunakanrumussepertipada(23).
Isikan sebutan yang diperoleh guru untuk subunsur pembelajaran/
pembimbingansebagaimanaditetapkandalamPermennegPANdanRBNo.16
Tahun2009(berdasarkanhasil(23)).
NilaiHasilPK
Persentase
Sebutan
Angkakredit
GURU
91100
Amatbaik
125%
7690
Baik
100%
6175
Cukup
75%
5160
Sedang
50%
50
Kurang
25%
Isikan persentase angka kredit yang diperoleh guru untuk subunsur
pembelajaran/pembimbingansesuaisebutanpada(25).
Isikan sebutan yang diperoleh guru untuk subunsur tugas tambahan
sebagaimana ditetapkan dalam Permenneg PAN dan RB No. 16 Tahun 2009
(berdasarkanhasil(24)).
Isikan persentase angka kredit yang diperoleh guru untuk subunsur tugas
tambahansesuaisebutanpada(27).
Isikan persentase bobot subunsur pembelajaran/pembimbingan sesuai tugas
tambahan yang diemban guru (25% untuk kepala sekolah, 50% untuk wakil
kepalasekolahatautugaslainnya)
Isikanperolehanangkakreditsubunsurpembelajaran/pembimbinganpertahun
yang dihitung berdasarkan rumus sistem paket tersebut dikalikan dengan
persentasesesuaiperolehan(29).
Rumussistempaketpembelajaran/pembimbingan:
(AKKAKPKBAKP)x(JM/JWM)xNPK
AngkaKreditpertahun=
4
Keterangan:
AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk
kenaikanpangkat.
AKPKBadalahangkakreditPKByangdiwajibkan(subunsurpengembangan
diri,karyailmiah,dan/ataukaryainovatif).
AKP adalah angka kredit unsur penunjang yang ditetapkan menurut

216

NO

NOMOR
KODE

31.

(31)

32.

(32)

33.
34.

(33)
(34)

35.
36.

(35)
(36)

37.
38.

(37)
(38)

URAIAN
PermennegPANdanRBNo.19Tahun2009.
JM adalah jumlah jam mengajar (tatap muka) guru di sekolah/madrasah
ataujumlahkonseliyangdibimbingolehguruBK/Konselorpertahun.
JWM adalah jumlah jam wajib mengajar (24 40 jam tatap muka per
minggu)bagigurupembelajaranataujumlahkonseli(150250konseliper
tahun)yangdibimbingolehguruBK/Konselor.
NPK adalah persentase perolehan angka kredit sebagai hasil penilaian
kinerja
4adalahwakturataratakenaikanpangkatreguler,(4tahun).
JM/JWM = 1 bagi guru yang mengajar 2440 jam tatap muka per
mingguataumembimbing150250konselipertahun.
JM/JWM=JM/24bagiguruyangmengajarkurangdari24jamtatapmuka
per minggu atau JM/150 bagi guru BK/Konselor yang membimbing
kurangdari150konselipertahun.
Isikan persentase bobot subunsur tugas tambahan yang diemban guru (75%
untuk kepala sekolah, 50% untuk wakil kepala sekolah atau tugas tambahan
lain)
Isikanperolehanangkakredittugastambahanberdasarkanrumussistempaket
berikut:
(AKKAKPKBAKP)xNPK
AngkaKreditpertahun=
4
Keterangan:
AKK adalah angka kredit kumulatif minimal yang dipersyaratkan untuk
kenaikanpangkat.
AKPKBadalahangkakreditPKByangdiwajibkan(subunsurpengembangan
diri,karyailmiah,dan/ataukaryainovatif).
AKP adalah angka kredit unsur penunjang yang ditetapkan menurut
PermennegPANdanRBNo.19Tahun2009.
NPK adalah persentase perolehan angka kredit sebagai hasil penilaian
kinerja.
4adalahwakturataratakenaikanpangkatreguler,(4tahun).
Isikantahundilaksanakannyapenilaiankinerja.
Isikan total perolehan angka kredit bagi guru dengan tugas tambahan yang
dinilai.
Tulislahtempatdantanggaldilakukannyapengisianformatini.
Isilah dengan tanda tangan dan nama guru yang dinilai sebagai bukti bahwa
gurutelahmengetahuidansetujudenganestimasihasilpenilaiankinerjayang
diperoleh.
Isilahtandatangandannamapenilai.
Isilah dengan tanda tangan dan nama kepala sekolah/madrasah tempat guru
bekerja, sebagai bukti bahwa kepala sekolah/madrasah telah mengetahui dan
menyetujuidenganhasilnilaikinerjaguruyangdiberitugastambahan.

217

218

LAMPIRAN5
LAPORANKENDALIKINERJAGURU

219

LAPORANKENDALIKINERJAGURU
(Laporandibuatdalamkurunwaktu3tahununtukmenunjukkanterjadinyakemajuan/peningkatankinerjaguru)

Namasekolah:

TandatanganKepala
(3)
(1)
Sekolah:
Alamatsekolah:
(2)
NamaKepalaSekolah:
(4)

Jumlah
Hasil
Jumlah
Hasil
Jumlah
Hasil
Tahunajaran
Tahunajaran
Tahunajaran
penilaian
guru
penilaian
guru
penilaian
guru
(5)
Tercapai
(6)
(5)
Tercapai
(6)
(5)
Tercapai
(6)
Tidak
(7)
Tidak
(7)
Tidak
(7)
tercapai
tercapai
tercapai
Tidakdinilai
(8)
Tidakdinilai
(8)
Tidakdinilai
(8)
Jumlahtotalguru
(9)
Jumlahtotalguru
(9)
Jumlahtotalguru
(9)

Tahunajaran: Tahunajaran: Tahunajaran:


(11)
(11)
(11)
No
NamaGuru
Catatan
PK
PK
PK
PKGuru
PKGuru
PKGuru
Sasaran Guru
Sasaran Guru
Sasaran Guru
Formatif
Formatif
Formatif
Sumatif
Sumatif
Sumatif
1
(10)
(12)
(13)
(14)
(12)
(13)
(14)
(12)
(13)
(14)
(15)
2

.. dst.

Catatan:Kohortdatadalambeberapatahunakademikakanmemberikangambarantentangkemajuan/peningkatankinerja
PKGuruformatifadalahnilaiPKGuruyangdiperolehgurupadapenilaiandiawalsemester1
SasaranadalahnilaiPKGuruyangditargetkanakandicapaisetelahmelaksanakanPKB
PKGurusumatifadalahnilaiPKGuruyangdiperolehgurupadapenilaiandiakhirsemester2

220

PETUNJUKPENGISIANLAPORANKENDALIKINERJAGURU

NOMOR
NO
URAIAN
KODE
1
2
3
1.
(1)
Tulislahnamasekolahyangmelaporkankendalikinerjaguru
2.
(2)
Tulislahalamatsekolahlengkapdengannamajalan,nomor,kota,
provinsi
3.
(3)
BubuhkantandatanganKepalaSekolahyangmelaporkankendali
kinerjaguru
4.
(4)
TulislahnamaKepalaSekolahyangmelaporkankendalikinerja
guru
5.
(5)
Tulislahtahunpelajaranpelaporankendalikinerjagurusecara
terurutmulaidaritahunpertamadikotakpalingkirihinggatahun
ketigadikotakpalingkanan
6.
(6)
Tulislahjumlahguruyanghasilpenilaiankinerjanyamencapai
standar
7.
(7)
Tulislahjumlahguruyanghasilpenilaiankinerjanyatidakmencapai
standar
8.
(8)
Tulislahjumlahguruyangkinerjanyatidakdinilai
9.
(9)
Tulislahtotaljumlahguru,baikyangtelahdinilaikinerjanya
(mencapaistandaratautidakmencapaistandar)maupunyang
kinerjanyatidakdinilai
10.
(10)
Tulislahnamagurudisekolahyangtelahdinilaikinerjanya
11.
(11)
Tulislahtahunpelajaranpelaporankendalikinerjagurusecara
terurutmulaidaritahunpertamadikotakpalingkirihinggatahun
ketigadikotakpalingkanan
12.
(12)
TulislahhasilPKGuruFormatifuntuksemuaguruyangdilaporkan
dalamlaporankendalikinerjaguru
13.
(13)
Tulislahharapan(target)hasilPKGuruuntuksemuaguruyang
dilaporkandalamlaporankendalikinerjagurusetalhguru
melakukanPKB
14.
(14)
TulislahhasilPKGuruSumatifuntuksemuaguruyangdilaporkan
dalamlaporankendalikinerjaguru
15.
(15)
Tuliskankomentar(catatan)berdasarkanhasilPKGuruselama3
(tiga)tahununtuksemuaguruyangdilaporkandalamlaporan
kendalikinerjaguru

221