Anda di halaman 1dari 1848

DIRECTORY ESTABLISHMENT

SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 1410-Quarrying of stone, sand and clay

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1994

10 - 50

SHRIKANTH D HOSAMAHI BEHIND S V M


COLLEGE

GROUND LKAL DIS BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

SHANTKUMAR R SURNUR BALAKUND


ROAD LKAL

NETRAVATHI ILES NDUSTRIES ILKAL DIST BAGALKO PIN CODE: 587125, STD CODE: 08351,
TEL NO: 270682, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

RAMGOPALJI LAHOT GRANITES HIRE


UPANAL V

LLAGE ILKAL ,
N.A.

1997

10 - 50

DURAGAPPA SHNGAPPA HULGERI


BALKUND ROAD

HIRE UPANAL ILKAL DIST BAGALKO ,


272275, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

MANJUNATH M SHETTAR SHREE GURU


KOTTURESHW

AR GRANITES BALKUNDI ROAD HIRE UPANAL ILKAL DIST BAGALKO PIN CODE: 587125, STD
CODE: 08357, TEL NO: 270286, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

ARVEEND MANGALORE BALKUNDI ROAD


HIRE UPNA

L ILKAL DIST BAGALKO ,


NA, E-MAIL : N.A.

1998

10 - 50

UTTAM S SOMANI NEAR SHRINIVAS


TAKIES

HANAMASAGAR ROAD LKAL ,


NO: NA, E-MAIL : N.A.

1998

10 - 50

HANAMANTAPAA R RATHOD BALAJI


ENTERPRISES

BALKUNDI ROAD ILKAL DIST BAGALKO ,


272643, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

GOUTAM M BORA G M GRANITES


BALKUND ROAD

HIRE UPANAL ILKALDIS BAGALKOT ,


272425, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

10

VISHNAKANT HAHMANDAS KARWA

HEAR SRIHIVAS TALKIES HANAMAS AR ROAD ILKAL PIN CODE: 587125, STD CODE: 08351,
TEL NO: 270077, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

11

RAJGOPAL MANGILAL DARAK

HANAMASAGAR ROAD NEAR SRINIVAS ALKIES ILKAL PIN CODE: 587125, STD CODE: 08351,
TEL NO: 2711157, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

12

USMANGAN IBRAHIM SAHEB UMNABAD

TAJ INERNATIONAL GRAHITE HANAMASAGAR ROAD ILKAL DIST BAGALKO PIN CODE: 587125,
STD CODE: 08351, TEL NO: 270695, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

13

BALDEV MUKESHKUMAR PRIAPAT

NEAR SHRINIVAS ALKIES 77 1 3 8 HANAMSAGA R ROAD LKAL PIN CODE: 587125, STD CODE:
08351, TEL NO: 270627, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

PIN CODE: 587125, STD CODE: 08351, TEL NO: 270366,

PIN CODE: 587125, STD CODE: 08351, TEL NO: 270476, FAX NO: NA, E-MAIL :

PIN CODE: 587125, STD CODE: 08351, TEL NO:

PIN CODE: 587125, STD CODE: 08351, TEL NO: 271455, FAX NO:

PIN CODE: 587125, STD CODE: 08351, TEL NO: 270860, FAX

PIN CODE: 587125, STD CODE: 08351, TEL NO:

PIN CODE: 587125, STD CODE: 08351, TEL NO:

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

DISTRICT : Bagalkot

Name of Establishment

(1)
14

STATE : KARNATAKA

Address / Telephone / Fax / E-mail

(2)
VEERPAKASHAPPA AMABARGOL
GRANITES HIRE UP

(3)
NAL ILKAL DIST BAGALKO ,
NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: 08351, TEL NO: NA , FAX NO:

Year of start of
Operation

Employment
Class

(4)

(5)

2002

10 - 50

NIC 2004 : 1513-Processing and preserving of fruit, vegetables and edible nuts
15

HOLABASAPPA GURAPADAPPA GHATTAD

OIL INDUSTRIES KERUR TQ BADAM DIST BAGALKO PIN CODE: 587206, STD CODE: NA , TEL
NO: 230266, FAX NO: NA, E-MAIL : N.A.

1933

10 - 50

16

B B NILOGAL

OIL MILL KERUR Q BADAMT ,


NO: NA, E-MAIL : N.A.

1967

10 - 50

17

M C GHATTAD

BASWESHWER OIL MILL KEAUR ,


FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

OIL INDUSTRIES KERUR TQ BADAM DIST BAGALKO PIN CODE: 587206, STD CODE: 08357, TEL
NO: 230012, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

JAMAKHANDI ROAD MUDHOZ TALUK MUDHOL DIS BAGBLAKO PIN CODE: 587313, STD CODE:
08350, TEL NO: 281142, FAX NO: 281092, E-MAIL : N.A.

1999

101 - 500

PIN CODE: 587206, STD CODE: 08357, TEL NO: 230023, FAX

PIN CODE: 587206, STD CODE: 08357, TEL NO: 230058,

NIC 2004 : 1532-Manufacture of starches and starch products


18

MALLAPPA CHANNAMALLAPPA GHATTAD

NIC 2004 : 1542-Manufacture of sugar


19

NIRANI SHUGAR WORKS

NIC 2004 : 1551-Distilling, rectifying and blending of spirits; ethyl alcohol production from fermented materials
20

MANAGER LADIES HOSTEL BAGALKO

COLLEGE CAMPUS ,
E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00223003, FAX NO: NA,

1980

10 - 50

21

MANAGER POLYTECHANIC BOYS


HOSTEL BAGALKO

COLLEGE CAMPUS ,
: N.A.

PIN CODE: 51817, STD CODE: 08354, TEL NO: NA , FAX NO: NA, E-MAIL

1982

10 - 50

22

MANAGER BOOMARADDI HOSTEL


BAGALKOT

COLLEGE CAMPUS BAGALKO ,


FAX NO: NA, E-MAIL : N.A.

1950

51 - 100

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00222986,

NIC 2004 : 1552-Manufacture of wines

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
23

STATE : KARNATAKA

(2)
SURENDR REDD

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(3)
MAIGUR ROAD JAMKHAND TALUK JAMAKHANDI DISTRIC BAGALKOT PIN CODE: 587301, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

2005

10 - 50

NIC 2004 : 1711-Preparation and spinning of textile fiber including weaving of textiles (excluding khadi/handloom)
24

BASAPPA SIDAMALLAPPA SUNKAD

TATAGAR GALL BANAHA TALUK JAMAKHANDI DIS BAGALAKO PIN CODE: 587311, STD
CODE: 08353, TEL NO: 230084, FAX NO: NA, E-MAIL : N.A.

1945

10 - 50

25

VITTHAL R KADAM

THE BADIGER AND KAMMAR KAIMARG UTPADANE SINGH SAMSTHE B ANHA PIN CODE:
587311, STD CODE: 08353, TEL NO: 230014, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

26

SANGAPPA GANGAPPA GANESHNAVAR

SOMAWAR PETH BANAHATTI TAL JAMAKHANDI DIS BAGALKOT PIN CODE: 587311, STD
CODE: NA , TEL NO: 230119, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

27

JAYAVANTAPPA ALLAPPA BANAKAR

LAXM NAGAR NEAR BUGS STAND ROAD BANAHAT TAL JAMAKHAND DIST BAGALKO PIN
CODE: 587311, STD CODE: NA , TEL NO: 230294, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

28

TIRUPATI VENKATESHWAR SIZING


WORKS AMMAN

NAPPA ROAD BANAHATTI ALUK JAMAKHAND DIS BAGALKOT PIN CODE: 587311, STD CODE:
23036, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

29

MALLINATH SANKAPPA KAKAMAR &


BROTHERS

AT POS BANAHA TQ JAMAKHND BAGALKO SOMAWARA PETA BANAHTTI PIN CODE:


587311, STD CODE: 08353, TEL NO: 230242, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

30

PRAKASH ISYARAPPA CHAVVANNAYAR

LAXM NAGAR BANAHA TAL JAMAKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE: NA
, TEL NO: 230213 4, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

31

GANGAPPA BASPPA MUGA

THE POST MARUT TEMPLE MUGATTI LANE BANAHA PIN CODE: 587311, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

32

DUNDAPPA S DHODPADAL

KUMBAR GALLI OR TUNGAL GALLI RABKAV PIN CODE: 587314, STD CODE: 08353, TEL NO:
2300186, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

33

RAMANNA BHJMAPPA KULAGOD


AMMANNAPPA ROAD

BANAHA TALUK JAMAKHANDJ DIS BAGALKOT ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587311, STD CODE: NA , TEL

1979

10 - 50

34

SANGAPPA RAMAPPA JALEGIDAD

AT POS BANAHA TG JAMAKHNDI D.BAGLKOT JAMAKNDI ROAD BANAH PIN CODE: 587311,
STD CODE: NA , TEL NO: 230691, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

35

RAJASHEKHAR B SORAGANV

ITNAL LANE MANGALWAR PETH RANAHA TQ JAMAKHAND PIN CODE: 87311, STD CODE:
08353, TEL NO: 23011351, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

36

CHETAN SIZING WORKS

PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE: 08353, TEL NO:
230210, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

37

B K SARIES

SHRI MALLIKARJUN BASAPPA KESARAGOPPA TATAGAR GALL BANAHA TALUK


JMMAKHANOI PIN CODE: 587311, STD CODE: 08353, TEL NO: 230107, FAX NO: NA, E-MAIL :
N.A.

1980

10 - 50

38

SHRI GAYATRI SARY CENTER SADASHIV


NAGAR

BANAHA TQ JAMAKHAND DT BAGALAKOT ,


NO: 230175, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

39

M/S PARAPPA GURALINGAPPA


URABHINAVAR

P RABKAV NEAR OLL NAKA RABKAVI TQ JAMKHANDI D BAGALKOT PIN CODE: 587314, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

40

SHENKARAPPA SHIVALINGAPPA
MARABASNAWAB

DEAGABARA TEMPLE GALLI HOSUR PIN CODE: 587314, STD CODE: 08353, TEL NO: 231484,
FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

41

MALLIKARJUN DANAPPA KOKKALAK

ATPOST RABKAVI Q JAMKHAND DIST BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

42

KADAPPA S SHILVANT

KADAPPA S SHILVANT PENDARI GALLI BANHAIT ,


NO: 00237678, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

43

SHRINIVAS SAIZING WORKS

POST BANAHATTI Q JAMAKMANDI DIS BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

44

RAVINDRA P KARALATTI

NEAR SHWARLING TEMPLE BANAHATTI ,


230336, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

45

ASHOK V PA AN

LAXM NAGAR PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE:
08353, TEL NO: 230539, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

46

GIRIMALLAPPA ANDYANAPPA BAGEWADI

NEAR BASAWANAGUD TEMPLE HOSUR PIN CODE: 587314, STD CODE: 08353, TEL NO:
230703, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

47

SHANKREPPA B HALLYAL

TATGAR GALLI POS BANHATTI TQ JAMKHANDI D BAGALKOT PIN CODE: 587311, STD CODE:
08353, TEL NO: 230543, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

48

SHIVANAND BALAPPA GENI

KUMBAR GALLI RABKAV PIN CODE: 587314, STD CODE: 08353, TEL NO: 230057, FAX NO: NA,
E-MAIL : N.A.

1985

10 - 50

PIN CODE: 587311, STD CODE: 08353, TEL

PIN CODE: 587314, STD CODE: NA , TEL

PIN CODE: 587311, STD CODE: NA , TEL

PIN CODE: 587311, STD CODE: NA , TEL

PIN CODE: 581711, STD CODE: 08353, TEL NO:

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

(5)
10 - 50

NEAR BASAWANGUDI TEMPLE HOSUR PIN CODE: 587314, STD CODE: 08353, TEL NO: 230665,
FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

BADDUR LANE POST BANHA TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE:
08353, TEL NO: 230418, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1990

10 - 50

SHINSHA USAMANSAB JHDWALE &


SONS

AT POS BANA TQ JAMAKHANDI DISTBAGALK OTASHOK COLONEY GANPAT GUDI ONI PIN
CODE: 587311, STD CODE: NA , TEL NO: 230582, FAX NO: NA, E-MAIL : N.A.

50

BASAPPA ANDYANAPPA BAGAWAD

RUDRAPPA V CHANPANNAVAR

Employment
Class

(4)
1987

49

51

Year of start of
Operation

52

SAIBABA STZING WORKS AMMANNAPPA


ROAD BAN

AHATTI ALUK JAMAKHAND DIST BAGALKO ,


NO: 231070, FAX NO: NA, E-MAIL : N.A.

53

MAHADEV NUNNOLLI

LAXM NAGAR PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

54

ASHA SARY CENTER WATER ANK NEAR


NOORANI

MASJID ATAGAR ONI BANAHATTI ALUK JAMAKH ANDI DIS BAGALAKO PIN CODE: 587311,
STD CODE: 08353, TEL NO: 230597, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

55

SHRI DHANALAXM SARY CENTER

SHRI CHANNAPPA GOSHIRAPPA KARALA TATAGAR GALL BANAHA TALUK JAMAKHANDI


PIN CODE: 587311, STD CODE: 08353, TEL NO: 230732, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

56

GANESH HANDLOOM WORKS

GUNAKI LANE RABKAV PIN CODE: 587314, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

1990

10 - 50

57

MALLAKARJUN SHIVALINGAPPA MU UR

MUTTUR LEN RABKAVI Q SAMKHAND DIST BAGALKO PIN CODE: 587314, STD CODE: NA , TEL
NO: 230024, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

58

CHULAG WEAVING FACTORY

KATAGI ONI RABKAV PIN CODE: 587314, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

1991

10 - 50

59

SRI PAMPANNA KALAG

WARDNO6 NEAR SRI AMRESHWAR JYOTIRBHAVAN ILKAL TALUKA HUNGUND DISTIC


BAGAKKOT PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

60

SHRI SHANMOKH S GOMB

THE MANGGER SOUJANNY HANDLUM SOCIETY MAHALINGAPUR PIN CODE: 587312, STD CODE:
NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

1992

10 - 50

61

THE CHAIRMAN

KPI CO OP SOCIETY RABKAV ,


NA, E-MAIL : N.A.

PIN CODE: 587314, STD CODE: NA , TEL NO: NA , FAX NO:

1992

10 - 50

62

MAHADEV CHANAMALLAPPA HARUGERI

BEHIND ARUN TALKIES BANAHATTI TQ JAMKHANDI DT BAGALKO PIN CODE: 587311, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

PIN CODE: 587311, STD CODE: 08353, TEL

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

(1)

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1993

10 - 50

63

SHRI VEERBHADRESHWAR SAIGING


WORKS ATAGA

R LANE BANAHATTI Q JAMAKHANDI D BAGALKO ,


TEL NO: 230255, FAX NO: NA, E-MAIL : N.A.

64

SIDRAYAPPA S SHEELAVANTH

LAXM NAGAR PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE:
08353, TEL NO: 230447, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

65

MALLAPPA MINGAPPA GOTUR

WARDNO6 NEAR MATAN MARKE ILKAL TALUKA HUNGUND DTSTI BAGALKOT PIN CODE:
587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

66

KADAPPA RAPPA HANAGANDI

KOKATNUR LANE BANAHATTI TQ JAMKHANDI DT BAGALKO PIN CODE: 587311, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

67

PRABHU PANDITAPPA KARALA


TAMMANAAPPAIR

OAD BANAHA TALUK JAMAKHANDI DIS BAGAL KOT PIN CODE: 587311, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

68

SHRI MAHADEV BALAPPA

BADDUR ONI BANAHATTI ALUK JAMAKHAND DIST BAGALAKOT PIN CODE: NA , STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

69

VIRUPAKSHAPPA MAHAJAN

MANGALANAR PETH BANAHA TA JAMAKHAND PIN CODE: 587311, STD CODE: 08353, TEL NO:
2332026, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

70

VEERAPPA VIRUPAKSHAPPA
KOKATNUR

KOKATNUR LANE BANAHA TQ JAMKHANDI DT BAGALKO PIN CODE: 587311, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

71

SIDDAPPA BASAPPA BELAGAL

KUMBAR ONI RABKAVI Q JAMKHAND DT BAGALK OTE PIN CODE: 587314, STD CODE: 08353,
TEL NO: 230187, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

72

MURAGEPPA SHIVAPPA MOTAG

KUMBAR GALLI RABKAV PIN CODE: 587314, STD CODE: 08353, TEL NO: 231571, FAX NO: NA,
E-MAIL : N.A.

1999

10 - 50

73

VEERAPPA VIRUPAKSHAPPA
KOKATNUR

KOKATNUR LANE BANAHATTI JAMKHAND


TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

2000

10 - 50

74

VEERAPPA VIRUPAKSHAPPA
KOKATNUR

KOKATNUR LANE BANAHA TQ JAMAKHAND D BAGALKOT PIN CODE: 587311, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

75

M M H JUVJAPPANAVAR AND BROTHER


SAREESHOP

SHANKAR S JUNJAPPANAVAR SONAVAR PETE BANAHATTI PIN CODE: 587311, STD CODE:
08353, TEL NO: 230289, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

76

ISVARAPPA PARAPPA CHAVVANNAVAR

LAXM NAGAR BANAHA TAL JAMAKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

MAND

PIN CODE: 587311, STD CODE: 08353,

BAGALKOT PIN CODE: 587311, STD CODE: NA ,

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

(2)

77

PARAPPA G DHADUTJ

78

Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

LAXM NAGAR PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

MALLAPPA B JEERAGAL

KUMBAR GALLI RABKAV PIN CODE: 587314, STD CODE: 08353, TEL NO: 230535, FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

79

VARUPAKSH G MUGATI

MUGATI ROAD BANAHA ,


E-MAIL : N.A.

2001

10 - 50

80

M C MUGATI

MULEGANV ROAD BANAHATTI ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

2001

10 - 50

81

C H SHETTI

MULEGANV ROAD BANAHATTI ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

2001

10 - 50

82

KEERTHEPPA GACHH

NEAR O NO SCHOOL K E B ROAD LKAL ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: NA , TEL NO: NA ,

2002

10 - 50

83

B G MULEGANV

MULEGANV ROAD BANAHATTI ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

2002

10 - 50

84

INDUDHAR BASAPPA BELAGAL

NEAR YALLAMMA DEVI EMPLE MYADAR GALLI RABKAV PIN CODE: 587319, STD CODE:
08353, TEL NO: 230099, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

85

DATATARAY TIPPANNA CHILLAL

NEAR POLICE QUATERS WELL WARD NO 4 HOUSPA TH STREE ILKAL PIN CODE: 587125, STD
CODE: 08351, TEL NO: 270848, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

86

NAVEEN SHANKARAPPA MEOAKER


SALPATH WARD

NO 2 LKAL ,
N.A.

2004

10 - 50

87

RAVINDRA BADAG

NEAR MALLIKARJUN EMPLE AT PO BANHATTI Q JAMKHAND DT BAGALKO PIN CODE: 587311,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

88

GANPATHRAO HAJARE CO
MALLIKARJUN B JUGAL

JUGALL LENE RABAKAV TQ JAMAKHAND DT BA GALKOTE PIN CODE: 587314, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

89

PRASANNKUMAR GANPATHRAO HAJARE

KAMBALIBAJAR RABKAVI Q JAMKHAND DT BAGA LKOTE PIN CODE: 587314, STD CODE:
08353, TEL NO: 230505, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

90

KARNATAK KHADI GRAMODYOG


SAMYUKTA SANGH

FEDRATION KHAD KENDRA KERUR TQ BADAM DIST BAGALKO PIN CODE: 587206, STD CODE:
08357, TEL NO: 00230136, FAX NO: NA, E-MAIL : N.A.

1957

51 - 100

PIN CODE: 587311, STD CODE: NA , TEL NO: NA , FAX NO: NA,

PIN CODE: 587125, STD CODE: NA , TEL NO: 95451121, FAX NO: NA, E-MAIL :

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

91

SHIVSHKTHI YARN SHIGENG WORKS

GANGAPPA VIRUPAKSHPPA BANAKAR ASHOK COLNY ATPOST BANHTTI Q JAMKHNDI DIS


BAGALKOT PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1970

51 - 100

92

THE BANAHA
LTD

BASAWANAGARA BANAH TA JAMKHANDI DIST BAGALAKOT PIN CODE: 587311, STD CODE:
NA , TEL NO: 330316, FAX NO: 330316, E-MAIL : N.A.

1975

> 500

1958

10 - 50

1980

10 - 50

1985

51 - 100

2001

51 - 100

2001

10 - 50

CO OP SPTNNSNG MILL

NIC 2004 : 2211-Publishing of books, brochures, musical books and other publications.
93

SHRI SATTIGERT

SHRI SANGAMESHWAR PRINTING PRESS NEAR BANNIKA


CODE: NA , TEL NO: 250276, FAX NO: NA, E-MAIL : N.A.

94

AGDTTOR NADU DAILY NEWS PAPER


OFFICE

VENKATPETH BAGALKO DISTRICT BAGALKO ,


220765, FAX NO: NA, E-MAIL : N.A.

95

MANAGER BASAVALING PRINTINGPRESS


BAUALKO

COLLEGE CAMPUS BAGALKO ,


FAX NO: NA, E-MAIL : N.A.

96

VISAYA SHENKESWAR

K S S D C NDASTRIAL ARIYASP PLOT NO 9 KALADAGI ROAD BAGALKOT PIN CODE: NA ,


STD CODE: 08354, TEL NO: 00234197, FAX NO: 00234106, E-MAIL : N.A.

GULEDGUDDA PIN CODE: NA , STD

PIN CODE: NA , STD CODE: 08354, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00320689,

NIC 2004 : 2693-Manufacture of structural non-refractory clay and ceramic products


97

GURUM LAXMAN GRANITES FACTORY H


H 13 ROAD

HUNGUND ROAD LKAL DIS BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: NA , TEL NO: NA ,

NIC 2004 : 2694-Manufacture of cement, lime and plaster


98

S PATIL

KAANATAKA CEMENT PIPE FACTORY BELGAUM ROA D BAGALKOT PIN CODE: 587101, STD
CODE: 08354, TEL NO: 233555, FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

99

M D KAHORIYA NDUSTREES CEMENT


DIVISION

KANORIYA NDUSTREES LTD CEMENT DIVISION BAGALKOT PIN CODE: 587101, STD CODE:
08354, TEL NO: 00220252, FAX NO: NA, E-MAIL : N.A.

1954

101 - 500

1982

10 - 50

NIC 2004 : 2695-Manufacture of articles of concrete, cement and plaster


100

SUSHILAKUMAR S KALLYANASHE Y
MYSORE

CEMENT PIPE INDUSTRIES G6 INDUSTRIL STATE RAMBAG JAMAKHAND TALUK JAMAKHANDI


BAGALK PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

DISTRICT : Bagalkot

Name of Establishment

(1)
101

STATE : KARNATAKA

Address / Telephone / Fax / E-mail

(2)
SHRI VIAYA CONCRETE WORKS &
CEMENT PIPE

(3)
FACTORY BAGALKOT ,
NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220942, FAX NO:

Year of start of
Operation

Employment
Class

(4)

(5)

1975

101 - 500

NIC 2004 : 2696-Cutting, shaping and finishing of stone


102

ANKI STONES

ALAMPURPETH WARDWNO7 ILKAL PIN CODE: 587154, STD CODE: 08351, TEL NO: 271468, FAX
NO: NA, E-MAIL : N.A.

1990

10 - 50

103

YAMANUR SAKA

ALAMPURPETH WARDNO7 ILKAL PIN CODE: 587154, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1990

10 - 50

104

VENKATESH SAKA

ALAMPURPETH WARDNO7 ILKAL PIN CODE: 587150, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1990

10 - 50

105

AILI STONE NDUSTRIES

SRI MAHANTESH GADDAG ROAD NO 6 LKAL TALUK HUNGUND DISTIC BAGALKOT PIN CODE:
587125, STD CODE: NA , TEL NO: 270622, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

106

VENKATESH V SAKA ANMIT GRANAIT

ALAMPUR PETH ILKAL DIST BAGALKO STATE KARNATAKA PIN CODE: 587154, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

NIC 2004 : 5110-Wholesale on a fee or contract basis.


107

MAVALAGTCO AN JINNLNG FACTORY

COLLEGE ROAD NEAR LHARANTIMATH MANGAL BHA VAN BAGALKOT PIN CODE: 587101, STD
CODE: 08354, TEL NO: 220620, FAX NO: NA, E-MAIL : N.A.

1932

10 - 50

108

BEMBALAG JINNING TACTORY


BAGALKOT

COLLEGE ROAD BAGALKO ,


NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 220239, FAX

1970

10 - 50

109

THE BHARAT GAS SERVICE AGINES

RABAKAVI RABKAV TQ JAMKHANDI PIN CODE: 587314, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1978

10 - 50

1970

10 - 50

NIC 2004 : 5219-Other retail sale in non-specialized stores


110

GOVT OF INDIA ARCHAEOLOGICAL


MUSEUM BADAM

TQ BADAM DIST BAGALKO STATE KARNATARA ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587201, STD CODE: NA , TEL

NIC 2004 : 5231-Retail sale of pharmaceutical and medical goods, cosmetic and toilet articles

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
111

STATE : KARNATAKA

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)
ANAND PHARMACUTICALS TECTIVAL
FORMULATIR

(3)
GOVINDPUR GALL WARD S BLOCK 2O BESIDE STATEBANKOF HYDERABAO MUDHOL D
BAGALKO PIN CODE: 587313, STD CODE: 08350, TEL NO: 280375, FAX NO: 282694, E-MAIL :
N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1980

10 - 50

1925

10 - 50

1960

10 - 50

1985

10 - 50

1998

10 - 50

NIC 2004 : 5232-Retail sale of textiles, clothing, footwear and leather goods
112

SHRI K LAHOOTI CLOTHMERCHNT


JAMAKHAND

TALUK JAMAKAND DISTRICT BAGALKO ,


NO: NA, E-MAIL : N.A.

113

MANAGER SAMAGR GRAM SEVA SAMAT


CHINCHAKH

NDI TQ MUDHOL DI BAQALKOTI ,


NO: NA, E-MAIL : N.A.

114

DWARAKADHISH SOYARDHAN BHA AD

MANGALWAR PETH BHATTAD CLOTH CENTRE BANAHA


Q JAMAKHANDI DT BAGALKO PIN
CODE: 587311, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 587113, STD CODE: 08350, TEL NO: NA , FAX

NIC 2004 : 5260-Repair of personal and household goods


115

A S NYAMAGOUD

NEAR MAIN ELECTRICITY TRONSFORMER RABAKAVI ROAD MAHALINGAPUR PIN CODE:


587312, STD CODE: 08350, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 5510-Hotels; camping sites and other provision of short-stay accommodation
116

MANAGERB E C HOSTEL

NETAGI SUBHASHCHANDRABHOSE HOSTEL NIJALINGAPPA ROAD BAGALKOT PIN CODE:


587102, STD CODE: 08354, TEL NO: 233431, FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

117

PRINCIPAL

BEC VISHVESAWARAYYA HOSTEL VIDYAGIRI BAGALKOT PIN CODE: 587102, STD CODE:
08354, TEL NO: 233368, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1975

10 - 50

1979

10 - 50

1989

10 - 50

NIC 2004 : 5520-Restaurants, bars and canteens


118

MANAGER KINGS BAR AND


RESTAURANT

BAGALKOT COLLEGE ROAD ,


FAX NO: NA, E-MAIL : N.A.

119

MOHAN TEA CLUB KALADAG ROAD


BAGALKO

TALUK BASALKOT DISTRIC BAGALKOT ,


222700, FAX NO: NA, E-MAIL : N.A.

120

SHASHTRISAGAR RESTAURAN

NEAR BUSSTAND MUDHOL ALUK MUDHOL DISTRICT BAGALKO PIN CODE: 587313, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00221003,

PIN CODE: NA , STD CODE: 08354, TEL NO:

10

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

DISTRICT : Bagalkot

Name of Establishment

(1)
121

STATE : KARNATAKA

Address / Telephone / Fax / E-mail

(2)
MANEGER BLUEBELL BAR
&RESTAURAN BAGALKO

(3)
BUSSTAND ROAD ,
E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

PIN CODE: 587101, STD CODE: 08354, TEL NO: 225304, FAX NO: NA,

1998

51 - 100

NIC 2004 : 6022-Other non-scheduled passenger land transport


122

SAI MOTORS

IO ROOPLAND BELGAUM ROAD BAGALKOT PIN CODE: 587102, STD CODE: 08354, TEL NO:
234505, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

123

KARNATAKA STATE ROAD


CORPORATION CONTROL

UNIT MUDHOL TQMUDHOL BAGALKO ,


280401, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587313, STD CODE: NA , TEL NO:

1995

101 - 500

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220045, FAX NO: NA,
E-MAIL : N.A.

1970

10 - 50

1942

10 - 50

NIC 2004 : 6030-Transport via pipelines


124

SHREE G M K PLU COLLEGE BADAMI

NIC 2004 : 6411-National post activities


125

HEAD POS OFFICE JAMAKHAND

TALUK JAMAKHANDI DISTRIC BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

126

POST OFFICE MUDHOL

AT MUDHOL TALUKA MUDHOL DIST BAGALKO PIN CODE: 587313, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1958

10 - 50

127

SUB POST MASTER MANGALAWARPETH


AMMANNAPP

ROAD BANHA TALUK JAMAKHANDI DIS BAGAL KOT PIN CODE: 587311, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

1979

10 - 50

1984

10 - 50

1992

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

NIC 2004 : 6420-Telecommunications


128

CHIEF SUPRIDENTENT ELEPHONE


EXCHANGE

RURAL AREA BAGALKO ,


NA, E-MAIL : N.A.

129

THE MANAGER BSNL NEAR APMC

MAHALINGPUR TQ MUDHOL DIST BAGALKO PIN CODE: 587312, STD CODE: 08350, TEL NO:
270198, FAX NO: 270800, E-MAIL : N.A.

130

KANNAD MEDIUM HIGHSCHOOL LKAL

PIN CODE: 587101, STD CODE: 08354, TEL NO: 220666, FAX NO:

PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

11

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(1)

(2)

131

DURGA VINAR PRDPRITOR STATATION


RDAD

BDARDING AND LDPGINB STATION ROAD BAGALKO ,


TEL NO: 220687, FAX NO: 224992, E-MAIL : N.A.

(3)

132

CHIEF SUPRIDENTENT ELIPHONE


EXCHANGE

URBAN AREA BAGALKO ,


NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO: 220223, FAX NO:

1979

101 - 500

PIN CODE: 087101, STD CODE: 08354,

NIC 2004 : 6519-Other monetary intermediation. xz


133

THE GENARAL MANEGAR LAXM CO


OPRITIVE BAN

K NEAR MC ROAD AT POS GULEDAGUDD TA BADAM DIST BAGALAKOT PIN CODE: 587203,
STD CODE: 08357, TEL NO: 250310, FAX NO: NA, E-MAIL : N.A.

1913

10 - 50

134

JAMAKHANDI PATTANA SAHAKAR BANK


LTD

JAMAKHANDI UMARAMESHWAR ROAD JAMAKMNDI TALUK JAMAKHANDI DISTRIC BAGALKOT


PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1940

10 - 50

135

THE BAGALKOT DISTRIC CENTRAL CO


OPERATIV

E BANK LIMITED BRANCH JAMKHAND ,


FAX NO: NA, E-MAIL : N.A.

1952

10 - 50

136

M D VEERAPUR MANEGER SYNDICATE


BANK

SYNDICATE BANK UMARAMESHWAR ROAD JAMKHAND TALUK JAMKHAND DISTRICT BAGALKO


PIN CODE: 587301, STD CODE: 08353, TEL NO: 220024, FAX NO: NA, E-MAIL : N.A.

1957

10 - 50

137

THE MANAGER SYNDICATE BANK


HUNGUND

1958

10 - 50

138

THE MANAGER CO OP BANK LTD

SHRIVIJAY MAHANTESH CO OP BANK LTD HUNGUND PIN CODE: 587118, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1961

10 - 50

139

JAMKHAND TALUKA PRIMARY


COOPERATIVE

AGRICULTURE AND RURALDEVELOPMENT BANK LTD JAMAKHANDI DISTRIC BAGALKOT PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

140

STATE BANK OF INDIA MUDHOL WARD


NO 17

TA MUDHOL DI BAGALKO ,
E-MAIL : N.A.

1964

10 - 50

141

THE KARNATAKA BANK LTD

MAHALINGPUR TQ MUDHOL DIST BAGALKO PIN CODE: 587312, STD CODE: 08350, TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1966

10 - 50

142

THE MANAGER STATE BANK OF INDIA

HUNGUND ,

1970

10 - 50

143

STATE BANK OF MYSORE

PO RABKAVI Q JAMKHAND OIST BAGALAKOT KARNATAKA STATE PIN CODE: 587314, STD
CODE: 08353, TEL NO: 230244, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

PIN CODE: NA , STD CODE: 08353, TEL NO: 220010,

PIN CODE: 587118, STD CODE: NA , TEL NO: 00261022, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587313, STD CODE: NA , TEL NO: NA , FAX NO: NA,

PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

12

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

Address / Telephone / Fax / E-mail

(1)

(2)

144

STATE BANK OF TNDIA A D B JAMKHAND

KUDACH ROAD JAMKHANDT ,


220080, E-MAIL : N.A.

(3)

145

THE MANAGER VIJAYA BANK

146

***

147

Year of start of
Operation

Employment
Class

(4)
1972

(5)
10 - 50

NEAR SRI BASAVESHWAR CIRCLE MAHALINGAPUR TQ MUDHOL DIST BAGALKO PIN CODE:
587312, STD CODE: 08350, TEL NO: 270077, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

MANAGER VIJAYA BANK BAGALKOT KRESNA TALK 5K PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

MANGER STATE BANK OF MYSORE


KALADASI ROAD

MELLIGER COMPLEX BAGALKO DISTRICT BAGALKO PIN CODE: NA , STD CODE: 08354, TEL NO:
220206, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

148

MANAGER STATE BANK OF MYSORE

ILKAL TALUK HUNGUND DISTRICT BAGLKOT ,


270208, FAX NO: NA, E-MAIL : N.A.

1977

10 - 50

149

THE KARNATAK BANK LIMITED


JAMAKHANDI

TALUK JAMAKAND DISTRICT BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

1977

10 - 50

150

MANAGER

STATE BANK OF INDIA BRANCH JAMAKHAND DIST BAGALKO PIN CODE: 587301, STD CODE:
08353, TEL NO: 220032, FAX NO: 222333, E-MAIL : N.A.

1979

10 - 50

151

MANAGER CORPORATION BANK

MAIN MARKE BAGALKOT ,


NO: NA, E-MAIL : N.A.

1980

10 - 50

152

THE SYNDICATE BANK MUDHOL

AT POS MUDHOL Q MUDHOL DIST BAGALKO STATE KARNATAKA PIN CODE: 587313, STD
CODE: 08350, TEL NO: 280018, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

153

THE MANEGER

MAHALINGAPUR CO OP URBBN BANK MAHALINGPUR TY MUDHOL PIN CODE: 587312, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

154

M N KULKARNI MANEGER
CORPORATION BANK

CORPORATION BANK NEAR ASHOK CIRCLE UMARAM ESHWAR ROAD JAMKHAND PIN CODE:
587301, STD CODE: 08353, TEL NO: 220264, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

155

THE JAMKHAND URBAN CREDIT CO OP


BANK

GIRISH NAGAR ,
N.A.

1990

10 - 50

156

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

157

THE MANEGER SYNDIKET BANK


GULEDACUDD

NEAR M C ROAD TA BADAM ATPOST GULLDAGU DD DIS BAGALAKO PIN CODE: 587203,
STD CODE: 08357, TEL NO: 250344, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: 220080, FAX NO:

PIN CODE: 587125, STD CODE: 08351, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00223909, FAX

PIN CODE: 587302, STD CODE: NA , TEL NO: 220361, FAX NO: NA, E-MAIL :

13

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 6592-Other credit granting.

(3)

PIN CODE: 587201, STD CODE: 08357, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1970

10 - 50

158

SHREE VEER PULAKESAE CO


OPERATIVE BANK

BADAMS ,

159

MANEGAR SHREE VEERAPULAKESHI


URBAN CO OPA

RETIVE BANK LTD TQ BADAM DIST BAGALKO PIN CODE: 587206, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

160

PRESIDEN

HEMA VEMA EDUCATION SOCIETY HOUSING COLONY BAGALKO PIN CODE: 587101, STD
CODE: 08354, TEL NO: 222225, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

161

J S Y S NAVANAGAR DIST OFFICE

JALA SAMVARDHANE YOJANA SANGHA NAVANAGAR DIST BAGALKO PIN CODE: 587102,
STD CODE: 08354, TEL NO: 235140, FAX NO: 235140, E-MAIL : N.A.

2001

10 - 50

162

NANDIN KARNATAKA MILK FEDRATION


OFFICE

MAIGUR ROAD JAMKHAND TALUK JAMAKHANDI DIS BAGALKOT PIN CODE: NA , STD CODE:
NA , TEL NO: 224310, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

NIC 2004 : 6599-Other financial intermediation n.e.c.


163

MANAGER

SYNDICATE BANK BELGAUM ROAD BAGALKO PIN CODE: 587101, STD CODE: NA , TEL NO:
220759, FAX NO: NA, E-MAIL : N.A.

1942

10 - 50

164

THE MANAGER THE MUDHOL


COOPERATIVE BANK

LTD MUDHOL BRANCH MAHALINGAPUR INGAPUR TALUK MUDHOL DIS BAGALKOT PIN CODE:
587312, STD CODE: 08350, TEL NO: 00270111, FAX NO: NA, E-MAIL : N.A.

1942

10 - 50

165

THE URBAN CO OP BANK BANHA

MANGMLAVAR PETH BANHATTI Q JAMAKHANDI DIST BAGALKO PIN CODE: 587311, STD
CODE: 8353, TEL NO: 230147, FAX NO: NA, E-MAIL : N.A.

1943

10 - 50

166

SYNDICATE BANK BRANCH RABKAV

ISHWAR SANAKAL ROAD RABKAV TQ JAMKHANDI


DIST BAGALKO PIN CODE: 587314,
STD CODE: NA , TEL NO: 230223, FAX NO: NA, E-MAIL : N.A.

1955

10 - 50

167

MANEGER

CANARA BANK MAHAVEER ROAD BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1961

10 - 50

168

THE MUDHOL ALUK PRATHAMIK


SAHAKARA KRUSH

GRAMEEN ABIRUDDI BANK NIYAMIT MUDHDL TQMUDHOL BAGALKO PIN CODE: 587313, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

169

MANEGER

PRIMARY COOP AGRICULTURE AND RURAL DEVALOPMEN BANK LIMITED BAGALKO PIN CODE:
587101, STD CODE: NA , TEL NO: 220817, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

14

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1977

(5)
10 - 50

AT-POS MUDHOL Q-MUDHOL DIST-BAGALKOT STATE-KARNATAKA PIN CODE: 587313, STD


CODE: 08350, TEL NO: 280105, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

SHANKAR INGALGANVI

UNITED FAINANS CORPORATION LIMITED CHALUK YA COMPLEX MUDHOL ROAD JAMAKHAND


PIN CODE: 587301, STD CODE: NA , TEL NO: 00220403, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

173

BASVESHWAR BANK MUDHOL

AT MUDHOL TALUKA MUDHOL DIST MUDHOL BAGALKOT PIN CODE: 587313, STD CODE: 8350,
TEL NO: 283141, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

174

SHRI BILUR GURUBASAVA CREDIT


CO-OP SOCIE

Y LTD ADAT BAZAR ROAD BAGALKOT ,


220341, FAX NO: 226741, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO:

2001

10 - 50

175

BRANCH MANAGER

KARNATAKA STATE FINANCE CORPORATION SECTOR NO24 NAVANAGAR BAGALKO PIN


CODE: NA , STD CODE: 08354, TEL NO: 2354781, FAX NO: 235482, E-MAIL : N.A.

3001

10 - 50

176

SHRI BASAVESHWAR CO-OP BANK LTD


BAGALKOT

ADAT BAZAR ROAD BAGALKOT ,


FAX NO: 226741, E-MAIL : N.A.

1917

51 - 100

177

MANEGER

STATE BANK OF INDIA NEAR OWNPOLICE STATION BAGALKO PIN CODE: 587101, STD CODE:
NA , TEL NO: 220772, FAX NO: 2220306, E-MAIL : N.A.

1959

51 - 100

178

BRANCH MANAGER

LIFE NSURANCE CORPORATION SECTOR NO NAVANAGAR BAGALKO PIN CODE: NA , STD


CODE: 08354, TEL NO: 236060, FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

BRANCH JAMKHANDI DIS BAGALKOT BO_63J LIC NDIA COM PIN CODE: 587301, STD CODE:
08353, TEL NO: 00220016, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

170

STATE BANK OF TNDIA

PO BANAHATTI TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587311, STD CODE: 08353, TEL NO:
230356, FAX NO: NA, E-MAIL : N.A.

171

THE URBAN CO-OPERATIVK BANK LTD


MUDHOL

172

PIN CODE: 587101, STD CODE: 08354, TEL NO: 220341,

NIC 2004 : 6601-Life insurance


179

LIFE NSURANCE CORPORATION OF


NDIA

180

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 7111-Renting of land transport equipment


181

***

NIC 2004 : 7411-Legal activities

15

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

(2)

182

COUR OF HE CIVIL JUDGE JUNIOR DIV


AND

Address / Telephone / Fax / E-mail

(3)
J M F C HUNGUND ,
N.A.

PIN CODE: 587118, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

Year of start of
Operation

Employment
Class

(4)

(5)

1955

10 - 50

NIC 2004 : 7413-Market research and public opinion polling.


183

CIVIL COUR JUDGE

CIVIL COUR JUNIOR DIVISION BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO: 223659,
FAX NO: NA, E-MAIL : N.A.

1887

10 - 50

184

CIVIL COUR JUDGE

CIVIL COUR SENIOR DIVISION BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO:
220993, FAX NO: NA, E-MAIL : N.A.

1887

10 - 50

185

DISTRICT CO ORDINATOR MAHILA


SAMAKHYA KAR

NATAKA DIS IMPLEMENTATION UNI TEGG LAY OUT VIDYAGIR BAGALKOT PIN CODE: 587102,
STD CODE: 08354, TEL NO: 234624, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

NA

10 - 50

NIC 2004 : 7421-Architectural and engineering activities and related technical consultancy
186

RAMESH LAKSHMPPA MORATGI

CLASS CIVIL CONTRACTOR JYOTI COLONY VIOYAGIR BAGALKOT PIN CODE: 587102, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 7511-General (overall) public service activities


187

HEAD MASTER

KGS NO 1 NEAR SONY HOSPITAL BADAM ROAD GULEDGUDDE PIN CODE: NA , STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1864

10 - 50

188

CHIEF OFICER

PATTAN PANCHAYAT OFICE MAHALINGAPUR TZ MUDHOL DIST BAGALKO KARNATAK STATE


PIN CODE: 587312, STD CODE: 08350, TEL NO: 270035, FAX NO: NA, E-MAIL : N.A.

1872

10 - 50

189

TOWN MUNCIPAL COUNCIL MUDHOL

AT MUDHOL TALUKA MUDHOL DIST BAGALKO PIN CODE: 587313, STD CODE: 08350, TEL NO:
280029, FAX NO: NA, E-MAIL : N.A.

1872

10 - 50

190

K P C L ELECETRICAL OFFICE LKAL


DIS

BAGALKOT ,

1889

10 - 50

191

SECIION OFFICER

K P C L OFFICE BADAMI ROAD GULEDAGUDD PIN CODE: NA , STD CODE: NA , TEL NO:
250225, FAX NO: NA, E-MAIL : N.A.

1904

10 - 50

192

GOVERNMENT OF KARANATAK TALUK


PANCHAYA O

FFICE BADAMI DIS BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

1910

10 - 50

PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587201, STD CODE: 08357, TEL NO: 00220022,

16

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1910

10 - 50

PIN CODE: 587203, STD CODE: 08357, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1910

10 - 50

193

GOVT OF KARANATAKATAHASHILDAR
OFFICE BADA

194

TOWN PANCHAYAT BADAM DIST


BAGALKO

195

CHEEF OFEICAR

TOWN PACHANTITERUAL TQ JAMKHANDI DIS BAGALKOT PIN CODE: 587215, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1921

10 - 50

196

G D MAHAVARKAR

CIVIL JUDGE JUNIOR DIVN J M F C JAMAKHAV DI DIS BAGALKOT PIN CODE: 587301, STD
CODE: 08353, TEL NO: 223591, FAX NO: NA, E-MAIL : N.A.

1928

10 - 50

197

S S KAMATAGI

OFFICE OFFICE PUBLIC WORK DEP JAMKHAND DIST BAGALKO PIN CODE: 587301, STD CODE:
08353, TEL NO: 220019, FAX NO: NA, E-MAIL : N.A.

1943

10 - 50

198

GOVT OF KARANATAK POLICE


DEPARTMEN BADAM

DIS BAGALKOT ,
PIN CODE: 587201, STD CODE: 08357, TEL NO: 00220133, FAX NO:
00220133, E-MAIL : N.A.

1946

10 - 50

199

STATION SUPRIDEN

RAILWAY STATION BAGALKOT PIN CODE: 587101, STD CODE: 08354, TEL NO: 220422, FAX
NO: NA, E-MAIL : N.A.

1948

10 - 50

200

ASSISTAN SUB INSPECTOR

OFFICE OF THE ASSISTAN SUB INSPECTOR AND RAILWAY PROTECTION FORCE BAGALKO PIN
CODE: 587101, STD CODE: 08354, TEL NO: 224488, FAX NO: NA, E-MAIL : N.A.

1948

10 - 50

201

PRIMARY LAND DEVELOPMENT BANK


BADAMI

DIST BAGALKO ,
N.A.

1950

10 - 50

202

KARNAL 37 KARNATAK NATIONAL


CREDIT CORPS

BAGALKOT COLLEGE CAMPUS ,


FAX NO: NA, E-MAIL : N.A.

1950

10 - 50

203

ASSISTAN EXECUTIVE ENGTNEER

PUBLIC WORK DEPARTMENT SUBDIVISION BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL
NO: 00220788, FAX NO: NA, E-MAIL : N.A.

1950

10 - 50

204

OFFICE OF THE ASST EXECUTIVE


ENGENEER Z P

SUBDIVISION BADAMI BAGALKOT PIN CODE: 581201, STD CODE: 08357, TEL NO: 220054, FAX
NO: NA, E-MAIL : N.A.

1952

10 - 50

205

***

ARCHAE0LOGICAL SORVEY OF NDIA SUB CIRCLE OFFICE BAOAMI PIN CODE: 587201, STD
CODE: 08357, TEL NO: 00220047, FAX NO: 00220047, E-MAIL : N.A.

1952

10 - 50

206

AGRICULTURAL PRODUCE
MARKETING

COMMITTE JAMKHANDI DISTRICT BAGALKO ,


2200217, FAX NO: NA, E-MAIL : N.A.

1952

10 - 50

MI DSS BAGALKOT ,
00220037, E-MAIL : N.A.
,

PIN CODE: 587201, STD CODE: 08357, TEL NO: 00220037, FAX NO:

PIN CODE: 587201, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

PIN CODE: 587101, STD CODE: 08357, TEL NO: 00220616,

PIN CODE: 587302, STD CODE: NA , TEL NO:

17

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1952

10 - 50

207

MUNCIPAL COMMISSIONER

CITY MUNCIPAL COUNCIL RABAKAVI BANHA ,


230236, FAX NO: NA, E-MAIL : N.A.

208

N H SULEBHAV

ASST COMMINCER JAMKHANDI DIST BAGALKO PIN CODE: 587301, STD CODE: 08353, TEL NO:
220007, FAX NO: 222677, E-MAIL : N.A.

1953

10 - 50

209

SMT N M FIRAJADE

ASSISTAN DIRECTOR OF LAND RECORD OFFICE JAMKHAND DIST BAGALKO PIN CODE:
587307, STD CODE: 08353, TEL NO: 222001, FAX NO: NA, E-MAIL : N.A.

1956

10 - 50

210

SYNDTCATE BANK BADAM HEAD OFFICE


MANIPAL

1957

10 - 50

211

COUR OF HE CIVLL JUDGE SUG


DIVISION ED

M F C BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 221049, FAX NO: NA,
E-MAIL : N.A.

1958

10 - 50

212

ASSISTAN COMMISIONER OFFICE

BELGAUM ROAD BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO: 00220852, FAX NO:
00226460, E-MAIL : N.A.

1959

10 - 50

213

PRINCIPAL CIVIL COUR JUNIOR


DIVISON AND

ADDITIONAL CIVIL COURT JUNIOR DIVISON MUDHOL DIS BAGALKOT PIN CODE: 587313, STD
CODE: 08350, TEL NO: 280174, FAX NO: NA, E-MAIL : N.A.

1960

10 - 50

214

SHRI S L CHINCHALI HASILDAR


MUDHOL

POST MUDHOL Q MUDHOL DIST BAGALKO KARNATAKA STATE PIN CODE: 587313, STD
CODE: 08350, TEL NO: 280051, FAX NO: NA, E-MAIL : N.A.

1960

10 - 50

215

TALUKA PANCHAYAT MUDHOL WARD-1

TA:MUDHOL DI:BAGALAKOT ,
NO: 280116, E-MAIL : N.A.

1960

10 - 50

216

TALUK PANCHAYA OFFICE JAMAKHAND

DISTRICT BAGALKO ,
E-MAIL : N.A.

1962

10 - 50

217

ASSISTAN ENGINIAR

KARNATAKA POWER TRANCEPORT CORPORATION LMTD HUBLI DIVISION MAHALINGAPUR PIN


CODE: 587312, STD CODE: 08350, TEL NO: 00270161, FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

218

THE EXECUTIVE ENGINEER

OKM DIVISION HESCOM KALADG ROAD BAGALKOT PIN CODE: 587102, STD CODE: 08354, TEL
NO: 234545, FAX NO: 234545, E-MAIL : N.A.

1965

10 - 50

219

THE ASSISTAN EXECUTIVE ENGINEER

O KV SUB STATION K P C L KALADGI ROAD BAGALKOT PIN CODE: 587102, STD CODE: 08354,
TEL NO: 234557, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

220

ASSISTAN DIRECTOR OF AGRICULTURE


OFFICE

JAMKHAND DISTRICT BAGALKO ,


FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

PIN CODE: NA , STD CODE: 08353, TEL NO:

PIN CODE: 576119, STD CODE: NA , TEL NO: 220028, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587313, STD CODE: 08350, TEL NO: 280116, FAX

PIN CODE: NA , STD CODE: 08353, TEL NO: 220009, FAX NO: 222753,

PIN CODE: 587302, STD CODE: NA , TEL NO: 220054,

18

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

221

TAHSILDAR OFFICE

BELGAUM ROAD BAGALKOT PIN CODE: 587401, STD CODE: NA , TEL NO: 220374, FAX NO:
220374, E-MAIL : N.A.

1967

10 - 50

222

AGRICULTURE OFFICER SOIL ESTING


LABROTRY

JAMKHANDI ,

1967

10 - 50

223

WOMEN CHILD DEPARTMEN BAGALKOT

EXTENSION AREA BAGALKO ,


FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

224

BHOJNAY KA IMAN

WATER MANEGMEN G L B C KUDCHI ROAD JAMKH ANDI ALUK JAMAKHAND DISTRICT


BAGALKO PIN CODE: 587301, STD CODE: 08353, TEL NO: 220038, FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

225

***

BALAK EDUCATIONAL OFFICE BADAMI BAGALKO PIN CODE: 587201, STD CODE: 08357, TEL
NO: 00220161, FAX NO: 00220181, E-MAIL : N.A.

1970

10 - 50

226

HOBL ELECTRICITY SUPPLY COMPANY


LIMITED

O M SELEION BADAMT ,
E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: 220060, FAX NO: NA,

1970

10 - 50

227

BLOCK EDUCATION OFFICER

BLOCK EDUCATION OFFICE NEAR AHSILDAR OFFICE BAGALKOT PIN CODE: 587101, STD
CODE: NA , TEL NO: 220936, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

228

BHIMAPPA HANAMAPPA GONAL

BLOCK EDUCATIONAL OFFICE HUNGUND DI BAGALKO PIN CODE: 587118, STD CODE: 08351,
TEL NO: 260237, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

229

S M BEWOOR BEO JAMKHANDI

BLOCK EDUCATION OFFICE NEAR PAGA SCHOOL JAMKHAND TALUK TAMKHAND DISTRICT
BAGLKO PIN CODE: 587301, STD CODE: 08353, TEL NO: 220240, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

230

TECHANICAL ENGINEER K S R C
ECHANICAL

SECTION BAGALKOT ,
NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220480, FAX NO:

1971

10 - 50

231

VALAY ARANYA ADHIKAR BADAMI

MAINROAD BADAM ,
: N.A.

PIN CODE: 587201, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL

1972

10 - 50

232

ASSISTAN EXECUTIVE ENGENEER N H

SUB DIVISION HUNGUND TALUK HUNGUND DIST BAGALKO PIN CODE: 587118, STD CODE:
08351, TEL NO: 00260238, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

233

THE CHIEF OFFICER TOWN MUNCIPAL


COUNCIL

HUNGUND ATPOST HUNGUND DIST BAGALKO PIN CODE: 587118, STD CODE: 08351, TEL NO:
260307, FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

234

CIRCLE NSPECTOR OF POLICE


POLTCE STATION

BANHATTI Q JAMKHAND DIST BAGALKO ,


00230292, FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

PIN CODE: 587302, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00222560,

PIN CODE: 587314, STD CODE: 08353, TEL NO:

19

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1976

10 - 50

235

SECTION OEFLCER

KPTCL KERUR ,
: N.A.

236

EXECUTIVE ENGINEER KNNL MLBC


DIVISION

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08351, TEL NO: 220110, FAX NO: NA,
E-MAIL : N.A.

1978

10 - 50

237

CHILD DEVELOPMEN PROJEC OFFICE

JAMKHAND ,

1978

10 - 50

238

CHIEF SUPRIDENTENT DISTRIC


TELEPHONE

EXCHANGE BAGALKO ,
NA, E-MAIL : N.A.

1979

10 - 50

239

ISHWAR K BHUTE

PRIL CIVIL JUDGE S DN JAMKHANDI DIST BAGALKO PIN CODE: 587301, STD CODE: 08353, TEL
NO: 220271, FAX NO: NA, E-MAIL : N.A.

1979

10 - 50

240

***

OFFICE OF THE CHID DEVELOPMENT PROJECT OFFLCER BADAMI PIN CODE: 587201, STD CODE:
08357, TEL NO: 0220356, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

241

S R ANTIN HEAD MASTER

GOVT KANNADA SCHOOL JAMAKHANDI ,


, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

242

SAHAYAK KRUSHI NIRDESHAKARU

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 2203071, FAX NO: NA,
E-MAIL : N.A.

1982

10 - 50

243

M L A M P S NO1 BADAMI

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

1982

10 - 50

244

KARNATAKA LAND ARMY OFFICE


JAMKHANDI

KUSCHIROAD JAKHAND TALUK JAMKHAND DISTRICT BAGALKO PIN CODE: 587302, STD
CODE: NA , TEL NO: 220456, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

245

EXELUTIVE ENGNEAR

DIVISIONAL DATA PROCESSING OFFICE NEAR ENGNEARING LOLLEGE BAGALKOT PIN CODE:
587101, STD CODE: 08354, TEL NO: 00233679, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

246

ASSISTAN EXECUTIVE ENGINEER

JILLA PACHAYAT SUB DIVISION HUNGUND TALUK HUNGUND DIST BAGALKO PIN CODE:
587118, STD CODE: 08351, TEL NO: 260209, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

247

KRISHIUTPANN MARUKATTE RACHERZ

MAHALINGAPUR Q MUDHOL DTST BAGALKO PIN CODE: 587312, STD CODE: 08350, TEL NO:
270007, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

248

EXECUTIVE ENGINEER KNNL MLBC


DIVISION 3

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220057, FAX NO: NA,
E-MAIL : N.A.

1988

10 - 50

PIN CODE: 587206, STD CODE: 08357, TEL NO: 230236, FAX NO: NA, E-MAIL

PIN CODE: NA , STD CODE: NA , TEL NO: 220265, FAX NO: NA, E-MAIL : N.A.
PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220498, FAX NO:

PIN CODE: 587301, STD CODE: 08353, TEL NO: NA

20

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

249

ASSISTAN EXECUTIVE ENGINEER

HESCOM MAMALINGPUR TQ MUDHOL DIST BAGALKO PIN CODE: 587312, STD CODE: 08350,
TEL NO: 270166, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

250

OFFICE OF THE ASSISTAN EX


ENGINEER

KARNATAKA URBAN WATER SUPLY SUB DIVISION AUNGUND TALUK HUNGUN DIST BAGALKO
PIN CODE: 587118, STD CODE: 08351, TEL NO: 00260347, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

251

EXECUTIVE ENGINEER PUBLIC HEALTH


ENGEENER

DIVISION NO 1 BAGALKOT ALUK BAGALKO DISTRICT BAGALKO PIN CODE: NA , STD CODE:
08354, TEL NO: 221918, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

252

UJWALA CHAP H V A S SOCIETY

UJWALA RURAL DEYELOPMENT SERVECE SOCIETY HUNGUND TALUK HUNGUND DISTIC


BAGALKO PIN CODE: 587118, STD CODE: 08351, TEL NO: 00261620, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

253

EXICETIVE ENGEENER DIVISION

BAOAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220152, FAX NO: NA,
E-MAIL : N.A.

1994

10 - 50

254

CHILDREN AND WOMEN DEVELOPMENT


OFFICE

HUNGUND TALUK HUNGUND DISTRICT BAGLKOT PIN CODE: 587118, STD CODE: 08351, TEL NO:
00260116, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

255

PRASEDEN K M F MAHAMANDALA
VIDDYAMGRI

K M F VIDDYAGIRE BAGALKOT DI BAGALKO PIN CODE: 587101, STD CODE: 08354, TEL NO:
00234234, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

256

KARNATAKA ELECTRIC DISTIBUTOR


COMPANY

O 33 K V ELECTRIC DISTIBUTOR CENTER HUNGUND TALUK HUNGUND DIST BAGALKO PIN


CODE: 587118, STD CODE: 08351, TEL NO: 00280447, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

257

DISTRICT MALARIA OEFICER DISTRIC


MALARIA

OFFICE STATATON ROAD BAGALKO ,


220625, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

258

DISTRICT HEALTH AND FAMILY


WELFARE OFFICE

R DISTRICT HEALTH OFFICE STATIDN ROAD BAGALKOT PIN CODE: 587101, STD CODE: 08354,
TEL NO: 223225, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

259

DISTRICT STATISTICAL OFFICE

EXTENSION AREA BAGALKO DSOBGT 01 @ SANCHARNET_IN PIN CODE: 587101, STD CODE:
08354, TEL NO: 00223670, FAX NO: 00223670, E-MAIL : N.A.

1997

10 - 50

260

ZILLAPANCHAYAT BAGALKO

BELGAUM ROAD BAGALK0T PIN CODE: 587101, STD CODE: NA , TEL NO: 02223906, FAX NO:
223906, E-MAIL : N.A.

1998

10 - 50

261

D.S.P.BAGALKOT VIDDYAGIRT

, BAGALKOT PIN CODE: 587101, STD CODE: 08354, TEL NO: 233868, FAX NO: NA, E-MAIL :
N.A.

1998

10 - 50

262

PRINCIPAL

GOVT
COLLECE NEAR K P C L GULEDGUDDA PIN CODE: NA , STD CODE: NA , TEL NO:
250149, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO:

21

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

(1)

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)
,

PIN CODE: 587001, STD CODE: 08354, TEL NO: 00228001, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1999

10 - 50

1999

10 - 50

263

AGRICULTRAL RESEARCH STATION


BAGALKOT

264

M B C DIVISAN NO GADDAHAKERI CAMP

BAGALKOT NEAR SAKR BUILDING ,


FAX NO: NA, E-MAIL : N.A.

265

EXECUTIVE ENGINEER K P C L

MAJOR WORKS DIVISION ROOPLAND BAGALKOT PIN CODE: 587102, STD CODE: 08354, TEL
NO: 233622, FAX NO: 233622, E-MAIL : N.A.

2000

10 - 50

266

REGIONAL RANSPORT OFFICER AND


SECRATARY

REGIONAL RANSPORT OFFICE SECTOR NO 33 NAVANAUAR BAGALKO PIN CODE: NA , STD


CODE: 08354, TEL NO: 235912, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

267

HUBL ELECTRIC DISTARBUTOR


COMPANY

HUNGUND TALUK HUNGUND DISTICTBAGALKO PIN CODE: 587118, STD CODE: 08351, TEL NO:
00260247, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

268

THE HEAD MASTER V M MODEL HIGH


SCHOOL AND

ENGLISH MEDIUM HIGH SCHOOL HUNGUND ATPOST HONGUND DIS BAGALGOT PIN CODE:
587118, STD CODE: 08351, TEL NO: 261377, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

269

DISTRICT AND SESI0NS JUDGE

DISTRICT AND SESIONS COURT BELGAUM ROAD BAGALKO PIN CODE: 587101, STD CODE: NA
, TEL NO: 224227, FAX NO: 224227, E-MAIL : N.A.

2001

10 - 50

270

DEPUTY DAIRECTOR OF SERICULTURE

GOVE BULLDING STATION ROAD BAGALKO DISTRICT BAGALKO PIN CODE: NA , STD CODE:
08354, TEL NO: 226346, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

271

ASSISTAN EXECUTIVE ENGINEER

ZILLA PANCHAYA ENGINEERING SHB DIVISION SECTOR NO 32 NAVANAGAR BAGALKO PIN


CODE: NA , STD CODE: 08354, TEL NO: 235768, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

272

EXECUTIVE ENGEENER B D A SUB DN


4

NAVNASAR SECTOR NO 48 DISTRICT BAGALKO ,


NO: 00235088, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587102, STD CODE: 08354, TEL

2001

10 - 50

273

EXECUTIVE ENGEENER B D A SUB


DIVISION 7

NAVNASAR DISTRIC BASALKOT ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587102, STD CODE: 08354, TEL NO: 00235088,

2001

10 - 50

274

DEPUTY DIRECTOR ZILLA PANCHAYA


PUBLIC ED

UCATION DEPARTMENT NAVNAGAR SECTOR NO 4T DISTRICT BAGALKO PIN CODE: 587102,


STD CODE: 08354, TEL NO: 00235112, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

275

EXCUTIVE ENGEENER ZLLLA PANCHAYA


ENGNEER

ING DIVISION OFFICE NAVNAGAR SECTOR NO 49 DISTRICT BAGALKO PIN CODE: 587102, STD
CODE: 08354, TEL NO: 00235042, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

276

EXECHTIVE ENGINEER

UPPER KRISKNA PROJEC NO4 BILAGI REHABLI ION CENTER NAVANAGAR BAGALKO PIN CODE:
NA , STD CODE: 08354, TEL NO: 236015, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO: 224334,

22

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(1)

(2)

(3)

277

DEPUTY PROJECT MANAGER Z P D S U

278

Year of start of
Operation

Employment
Class

(4)

(5)

JALA NIRMALA YOJANE HAVARG BILDING NEAR RURAL POLICE STATION EXTENTION AREA
BGK PIN CODE: 587101, STD CODE: 08354, TEL NO: 220446, FAX NO: 226335, E-MAIL : N.A.

2002

10 - 50

SUB DIVISIONAL ENGINEFR

B S N L TELEPHONE EXCHANGE HUNGUND TALUK HUNGUND DISTRICT BAGLKOT PIN CODE:


587118, STD CODE: 08351, TEL NO: 00260444, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

279

ASSISTAN COMMERCIAL FOR


COMMERCIAL TAX

SECTOT NO 32 NAVANAUAR BAGALKOT PIN CODE: NA , STD CODE: 08354, TEL NO: 235717,
FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

280

CHAIRAMAN

BAGALKOT DISTRIC CONSHMER FORHM SECTOR NO 33 NAUANAGAR BAGALKO PIN CODE: NA


, STD CODE: 08354, TEL NO: 235778, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

281

CONTRACTOR

HEAT FOOD PRODUC CAMP BOMBAY CHAL LAMANI GALLI BAGALKO PIN CODE: 587101, STD
CODE: 98800, TEL NO: 9891, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

282

R O OFFICE JAMKHANDI

GIRISHNAGAR JAMKHAND TALUK JAMKHAND DISTRICT BAGALKO PIN CODE: 587302, STD
CODE: NA , TEL NO: 221094, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

283

SHREEMOLEHUCMHESHWARSHIKSHAN
AANDGRAMEEN

BHIVRUDH SAMSTHE R GULEDGUDD ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587203, STD CODE: NA , TEL NO: NA ,

2005

10 - 50

284

***

DEPO MANGER NORTH WEST KARNATAK STATE ROA D TRANBPOR CORPORATAION BADAM
PIN CODE: 587201, STD CODE: 08357, TEL NO: 00220076, FAX NO: 0220076, E-MAIL : N.A.

NA

10 - 50

285

GOVT OF KARANATAK ASSISTAN


DIRECTOR LAND

REVENUE DEPARTMENT BADAM DIST BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

286

***

PIN CODE: NA , STD CODE: NA , TEL NO: 222746, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

287

ASSISTAN DIRECTOR OF
ACRICULTURAL

ROOPLAND ARIA BAGALKOT PIN CODE: NA , STD CODE: 08354, TEL NO: 234624, FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

288

THE ASSISTAN EXECUTIVE ENGINEER

L M SUB DIVISION K P C L KALADGI ROAD BACALKOT PIN CODE: 587102, STD CODE: 08354,
TEL NO: 234557, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

289

ASSISTAN EXECUTIVE ENGINEER

M SUB DN ROOPLAND BAGALKOT PIN CODE: 587102, STD CODE: 08354, TEL NO: 223645,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

290

CHIFE HEALTH OFFECER SAMUDAY


AROGYA KENDR

A GULEDAGUDD ATPOS GULEDAGUDD A BADAMI DIST BAGALAKOT PIN CODE: 587203, STD
CODE: 08357, TEL NO: 250222, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 587201, STD CODE: 08357, TEL

23

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

Address / Telephone / Fax / E-mail

(1)

(2)

(3)

291

SUB POST OFFICEA POST GULEDACUD


A BADAM

DIST BAGALAKOT ,
E-MAIL : N.A.

292

TASILDAR OFFICE HUNGUND

TALUK HUNGUND OFFICE BAGALKO ,


260234, FAX NO: NA, E-MAIL : N.A.

293

POLECEISUB NSPECTOR

294

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

NA

10 - 50

POLICE STATION HUNGUND TALUK HUNGUND DISTICTBAGALKO PIN CODE: 587118, STD CODE:
08351, TEL NO: 00260333, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

ASSISTAN EXECUTIVE ENGINERR

PUBLIC WDRK DEPARTMENT SUB DIVISION HUNGUND TALUK HUNGUND DISTRICT BAGALKO PIN
CODE: 587118, STD CODE: 08351, TEL NO: 260301, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

295

PRINCIPAL

GOVERNMENTTEACHER TRANING CENTERE HUNGUND TALUK HUNGUND DISTRICT BAGALKO


PIN CODE: 587118, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

296

S Y GANGER EXCEUTIVE ENGIENER

ZILLA PANCHAYA OFFICE KUDCH ROAD JAMKHA NDI TALUK JAMAKHANDI DISTRIC
BAGALKOT PIN CODE: 587301, STD CODE: 08353, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

297

M G HEGADE

WATER MANEGMEN G L B C KUDCHI ROAD JAMKH ANDL ALUKA JAMAKHANDI DISTRIC


BAGALKOT PIN CODE: 587301, STD CODE: 08353, TEL NO: 220473, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

298

CHIEF OFFICER NAGAR SABHA

MAIN MARKE BAGALKOT ,


NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220555, FAX

1864

51 - 100

299

CHIEF OFFICER

PATTAN PANCHAYAT LKAL DIST HUNUGUND PIN CODE: 587125, STD CODE: 08351, TEL NO:
270416, FAX NO: NA, E-MAIL : N.A.

1864

51 - 100

300

M K HI INAMATHA CHIEF OFFICER

TOWN MUNCIPAL COUNCIL JAMKHAND DISTRICT BAGALKOTE PIN CODE: 587301, STD CODE:
08353, TEL NO: 2201013, FAX NO: NA, E-MAIL : N.A.

1872

51 - 100

301

CHIFE OFFECER TOWN MUNICEPAL


CONSILAR

AT POS GULEDAGUDD A BADAMI DIST BAGALAKOT PIN CODE: 587203, STD CODE: 08357,
TEL NO: 2502130, FAX NO: NA, E-MAIL : N.A.

1888

51 - 100

302

ADMINISTRATIVEOFFICER
BASAVESHWAR SANG

BAGALKOT ,
: N.A.

1948

51 - 100

303

C G PATIL TAHASILDAR

TAHASILDAR OFFICE JAMKHAND DIST BAGALKO PIN CODE: 587301, STD CODE: 08353, TEL
NO: 220023, FAX NO: 222678, E-MAIL : N.A.

1948

51 - 100

304

HUBBALLI VIDYU SARABARAJU

KACHER MUDHOL Q MUDHOL DIS BAGALKOT ,


NO: 280054, FAX NO: NA, E-MAIL : N.A.

1963

51 - 100

PIN CODE: 587203, STD CODE: 08357, TEL NO: 250213, FAX NO: NA,

PIN CODE: 587118, STD CODE: 08351, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00022068, FAX NO: NA, E-MAIL

PIN CODE: 587313, STD CODE: 08350, TEL

24

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1965

51 - 100

1965

51 - 100

305

MANAGER KARNATAKA STATE ROAD


CORPORATION

BAGALKOT ,
: N.A.

306

SHRI B N HAKIM KSHETRA


SHIKSANADHIKARIGAL

KARYALAY MUDHOL TQ MUDHOL DIST BAGALKO ,


TEL NO: 280061, FAX NO: NA, E-MAIL : N.A.

307

DIVISION FORES OFFICE

BEHIND AC OFFICE BELGAUM ROAD BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO:
220269, FAX NO: 22026900, E-MAIL : N.A.

1966

51 - 100

308

S L VARANASI

G L B C OFFLCE KUDACHI ROAD JAMKHAND TALUK JAMAKMANDI DISTRIC BAGALKOT PIN


CODE: 587301, STD CODE: 08353, TEL NO: 223825, FAX NO: NA, E-MAIL : N.A.

1968

51 - 100

309

***

D C OFFICE NAVANAGAR A POST BAGALKO DIST BAGALKO PIN CODE: 587102, STD CODE:
08354, TEL NO: 00235091, FAX NO: 00235096, E-MAIL : N.A.

2001

51 - 100

310

EXECUTIVE ENGINEER

TALUK PANCHAYA OFFICE HUNGUND TALUK HUNGUND DISTIC BAGALKO PIN CODE: 587118,
STD CODE: 08351, TEL NO: 00260227, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

311

COMMISSINOR REHABILITATION AND


RECONSTRAC

TION OFFICE SECTOR NO 9 NAVANAGAR BAGALKO DISTRICT BAGALKO STATE KARNATAKA


PIN CODE: NA , STD CODE: 08354, TEL NO: 235462, FAX NO: 235459, E-MAIL : N.A.

1980

101 - 500

312

DEPO MANAGER NORTH WEST


KARNATAKA STATE

ROAD RANSPORT CORPORATION ILKAL TALUK HUNGUND DISTRICT BAGALKO PIN CODE:
587125, STD CODE: 08351, TEL NO: 270461, FAX NO: NA, E-MAIL : N.A.

1989

101 - 500

313

CHIEF ENGINEER

BAGALKOT OWN DEVELOPMEN AU ,


FAX NO: 233314, E-MAIL : N.A.

1995

101 - 500

314

***

NA

101 - 500

315

SAGADEESHAKUMAR DEPN MANRGER

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220430, FAX NO: NA, E-MAIL

PIN CODE: 587313, STD CODE: 08350,

PIN CODE: 587101, STD CODE: NA , TEL NO: 233353,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

BUS STAND JAMAKHANDE ALUKA JAMAKHANDI DISTRTCT BAGALKO PIN CODE: 587301, STD
CODE: 08353, TEL NO: 220430, FAX NO: NA, E-MAIL : N.A.

1962

> 500

NIC 2004 : 7512-Regulation of the activities of agencies that provide healthcare, education, cultural services and other social services, excluding
social security.
316

OFFICF OF THE DEPUTY DIRECTOR

DEPARTMENT OF MINES AND GEOLOGY NH I3 BYEPASS ILKAL PIN CODE: 587125, STD CODE:
08351, TEL NO: 00271070, FAX NO: NA, E-MAIL : N.A.

317

SHANTI NURSING HOME

PO BANAHATTI Q JAMKHAND DIST BAGALKO PIN CODE: 587311, STD CODE: 08353, TEL NO:
230095, FAX NO: NA, E-MAIL : N.A.

25

1998

10 - 50

NA

10 - 50

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 7514-Ancillary service activities for the Government as a whole

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

318

G R DESHPANDE

BUILDING CONTRACTOR VIDYAGIR KALADG ROA D BAGALKOT PIN CODE: 587102, STD
CODE: 08354, TEL NO: 235535, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

319

R P RATHOD CLASSIC CONTRACTOR


NAVANAGAR

AT POS BAGALKOT DIS BAGALKOT ,


00235058, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1968

10 - 50

PIN CODE: 587102, STD CODE: 08354, TEL NO:

NIC 2004 : 7522-Defence activities


320

SUB JAIL JAMAKANDI ALUK

DISTRICT BAGALKO ,
N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

NIC 2004 : 7523-Public order and safety activities


321

POLICE NSPECTOR POLICE STATION

RABAKAVI ROAD MAHALINGAPUR TQ MUDHOL DIST BAGALKO PIN CODE: 587312, STD CODE:
08350, TEL NO: 2700313, FAX NO: NA, E-MAIL : N.A.

1946

10 - 50

322

POLICE SUB FNSPECTOR ERDAL

TERDAL ,

1949

10 - 50

323

POLICE STASTION MUDHOL WARD 17

TQ MUDHOL DT BAGALKO ,
NA, E-MAIL : N.A.

1960

10 - 50

324

POLICE OF SUBINSPECTOR

TOWNPOLICE STATION BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO: 220333, FAX
NO: NA, E-MAIL : N.A.

1968

10 - 50

325

POLICE SUB NSPECTOR

RURAL POLICE STATION LAXMI NAGAR EXTENTION AREA BAGALKOT PIN CODE: 587101, STD
CODE: 08354, TEL NO: 220460, FAX NO: 220460, E-MAIL : N.A.

1985

10 - 50

326

RURAL POLICE STATION JAMKHANDI

KUDCHIROAD JAMKMANDI ALUK JAMKHANDI DISTRICT BAGALKO PIN CODE: 587302, STD
CODE: NA , TEL NO: 220623, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

327

URBAN POLICE STATION JAMKHANDI

KUDACH ROAD JAMAKHANDI PIN CODE: NA , STD CODE: NA , TEL NO: 220033, FAX NO: NA,
E-MAIL : N.A.

1958

51 - 100

328

SUPERINTENDENT OF POLICE

SECTOR NO 23 NAVANAGAR BAGALKOT PIN CODE: NA , STD CODE: 08354, TEL NO: 235077,
FAX NO: 235079, E-MAIL : N.A.

2003

51 - 100

329

RESERVE POLICE NSPECTPR

DISTRICT RESERVE POLICE SECTOR NO 25 NAVANAGAR BAGALKO PIN CODE: NA , STD CODE:
08354, TEL NO: 235083, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

PIN CODE: 587315, STD CODE: NA , TEL NO: 00255133, FAX NO: NA, E-MAIL : N.A.
PIN CODE: 887313, STD CODE: 08350, TEL NO: 280133, FAX NO:

26

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1818

10 - 50

NIC 2004 : 8010-Primary education


330

HEAD MASTER GOVERNMENT MODEL


PRIMARY SCHO

OL NO 1 BEHIND GAJANANA TEMPLE BAGALKO ,


NA , FAX NO: NA, E-MAIL : N.A.

331

HEAD MASTER

GOVT KANNAD BOYS SCHOOL NO 1 NEAR CHOBAZA R ROAD A POST GULEDAGUDD TA


BADAM PIN CODE: 587203, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1857

10 - 50

332

HEAD MASTER

GOVERNMENT GIRLS HLGHER PRIMARY SCHOOL NO 1 BAGAKOT PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1867

10 - 50

333

H H KOUJUGANOOR

K G S NO HUNGUND DIST BAGALKO PIN CODE: 587118, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1868

10 - 50

334

HEAD MASTER

MODEL KANNADA BOYS SCHOOL MUDHOL Q MUDHO L BAGALKOT PIN CODE: 587313, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1875

10 - 50

335

THE HEADMASTER GOV MODEL


KANNADA BOYS SC

HOOL MAHALINGAPUR DOUBLE ROAD POST MAHAL NGAPUR ALUK MUDHOL DIST
BAGALAKOT PIN CODE: 587312, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1876

10 - 50

336

GOVERNMENT KANNADA BOYS MODEL


SCHOOL

POST BANAHATTI Q JAMAKHANDI DIS BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587311, STD CODE: NA , TEL

1877

10 - 50

337

HEAD MASTER URDU HIGHER PRIMARY


SCHOOL

NO 1 OPPOSIT PANXAH MASJID BAGALKO DISTRICT BASALKO PIN CODE: 587101, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1883

10 - 50

338

GOVERNMENT GIRLS HIGHER PRIMARY


SCHOOL

ATPOST BANAHAT Q JAMAKHANDI DIS BAGAL KOT PIN CODE: 587311, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1887

10 - 50

339

HEAD MASTER GOVERNMENT KANNADA


BOYS PRIME

RY SCHOOL NO 2 BAGALKO ,
NA, E-MAIL : N.A.

1915

10 - 50

340

PRINCIPAL

GOVT P U COLLEGE NEAR BUS STAND GULEDGUDOA PIN CODE: NA , STD CODE: 25056, TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1921

10 - 50

341

GOVERNMENT KANNADA HIGHER


PRIMARY SCHOOL

HOSUR TALUK JAMAKHANDI DIS BAGALKOT PIN CODE: 587314, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1928

10 - 50

342

HEAD MASTER

SHASAKARA GOVT MODEL PRIMARY SCHOOL NO.4 NEAR KASTURIMATH HOUSING COLONY
BAGALKOT PIN CODE: 587101, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1944

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO:

PIN CODE: 587101, STD CODE: NA , TEL NO: NA , FAX NO:

27

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1945

10 - 50

1956

10 - 50

1956

10 - 50

343

HEADMASTER BASAJESHWAR BOYS


HIGHSCHOOL

BAGALKOT ,
N.A.

344

HEADMASTER GOVERNMEN MODEL


PRIMARY SCHOO

L LKAL ALUK UNNGUND DISTRIC BAGALKOT ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

345

GOVT U H P S NO J HEAD MASTER

PENDAR GALL PO BANAHATTI ,


NA, E-MAIL : N.A.

346

GOVT KANNADA GIRLS PRIMARY


SCHOOL BADAMI

KILLA ON BADAMI Q BADAMI DIS BAGALKOTE STATE KARNATAKA PIN CODE: 587201, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1960

10 - 50

347

GOVT KANNAD BOYS HIGHER PRIMARY


SCHOOL 9

ILKAL TALUK HUNGUND DISTIC BAGALKOT ,


NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: NA , TEL NO:

1962

10 - 50

348

GOVT KANNADA GIRLS SCHOOL


MAHALINGAPUR

TQ MUDHOL DI BAGALKO ,
E-MAIL : N.A.

PIN CODE: 587312, STD CODE: NA , TEL NO: NA , FAX NO: NA,

1962

10 - 50

349

SANT ANNIES LIONS SCHOOL BAGALKO

EXTENSION AREA BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

350

HEAD MASTAR GOVERNMENT KANNADA


BOYS MODEL

PRIMARY SCHOOL KERUR TQ BADAM DIST BAGALKO PIN CODE: 587206, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

351

SHRICHANNAGIRESHWAR HAIGHER
PRIMARY SCHOO

L MAHALINGPUR TQ MUPHOL DT BAGALKOAT PIN CODE: 587312, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

352

GOVERNMENT MODEL PRIMARV


SCHOOL BADAMI

DIST BAGALKO ,
N.A.

1970

10 - 50

353

HEAD MASTER

GOVERNMENT KANNADA GIRLS PRIMARY SCHOOL NO 3 NEAR SHAKTI AKIES BAGALKOT PIN
CODE: 587101, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

354

***

1982

10 - 50

355

GOVERNMENT JUINOR COLLEGE

POST BANAHATTI Q JAMAKHANDI DIS BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

356

HEAD MASTER

BVVS PRIMARY SCHOOL VIDYAGIR BAGALKOT DISTRICT BAGALKO PIN CODE: 587102, STD
CODE: 08354, TEL NO: 233764, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO: 0020725, FAX NO: NA, E-MAIL :

PIN CODE: 587125, STD CODE: NA , TEL

PIN CODE: 587311, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00226050,

PIN CODE: 587201, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 587311, STD CODE: NA , TEL

28

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

357

HEAD MASTER

GOVERNMENT HIGHER PRIMARY K BSCHOOL B D A BAGALKOT PIN CODE: NA , STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

358

HEAD MMSTER

MALLIKARJUN PRIMARY SCHOOL KERUR ,


FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

359

HEAD MASTER

JAI HIND PRIMERY SCHOOL MUDHOL Q DTST BAGALKO PIN CODE: 587313, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

360

THE HEAD MASTER LIONS PRIMARY


SCHOOL BAGA

LKOT ROAD HUNGUND ATPOST HUNGUND DIST BAGALKO PIN CODE: 587118, STD CODE:
08351, TEL NO: 260142, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

361

ENGLISH MEDIUM PRIVATE SCHOO


ILKAL

1989

10 - 50

362

HEAD MASTER

BASWESHWERIHIGHSCHOOL KERUR ,
FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

363

HEAD MASTAR SHREE CHARANTIMATH


KANNDA

ENGLISH MEDIUM HIGHER PRIMARY SCHOOL KERU R TQ BADAM DIST BAGALKO PIN CODE:
587206, STD CODE: NA , TEL NO: 230088, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

364

SHREE VEERAPULIKESHI PRIMARY


SCHOOL

BADAMI BAGALKOT PIN CODE: 587203, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

1992

10 - 50

365

THE HEAD MASTER V M LPS AND HPS


CONVEN

BAGALKOT ROAD HUNGUND ATPOST HUNGUND DIST BAGALKD PIN CODE: 587118, STD CODE:
08351, TEL NO: 261377, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

366

KANNAD PRIMARY PRIVATESCHOOL


LKAL

1992

10 - 50

367

MADARASA E FAIJUL ULUM R MUDHOL

SAI NAGAR KATARAKI ROAD MUDHOL Q MUDHOL DI BAGALKO PIN CODE: 587313, STD CODE:
08350, TEL NO: 280475, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

368

HEAD MASTER

SRI VINAYAK PRIMARY SCHOOL ERDAL TK JAMAKHAND DT BAGALKO PIN CODE: 587315,
STD CODE: 08353, TEL NO: 00255067, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

369

GURUMRUTYUNJAY COMPOSITE
JUNIOR COLLEGE

KUMBAR ONI MUDHOL TALVK MUDHOL DIS BAGALAKO PIN CODE: 587313, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

370

IHE HEADMASTER C K CHINCHALI


SCHOOL

BPSHVNAGAR MAHALINGPUR TZIMUDHOL DISI BAGALKO PIN CODE: 587312, STD CODE:
08350, TEL NO: 271162, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 587206, STD CODE: NA , TEL NO: NA ,

PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587206, STD CODE: NA , TEL NO: NA ,

PIN CODE: 587125, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

29

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

371

HEAD MASTER GOVERNMENT URDU


PRIMARY SCHO

OL NUMBER 1 SECTOR NO 13 NAVAMAYAR BAGALKOT PIN CODE: NA , STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

372

HEAD MASTER

GOVERNMENT KANNADA BOYS SCHOOL NO IO SECTOR NO 4I NAVAHAGAR BAGALKO PIN


CODE: 587103, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

373

HEAD MASTER HIGHER PRIMARY


SCHOOL

BAGALKOT ,

NA

10 - 50

374

SAIN XAVIERS SCHOOL GULEDGUDD

TQ BADAM DIS BAGALKOT ,


NO: NA, E-MAIL : N.A.

PIN CODE: 587203, STD CODE: 08357, TEL NO: 251084, FAX

NA

10 - 50

375

HEAD MASTERI

GOVERNMENT HIGHER PRIMARYSCHOOL VIDYANAGA R HUNGUND DISTRICT BAGLKOT PIN


CODE: 587118, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

376

HEAD MISTRESS

BHRIMATI LAXMIBA DESHPANDE PRIMARY SCHOOL BAGALKO PIN CODE: 587121, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

51 - 100

377

HEAD MASTER SHREE SATYA SA


EDUCATION SOC

ITY R SECTOR NUMBER 1 NAVANAGAR BAGALKOT PIN CODE: NA , STD CODE: 08354, TEL NO:
236157, FAX NO: NA, E-MAIL : N.A.

2002

51 - 100

1936

10 - 50

PIN CODE: 587101, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 8021-General Secondary/Senior Secondary education


378

GOVT RAMNA MODEL SCHOOL WARD 7

TA MUDHOL DI BAGALKO ,
E-MAIL : N.A.

379

PRINCIPAL

S C P HSGH SCHOOL MAHALINGPUR TZ MUDHOL DIST BAGALKO PIN CODE: 587312, STD
CODE: 08350, TEL NO: 270864, FAX NO: NA, E-MAIL : N.A.

1941

10 - 50

380

PRINCIPAL ANJUMANIJUNIOR COLLAGE

ANJUMAN JUNIOR COLLAGE BAGALKO KILLA BAGALKO PIN CODE: NA , STD CODE: 08354, TEL
NO: 00223519, FAX NO: NA, E-MAIL : N.A.

1950

10 - 50

381

HEAD MASTER

S M HIGH SCHOOL GURUKUL COMPUS TERDAL TK JAMKHANDI D BAGALKDT PIN CODE:


587315, STD CODE: 08353, TEL NO: 255881, FAX NO: NA, E-MAIL : N.A.

1953

10 - 50

382

SHREE VEERAPULIKESHI HIGHSCHOOL

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220955, FAX NO: NA,
E-MAIL : N.A.

1959

10 - 50

383

SHREE KALIDAS HIGHSCHOOL

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 221 039, FAX NO: NA,
E-MAIL : N.A.

1962

10 - 50

PIN CODE: 587313, STD CODE: NA , TEL NO: NA , FAX NO: NA,

30

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

384

BHIMAPAA LAMAN HM

CENTRAL SCHOOL HUNGUND BAGALKOT DISTRIC PIN CODE: 587118, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

385

NEW GIRLS HIGH SCHOOL MUDHOL

AT MUDHOL TALUKA MUDHOL DIST BAGALKO PIN CODE: 587313, STD CODE: 08350, TEL NO:
280328, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

386

R M G HIGH SCHOOL MUDHOL

TQMUDHOL D BAGALKOT ,
NA, E-MAIL : N.A.

PIN CODE: 567313, STD CODE: NA , TEL NO: 280106, FAX NO:

1966

10 - 50

387

HEAD MASTER

S J PRIMARY AND HIGH SGHOOL TERDAL TK SAMKHAND DT BAGALKO PIN CODE: 587315,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1966

10 - 50

388

B M DUGGAN PRTNCIPAL

BASAVESHWAR HIGHSCHOOL JAMAKHAND TALUK JAMAKHANDI DISTRIC BAGALKOT PIN


CODE: 587301, STD CODE: 08353, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1969

10 - 50

389

BILL ENGLISH PRIMARY AND HIGH


SCHOOL SCHO

OL MUDHOL WARD 7 TA MUDHOL DI BAGALKO PIN CODE: 587313, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1978

10 - 50

390

PRINCIPAL

KALIPAS HIGHER AND PRE UNIVERSITY EDUCAT ON SOCIETY NAVANAGA BAGALKOT PIN
CODE: 587101, STD CODE: 08354, TEL NO: 00234221, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

391

HEADMASTER MOUNESHWAR
HIGHSCHOOL BAGALKO

STATION ROAD BAGALKO ,


NA, E-MAIL : N.A.

1984

10 - 50

392

GOVERNMRNT HIGH SCHOOL

POST BANAHATTI Q IAMAKHANDI DIS BAGALKO ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

393

SHREE CHANNAPPAGOUDAR GIRLS


HIGH SCHOOL

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220210, FAX NO: NA,
E-MAIL : N.A.

1986

10 - 50

394

BASAVANAND HIGH SCHOOL


MAHALINGPUR

TQ MUDHOL DI BAGALKOAT ,
NA, E-MAIL : N.A.

PIN CODE: 587312, STD CODE: NA , TEL NO: NA , FAX NO:

1987

10 - 50

395

SHREE KALIDAS ENGLISH MEDIUM


PRIMERI SCHO

OL BADAM BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 221039, FAX NO: NA,
E-MAIL : N.A.

1992

10 - 50

396

K R LAKKAM VIDYALAY MUDHOL

LOKAPUR ROAD MUDHOL TQ MUDHOL DIST BAGALK OT PIN CODE: 587313, STD CODE: 08350,
TEL NO: 280248, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

397

J R HOSAMANI HEADMASTER

GOVT URDU SCHOOL JAMKAHANDT TALUK JAMAKHANDI DISTRIC BAGALKDT PIN CODE:
587301, STD CODE: 08353, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO: NA , FAX NO:

PIN CODE: 587311, STD CODE: NA , TEL

31

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

398

HEAD MASTER

RADHAKESARZ EDUCATION SOIETY CIMEN FACTORY ARIYA BAGALKOT PIN CODE: 587101,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

399

VIJAYALAXM DIDDIMAN HM

MODEL PRIMARY SCHOOL HUNGUND TA HUNGUND DIST BAGALKO BAGALKOTROAD PIN


CODE: 587118, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

400

HEAD MASTER JAYCEE ENGLISH


MEDIUM HIGH SC

HOOL MAHALINGAPUR TQ MUDHOL DI BAGALKO STATE KARNATAK PIN CODE: 587312, STD
CODE: 08350, TEL NO: 271012, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

401

GOVT MARATIHIGH SCHOOL MUDHOL


WARD:17

NA

10 - 50

402

VICE PRINCIPAL

SHANKRAPPA SAKRI HIGH SCHOOL BAGALKOT PIN CODE: 587121, STD CODE: NA , TEL NO:
220760, FAX NO: NA, E-MAIL : N.A.

1948

51 - 100

403

S S KABBINIPR1NCIPAL

GOVT GIRLS P U COLLEGE JAMAKHAND TALUK JAMAKHANDI DLSTRIC BAGALKOT. PIN CODE:
587301, STD CODE: 08353, TEL NO: 220562, FAX NO: NA, E-MAIL : N.A.

1959

51 - 100

404

HEADMASTER BASAVESHWAR GIRLS


HIGHSCHOOL

BAGALKOT ,
: N.A.

1985

51 - 100

405

HEAD MASTER

GOVERMEN HIGH URDU PRIMARY SCHOOL HUNGUND TALUK HUNGUND DISTRCTBAGALKO PIN
CODE: 587118, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

406

HEAD MASTER

BASAVESHAVER RNTERNATIONAL PUBLIC SCHOOL VIDYAGIR BAGALKOT PIN CODE: 587102,


STD CODE: 08354, TEL NO: 233940, FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

PIN CODE: 587313, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00222736, FAX NO: NA, E-MAIL

NIC 2004 : 8022-Technical and vocational Secondary/Senior Secondary education[


407

PRINCIPAL

SRI VINAYAK KIGARIKA RANING CENTER TERDAL Q JAMAKHANDI DISTRIC BAGALKO PIN
CODE: 587315, STD CODE: 08353, TEL NO: 00255067, FAX NO: NA, E-MAIL : N.A.

1978

10 - 50

408

PRINCIPAL S R KANT GIRLS HIGH


SCHOLL

ILKAL DISTRICT BAGALKOTL PIN CODE: 587125, STD CODE: 08351, TEL NO: 270820, FAX NO:
NA, E-MAIL : N.A.

1989

10 - 50

409

SHRI BHAVURAO APTE D ED COLLEGE


JAMKHAND

MARKET GALLI MUDHOL ROAD JAMKHANDI DIST BAGALKO STATE KARNATAK Q JAMAKHAD
PIN CODE: 587301, STD CODE: 08353, TEL NO: 00221073, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

NIC 2004 : 8030-Higher education

32

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1858

10 - 50

1929

10 - 50

PIN CODE: 587101, STD CODE: 08352, TEL NO: 00220485, FAX NO: NA,

1948

10 - 50

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220549, FAX NO: NA, E-MAIL

1950

10 - 50

1962

10 - 50

410

PRINCIPALIBASAVESHWAR ARTS
COLLEGE

BAGALKOT ,
: N.A.

411

S R A COMPOSITE JUNIOR COLLEGE


BANAHATTI

TQ JAMKHANDI DIS BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

412

PRINCIPAL BASAVESHWAR TEACHERS


RAINING

CENTER BAQALKO ,
E-MAIL : N.A.

413

PRINCIPAL BASAVESHWAR SCIENCE


COLLEGE

BAGALKOT ,
: N.A.

414

PRINCIPAL BASAVESHWAR
POLYTECHANIC COLLEG

E BAGALKOT ,
E-MAIL : N.A.

415

PRINCIPAL

BASAVESHVAR ENGINEERING COLLEG S NIJALING APPA ROAD BAGALKOT PIN CODE: 587102,
STD CODE: 95835, TEL NO: 234060, FAX NO: 234204, E-MAIL : N.A.

1963

10 - 50

416

HEAD MASTER VIJAYA MAHANTESH


ARTS

SCIENCE COLLEGE ILKAL TALUK HUNGUND DISTIC BAGALKOT PIN CODE: 587125, STD CODE:
08351, TEL NO: 270260, FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

417

R NARENDRA PRINCIPAL

GOVI EACHER RENING CENTER JAMARHANDI TALUK JAMAKHANDI DISTRIC BAGALKOT PIN
CODE: 587301, STD CODE: 08353, TEL NO: 220070, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

418

R M G P U COLLEGE MUDHOL

TQ MUDHOL D-BAGALKOT ,
NA, E-MAIL : N.A.

1966

10 - 50

419

PRINCIPALSMBHANDARKARTSRRBHAN
DARICOMMERCE

SKRATHISCIENCECOLLEGE GULEDGUDD ,
00250284, FAX NO: NA, E-MAIL : N.A.

1969

10 - 50

420

HEADMASTERMLAMPSGULEDGUDD

1969

10 - 50

421

PRINCIPAL

SRI PRABHULING PRE UNIVERSITY COLLEGE TERDAL TK JAMKHANDI DT BAGALKO PIN CODE:
537315, STD CODE: 08353, TEL NO: 255067, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

422

PRINCIPAL

SHANKARAPPA SAKR PRE-UNIVERSITY COLLFGE BAGALKOT PIN CODE: 587101, STD CODE:
NA , TEL NO: 220760, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

423

SHREE KALIDAS

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 221264, FAX NO: NA,
E-MAIL : N.A.

1978

10 - 50

COLLEGE

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220440, FAX NO: NA, E-MAIL

PIN CODE: 587314, STD CODE: 08353, TEL NO: 231559,

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220879, FAX NO: NA,

PIN CODE: 587313, STD CODE: 28010, TEL NO: NA , FAX NO:

PIN CODE: 587203, STD CODE: 08357, TEL NO:

PIN CODE: 587203, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

33

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1979

10 - 50

1980

10 - 50

424

PRINCIPAL

425

HEAD MASTER GOVT JUNIOR COLLEGE


GOLEDGUDD

426

PRINCIPAL

BVVS PHYSICAL EDUCATION COLLEGE VIDYAGIR BAGALKOT PIN CODE: 587102, STD CODE:
08354, TEL NO: 233303, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

427

SHREE VEERAPULIKESHI DEGREE


COLLEGE

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220116, FAX NO: NA,
E-MAIL : N.A.

1982

10 - 50

428

HEAD MASTER GOVERNMENT JUNIOR


COLLEGE

NEAR K E B OFFICE ILKAL DIST BAGALKO ,


270397, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

429

PRINCIPAL

SRNARSAPUR ARTS AND MBSHIRUR COMMERCE COLLEGE BAGALKOT PIN CODE: 587101, STD
CODE: NA , TEL NO: 220931, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

430

S R K ARTS COMMERCE AND SCIENCE


COLLEGE

MUDHOL T-MUDHOL D-BAGALKOT ,


NO: NA, E-MAIL : N.A.

1984

10 - 50

431

PRINCIPAL BASAVESHWAR SECONDARY


SCHOOL

TEACHERS RAINING CENTER BATALKO ,


00220485, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

432

PRINCIPAL

S C P ARTS AND D D S COMMERCE COLLEGE MAHALINGPUR TZ MUDHOL DIST BAGALKO PIN


CODE: 587312, STD CODE: 08350, TEL NO: 270235, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

433

PRINCIPAL S R KANT ARTS AND


COMMERCE

LADIES COLLEGE ILKAL DISTRICT BAGALKO PIN CODE: 587125, STD CODE: 08351, TEL NO:
270075, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

434

SHREE KALIDAS B A M S COLEEGE

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220874, FAX NO: NA,
E-MAIL : N.A.

1990

10 - 50

435

PRINCIPAL NANDIMATH LAW COLLEGE


BAGALKOT

COLLEGE CAMPUS ,
E-MAIL : N.A.

1991

10 - 50

436

SHREE KALIDAS J O D C COLLEGE

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 221264, FAX NO: NA,
E-MAIL : N.A.

1992

10 - 50

437

PRINCIPAL VIJAYMAHANTESH
AYURVEDA

MEDICAL COLLEGE ILKAL DISTRICT BAGALKO PIN CODE: 587125, STD CODE: 08351, TEL NO:
270518, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

S C P P U COLLEGE MAHALINGPUR TQ MUDHOL DIST BAGALKO PIN CODE: 87312, STD CODE:
08350, TEL NO: 270235, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: 08351, TEL NO:

PIN CODE: NA , STD CODE: 28002, TEL NO: NA , FAX

PIN CODE: 587501, STD CODE: 08354, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 0020664, FAX NO: NA,

34

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1993

10 - 50

438

M D NAVANI PRINCIPAL

GOVT GIRLS COLLEGE JAMAKHAND ,


221310, FAX NO: NA, E-MAIL : N.A.

439

PRINCIPAL VIJAYMAHANTESH BUSINESS


RURAL

COLLECE ILKAL DISTRICT BAGALKO PIN CODE: 587125, STD CODE: 08351, TEL NO: 271157,
FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

440

PRINCIPAL BASAVESH AYURVEDIC


COLLEGE

BAGALKOT ,
: N.A.

1998

10 - 50

441

MANAGER

BVVS CPED BPED MPED STUDENTS HOSTEL VIDYAGIR BAGALKOT PIN CODE: 587102, STD
CODE: 08354, TEL NO: 233466, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

442

DIRECTOR BASAVESHWAR NSTITUTE


OF MANAGME

NT STUDIES NEAR ENGINEERING CO AGE CAMPU S VIDVAGIR BAGALKOT PIN CODE: NA , STD
CODE: 33893, TEL NO: NA , FAX NO: 233887, E-MAIL : N.A.

1998

10 - 50

443

PRINCIPAL

GRAMEEN AYURVEDIC MEDICAL COLLEGE VIDYAGIR TERDAL TK JAMKHANDI PIN CODE:


587315, STD CODE: 08353, TEL NO: 255922, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

444

PRINCIPAL BASAVESHWARADENTAL
COLLEGE

BAGALKOT ,
: N.A.

2002

10 - 50

445

PRINCIPAL

BASAVESHVER INDIPENDEN SR UNIVERSITY ARTS AND SCIENCE CULLEGE


VIDYAGIRIBAGALKO PIN CODE: 587102, STD CODE: 08354, TEL NO: 00233764, FAX NO: NA,
E-MAIL : N.A.

2003

10 - 50

446

BASAVESHWAR TEACHER TRANING


INSTITUTE

MUDHOL TGMUDHOL DTBAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587313, STD CODE: NA , TEL NO: NA ,

2004

10 - 50

447

PRINCIPAL BASAVESHWAR COMMERCE


COLLEGE

BAGALKOT COLLEGE CAMPUS ,


NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: NA , FAX

NA

10 - 50

448

***

NA

10 - 50

449

G R KULKARAN PRINCEPAL

GOVI BOYS P U COLLEGE JAMAKHANDI TALUK JAMAKHANDI DISTRIC BAGALKOT PIN CODE:
587301, STD CODE: 08353, TEL NO: 220840, FAX NO: NA, E-MAIL : N.A.

1889

51 - 100

450

THE PRINCIPAL VMSRV COLLEGE

ATPOST HUNGUND DIST BAGALKO PIN CODE: 587118, STD CODE: 08351, TEL NO: 0260224,
FAX NO: 260331, E-MAIL : N.A.

1967

51 - 100

451

PRINCIPAL BASAVESHWAR JUNIOR


COLLEGE

BAGALKOT ,
: N.A.

1971

51 - 100

PIN CODE: 587361, STD CODE: 08353, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220438, FAX NO: NA, E-MAIL

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220435, FAX NO: NA, E-MAIL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220725, FAX NO: NA, E-MAIL

35

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

452

THE PRINCIPAL C V C RURAL


POLYTECHNIC

ILKAL HUNGUND ROAD N H 3 HUNGUND ATPOST HUNGUND DIS BAGALKOT PIN CODE:
587118, STD CODE: 08351, TEL NO: 260311, FAX NO: 260331, E-MAIL : N.A.

1983

51 - 100

453

PRINCIPAL BASAVESHWAR PHARMACY


COLLEGE

BAGALKOT COLLEGE CAMPUS ,


FAX NO: NA, E-MAIL : N.A.

1984

51 - 100

454

PRINCIPAL S R KANTI EDUCATIONAL


COLLEGE

ILKAL DISTIC BAGALKOT ,


NA, E-MAIL : N.A.

1986

51 - 100

455

PRINCIPAL AKKAMAHADEVI ARTS


&SCIENCE

COLLEUE BAGALKOT ,
NA, E-MAIL : N.A.

1992

51 - 100

456

SHREE VEERAPULIKESHI BAMS


COLLEGE

BADAMI BAGALKOT PIN CODE: 587201, STD CODE: 08357, TEL NO: 220586, FAX NO: NA,
E-MAIL : N.A.

1998

51 - 100

457

SRIMANN MADHVACHARY INDUSTRIAL


RANING

CENTRE BAGALKOT ,
NA, E-MAIL : N.A.

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220923, FAX NO:

1972

101 - 500

458

ADMINISTRATIVE OFFICER

S NIJHLINGAPPA MEDICAL COLLACE NAVANAGAR ROAD BAGALKO PIN CODE: 587101, STD
CODE: 08354, TEL NO: 00235340, FAX NO: 00235360, E-MAIL : N.A.

2000

> 500

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220008,

PIN CODE: 587125, STD CODE: 08351, TEL NO: 270262, FAX NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220689, FAX NO:

NIC 2004 : 8090-Other education


459

THE HEAD MASTER V M HIGH SCHOOL


HUNGUND

BAGALKDT ROAD HUNGUND ATPOST HUNGUND DIST BAKALKO PIN CODE: 587118, STD CODE:
08351, TEL NO: 260231, FAX NO: NA, E-MAIL : N.A.

1915

10 - 50

460

HEAD MASTER GOVENMEN HIGH


SCHOOL NEAR

KEB OFFICE LKAL DIS BAGALKOT ,


FAX NO: NA, E-MAIL : N.A.

1930

10 - 50

461

HEADMASTER

A R HIREMATH HIKH SCHOOL KERUR ,


230904, FAX NO: NA, E-MAIL : N.A.

1956

10 - 50

462

HEADMASTER GOVERNMEN GIRLS HIGH


SCHOOL

ILKAL TALUK HUNGUND DISTRICT BAGALKO ,


272461, FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

463

HEADMASTER GOVGRNMEN GIRRS


HIGH SCHOOL

OLKAL TALUK HUNGUNO DISTRICT BAGALKO ,


NO: 272461, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587125, STD CODE: 08351, TEL

1964

10 - 50

464

S M LAGALTSPRTNCIPAL

B L D E COLLEGE JAMAKHANDI ,
NO: NA, E-MAIL : N.A.

PIN CODE: 587301, STD CODE: 08353, TEL NO: NA , FAX

1964

10 - 50

PIN CODE: 587125, STD CODE: 08351, TEL NO: 270397,

PIN CODE: 587206, STD CODE: 08354, TEL NO:

PIN CODE: 589125, STD CODE: 08351, TEL NO:

36

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1970

10 - 50

1970

10 - 50

1975

10 - 50

465

HEADMASTER S M S KHADR HIGH


SCHOOL

CLKAL TALUK HUNGUNU DISTRICT BAGALAO ,


NO: 270144, FAX NO: NA, E-MAIL : N.A.

466

HEADMASTER S M S KHADR HIGH


SCHOOL

ILKAL TALUK HUNGUND DISTRICT BAGALKO ,


270144, FAX NO: NA, E-MAIL : N.A.

467

HEADMASTER BASAVESHWAR
SHISHUNIHAR BAGALK

OT ,

468

THE HEAD MASTER V M GIRLS HIGH


SCHOOL

BAGALKOT ROAD HUNGUND ATPOST HUNGUND DIST BAGALKO PIN CODE: 587118, STD
CODE: 08351, TEL NO: 260231, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

469

PRINCIPAL

M H M P U COLLEGE KERUR ,
NO: NA, E-MAIL : N.A.

1982

10 - 50

470

PRINCIPAL SHRI JAGADGURU


GANGADHAR

MURUSAAVIRMATH TI RAINING CENTRE ILKAL DISTIC BAGALKOT PIN CODE: 587125, STD
CODE: 08351, TEL NO: 270233, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

471

CHIEFENGINEER BASAVESHWAR SANG


BUILDINQ

SECTION BAGALKOT ,
E-MAIL : N.A.

1985

10 - 50

472

THE PRINCIPAL V M BPHARMACY


COLLEGE

HUNGUND ATPOST HUNGUNO DIST BAGALKO PIN CODE: 587118, STD CODE: 08351, TEL NO:
260356, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

473

PRINCIPAL DISTRICT NSTITUTE OF


EDUCATION

AND TRAING RLKAL TALUK HUNGUND DISTRICT BAGALKO PIN CODE: 587125, STD CODE:
08351, TEL NO: 270396, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

474

PRINCIPAL DISTRICT NSTITUTE OF


EDUCATION

AND TRAING LKAL TALUK HUNGUND DISTRICT BAGALKO PIN CODE: 587125, STD CODE:
08351, TEL NO: 270396, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

475

NAVODAY BALAKIYAR MADARI


RESIDENCIAL

SCHOOL MUDHOL Q MUOHOL DIBAGALKO ,


280618, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587312, STD CODE: NA , TEL NO:

1993

10 - 50

476

PRAGAT ADTGONDA AND MASK MAKKAA

RASTARAY PARATAMIK VASTI SHALA BADAMI PIN CODE: 587201, STD CODE: 08357, TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

477

HEADMASTER GURUMAHAN
SHISHUVIHAR CENTRE

ILKAL DISTRICT BAGALKO ,


NO: NA, E-MAIL : N.A.

2005

10 - 50

PIN CODE: 089125, STD CODE: 08351, TEL

PIN CODE: 087125, STD CODE: 08351, TEL NO:

PIN CODE: 587101, STD CODE: 08354, TEL NO: 00220435, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 587206, STD CODE: 08357, TEL NO: 230004, FAX

PIN CODE: 587101, STD CODE: 08354, TEL NO: NA , FAX NO: NA,

PIN CODE: 587125, STD CODE: 08351, TEL NO: 00270420, FAX

NIC 2004 : 8511-Hospital activities

37

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bagalkot
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1922

10 - 50

478

DR LAZAM HOSPITAL MARKE MAIN


ROAD

TALLUKBAGALKOT DISTRIC BAGALKOT ,


220332, FAX NO: NA, E-MAIL : N.A.

479

MEDICAL OFFICER

GOVERMEN MEDICALOFFICE TERDAL TQ JAMKHANDI D BAGALKOT PIN CODE: 587315, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1927

10 - 50

480

DR UDAYA HERANGAL SIRUR NURSING


HOME

VIJAYA BANK ROAD BAGALKO DISTRICT BAGA LKOT PIN CODE: NA , STD CODE: 08354, TEL
NO: 220300, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

481

ASSITANT DIRECTOR

GOVERNMENT VETARNARY HOSPITAL BAGALKOT COLLEGE ROAD BAGALKO PIN CODE:


587101, STD CODE: 08354, TEL NO: 220731, FAX NO: NA, E-MAIL : N.A.

1966

10 - 50

482

MEDICAL OFFICER

GOVT HOSPITAL KERUR ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: 08357, TEL NO: 230240, FAX NO: NA,

1967

10 - 50

483

DR B H KERUD

KERUDI HOSPITAL AND RESEARCH CENTRE NEAR NAGAPPANA KATTI BAGALKO PIN CODE:
587101, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1979

10 - 50

484

OFFICE OF THE CHIEF MEDICAL


OFFICER

GENERAL HOSPITAL LKAL ,


NO: 00270444, E-MAIL : N.A.

1982

10 - 50

485

DR KANTI NURSING HOME KALADASI


ROAD

BAGALKOT DISTRICT BAGALKIT ,


NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:

1983

10 - 50

486

PADMA HOSPITAL

PADMA NAGAR ERDAK ,


NA, E-MAIL : N.A.

PIN CODE: 587315, STD CODE: 08353, TEL NO: 255063, FAX NO:

1991

10 - 50

487

PRINCIPAL

GRAMEE AYURVEDIK MEDICAL COLLAGE HOSPITAL AND REBEARCH CENTRE TERDAL TK


JAMKHANDI PIN CODE: 587315, STD CODE: 08353, TEL NO: 255923, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

488

HEALTH OF ADMINISTRATIVE FIFTY


BEDS

PUBLIC HOSPITAL OLD BAGALKOT DISTRICT BAGALKO TALUK BAGALKOT PIN CODE: 587101,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

489

M S DADDENAVAR HOSPITAL

LAXM NAGAR NEAR RURAL POLICE STATION EXTENTION AREA BAGALKO PIN CODE: 587101,
STD CODE: 08354, TEL NO: 222003, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

490

CHIEF MEDICAL OFFICER

GENARAL HOSPITAL HUNGUND TALUK HUNGUND DISTRIC BAGALKOT PIN CODE: 587118, STD
CODE: 08351, TEL NO: 261629, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

491

DR M N SARAVAGOL CMO

GOVT SUB DIVN HOSPITAL JAMKHANDI DIST BAGALKO PIN CODE: 587301, STD CODE: 08353,
TEL NO: 220066, FAX NO: NA, E-MAIL : N.A.

1938

51 - 100

PIN CODE: NA , STD CODE: 08354, TEL NO:

PIN CODE: 587125, STD CODE: 08351, TEL NO: 00270444, FAX

38

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bagalkot

Name of Establishment

(1)

(2)

492

DISTRICT SURJAN DISTRICT HOSPITAL


SECTOR

Address / Telephone / Fax / E-mail

(3)
NO11 NAWANAGAR BAGALKOT DISTRIC BAGALKO ,
TEL NO: 236260, FAX NO: 236261, E-MAIL : N.A.

PIN CODE: NA , STD CODE: 08354,

Year of start of
Operation

Employment
Class

(4)

(5)

2002

51 - 100

1923

10 - 50

NIC 2004 : 8512-Medical and dental practice activities.


493

SARKAR SARNAJANIK ASPATRE


MUDHOL

TQ MUDHOL A BAGALKOT ,
NA, E-MAIL : N.A.

494

THE HEALTH OFFICER HEALTH


HOSPITEL

A P M C NEAR MAHALENGPUR TZ MUDHOL DIS BAGALKOT PIN CODE: 587312, STD CODE:
08350, TEL NO: 271003, FAX NO: NA, E-MAIL : N.A.

1948

10 - 50

495

DR A R BELAGAG

NURSING HOME MAHALINGPUR MAHALINGPUR TQ MUDHOL DIST BAGALKO PIN CODE: 587312,
STD CODE: 08350, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

496

R P KARADI HOSPITAL ILKAL TQ


HUNAGUND

DISTBAGALKOT ,
N.A.

1986

10 - 50

497

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

NA

10 - 50

B R DS NEAR N H NO 13 HUNGUND ATPOST HUNGUND DIS BAGALKOT PIN CODE: 587118,


STD CODE: 08351, TEL NO: 260260, FAX NO: 260260, E-MAIL : N.A.

1990

51 - 100

PIN CODE: 587313, STD CODE: NA , TEL NO: 280038, FAX NO:

PIN CODE: 587135, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

TALUKA HEALTH OFFICER GOVT HOSPITAL BADAMI PIN CODE: 587201, STD CODE: 08357, TEL
NO: 00220371, FAX NO: 00220311, E-MAIL : N.A.

NIC 2004 : 9211-Motion picture and video production and distribution


498

SHREE KRISHNA TALKIES BAGALKOT


OPPOSIT

C M C BAGALKOT TALUK DIST BAGALKO ,


FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 9309-Other service activities n.e.c.


499

THE MANAGING DIRECTOR

39

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NIC 2004 : 0121-Farming of cattle, sheep, goats, horses, asses, mules and hinnies; dairy farming [includes stud farming and the provision of feed lot
services for such animals]
500

BANGALORE GORAXANA SHALE

DODDANEKKUNDIROAD GARUDACPARPALYA MAHADEVAPURA POS BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: 28510272, FAX NO: NA, E-MAIL : N.A.

1940

10 - 50

501

MASAEBASILKSPRIVATELIMITED

DOERSANIPALAYA BG ROAD BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

502

BALAJI

SHRUTH SILKS BEGUR ROAD BEHIND KRISHNA THEATRE BOMMANMHALLI BANGALORE PIN
CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

503

***

ROMARZA GROUP DIAGONAL ROAD OPPJAINCOLLE E V V PURAM BANGALORE PIN CODE:


560004, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

504

***

KOMARLA GROUP DIAGONAL RD OPPJAIN COLLEGE BANGALORE PIN CODE: 560004, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

505

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 0122-Other animal farming; production of animal products n.e.c.


506

BALRAJ TRASPORTATION

N0 49/7 OPPOSE DON BOSCO COLLEGE BOMMANANAHALLI PIN CODE: 560068, STD CODE: NA
, TEL NO: 51109346, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

507

VINTEJ BAXO FIYEEJ PRI LIMITED

CHUDAYYANAPURA KENGER POST BANGALORE SOUTH BANGALORE PIN CODE: 560060,


STD CODE: NA , TEL NO: 06977146, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

508

***

NO GANESH BUILDING SUGANA POULTRY FROM LTD INDIRA NAGAR MICHALPALYA


BANGALORE PIN CODE: 560088, STD CODE: NA , TEL NO: 25213626, FAX NO: NA, E-MAIL :
N.A.

1995

51 - 100

509

NATIONAL DAIRY RESEARCH INSTITUTE

AUDUGODI HOSURROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1927

101 - 500

NA

101 - 500

PIN CODE: 560030, STD CODE: NA , TEL NO: NA ,

NIC 2004 : 0140-Agricultural and animal husbandry service activities, except veterinary activities.
510

MILITARY FARM

SAHAKARNAGAR POS BELLARYROAD BANGALORE 92 PIN CODE: 560092, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

40

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 0200-Forestry, logging and related service activities

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

511

OFFICE OF THE FOREST RANGE


OFFICER

NO49, 8TH CROSS, MALLESHWARAM BANGALORE RANGE, BANGALORE PIN CODE: 560055,
STD CODE: NA , TEL NO: 23566212, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

512

GAURD FIRE SERVILES

NO 90SMAINROAD BEHINDKRISHNA KALYANA MAN APA MEENAXINAGAR KAMAXIPALYA PIN


CODE: 560079, STD CODE: NA , TEL NO: 56953788, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

513

MR BP SWAMY

NOAGIA CROSS YESHANTHPUR BANGALORE PIN CODE: 560022, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 0502-Fish Farming


514

SUN SCIENCES CONSULTANLY

MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1989

10 - 50

515

D G AQUSTIC

NO 10/1 BYATARAYANAPURA BELLARY ROAD YELAHANKA HOBL BANGALORE PIN CODE:


560092, STD CODE: NA , TEL NO: 30616611, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

NA

10 - 50

NIC 2004 : 1120-Service activities incidental to oil and gas extraction excluding surveying
516

THYAGARAJ

PANTHARAPALYA NAYANDAHALLI NEAR QUTERS MYSOREROAD BANGALORE PIN CODE:


500039, STD CODE: NA , TEL NO: 28600133, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1410-Quarrying of stone, sand and clay


517

MAHALAKSHM ENTERPRISES

NOSG KOTTIGEPALYA MAIN ROAD BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

518

STDNEMARCHAN

WHITEFIELDMAINROAD RAJAPALYA MAHAOEVAPVRAPO BANGALORE SOUTHDISTRICT PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

519

GAVATHRI GRANITES

N0 347 4 PHASE 9 CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

520

MANAGER

SOUTH INDIA GRANET COMPANI NOII6 NDUSTR LAREA Y P R BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: 28395544, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

NIC 2004 : 1429-Other mining and quarrying n.e.c.

41

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
521

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
BABU GARMENT NO I028 9TH MAIN
ROAD

(3)
SRIRAMAPURA BANGALORE ,
NA, E-MAIL : N.A.

PIN CODE: 560021, STD CODE: NA , TEL NO: NA , FAX NO:

Year of start of
Operation

Employment
Class

(4)

(5)

1998

10 - 50

NIC 2004 : 1511-Production, processing and preserving of meat and meat products.
522

NOI46 ASSISTAN REGTSTER OF CO OP


SOCIETY

MALLESWARAM BANGALORE ,
NA, E-MAIL : N.A.

PIN CODE: 560003, STD CODE: NA , TEL NO: NA , FAX NO:

1998

10 - 50

523

NUTRE FEKDS AND FARMS PV LTD

DODDANNA NDUSTRIAL ESTATE NEAR PEENYA ND STAGE BANGALORE PIN CODE: 560091,
STD CODE: NA , TEL NO: 8360883, FAX NO: 8361616, E-MAIL : N.A.

2005

10 - 50

524

***

PIN CODE: NA , STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

525

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

NIC 2004 : 1513-Processing and preserving of fruit, vegetables and edible nuts
526

MYSORE FRUITS PRODUCTS LIMITED

MYSORE FRUITS PROPUCTS LIMITED ND 8615 OPP TO SKON EMPLE BANGALORE 8G PIN CODE:
560086, STD CODE: NA , TEL NO: 23419123, FAX NO: NA, E-MAIL : N.A.

1976

10 - 50

527

FAVOURITE FOODS

NO 49 5TH MAIN ROAD APPURAO ROAD CHAMARAJPE BANGALORE 5600I8 PIN CODE:
560018, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

528

NAMDHARIS FRESH

NO TJI ZND MAIN ROAD VYALIKAVAL MALLESHWARAM BANGALORE PIN CODE: 560003, STD
CODE: NA , TEL NO: 51236134, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

529

NUTHATCH ECHNOLOGY

NO 6O/1O6 MAINROAD BYRAVESWAR ND EST HEGGANAHALLI PEENYA 2 STAGE


BANGLORE PIN CODE: 560091, STD CODE: NA , TEL NO: 28463870, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

530

EBRAHIM M P M

ICA FOODS 287 V MAIN BABANNALEOUT MALLASANDRA BANGALORE PIN CODE: 560057,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

531

AKSHAYA WELFARE UNIT

OPP S1TE OBET KALYANAMANTAP JALAHALL BANGALORET PIN CODE: 560031, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

532

SHAKTHISACKS

KNO 255 KN 3OA/B SUNROAD A ESRIGANDADA KAVAL YESHWANTHPURHOBL BANGALORE


PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 1514-Manufacture of vegetable and animal oils and fats

42

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
533

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
***

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

1994

10 - 50

NIC 2004 : 1520-Manufacture of dairy product


534

CHOCOLATE FACTORY BOFEET ROAD

535

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

536

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

537

BOTTER SPONGE

53 VANIVILAS ROAD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: 26524257,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

HMTLAYOU RTNAGAR BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560032, STD CODE: NA , TEL NO: NA ,

NIC 2004 : 1531-Manufacture of grain mill products


538

BALATI RAICE NDUSTREWE

BHGL 2ND GATE OPPOSITE MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

539

VINU MAC

#205A 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28394512, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

540

DYNAM ELECTRO CONTROLS

HIBGV9MAIN BPHASE PEENYA LNDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28395112, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

541

DIRECTOR SRI LAKSHMI SRTNIVASA


ROLERIMILL

MAGADI MAIN ROADNO44/Z BANGALORE 23 PIN CODE: 560023, STD CODE: 00080, TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

542

COMPAC INDUSTRIES

#162 XMAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

543

HSR CONTAINERS

NO-487/488 NTCROSS RAJAGOPALANAGAR MAIN ROAD PEENYA2NDSTAGE BANGALORE PIN


CODE: 560058, STD CODE: 080, TEL NO: 51179494, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

544

SHIVANANDA FLOUR MILL

SHIVANANDA GENERAL STORES SHIVAMAMDA COMPLEX KUHARA KRUPA EAS BANGALORE


PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

545

NO32IBALAJ NDUCTR MYSOREROAD


BANGALORE

26 ,

1908

51 - 100

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

43

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

546

POWER GEAR LIMITED

547

***

DISTRICT : Bangalore

(3)
#I5-I6 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1980

51 - 100

NA

101 - 500

NIC 2004 : 1533-Manufacture of prepared animal feeds


548

M K RAMACHANDRA

I4 PRASHANTH NILAYA BASAVANAGUDI BANGALORE PIN CODE: 560020, STD CODE: NA , TEL
NO: 23317795, FAX NO: 23317789, E-MAIL : N.A.

1998

10 - 50

NIC 2004 : 1541-Manufacture of bakery products


549

NILGIRIS OFFICE

NOUO4A 2CROSS 8MAIN 3BLOCK KORMANGALA BANGALORE PIN CODE: 560034, STD CODE:
NA , TEL NO: 25527124, FAX NO: NA, E-MAIL : N.A.

1905

10 - 50

550

CANARA BANK

I608 FLOOR KUVEMPU ROAD OPPOSITE O DEVAYA PARK BANGALORE 2I PIN CODE: 560021,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

551

AMUDHA VILAS

11 CROSS HOSAHALL MAIN ROAD PADARAYANAPURA BANGALORE 26 DOOR NO 38 PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

552

OG WQRRIERS BEKARY

IZIT 2OTH MAIN ROAD S BLOLK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

553

NILGIRIS MACHANISED BAKERY PVI LTD

28 MAGRATH ROAD BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO: 25572104, FAX
NO: NA, E-MAIL : N.A.

1989

10 - 50

554

SHASTESS BAREAY 2 SUEETS

673/B UGTHCROSS 8THBLOCK JAYANAGAR ,


26654932, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

555

***

1995

10 - 50

556

SAI VIJAYA BAKERY

NO 44/ SHIVARAM KARANTH ROAD HANUMANTHAN AGARI PIN CODE: 560019, STD CODE: NA
, TEL NO: 56980407, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

557

MAYURA FOOD PRDDUCTS PRIVATE


LIMITED

NO 70/3MARENAHALLI 2 ND PHASE J P NAGARA BANGALORE PIN CODE: 560078, STD CODE:


NA , TEL NO: 22977716, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

558

SAMPATH KUMAR

237GROUNDFLORE 3CROSSTNDIAANAGAR BANGALORE PIN CODE: 560038, STD CODE:


25219, TEL NO: 095, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560082, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

44

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2000

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

559

NAGRAJ

560

***

561

KRISHNA M

NO237/24OGROUNFLOORINDIRANAGARAL3CROSS BANGALORE PIN CODE: 560038, STD


CODE: 25272, TEL NO: 842, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

562

SONIRAAJ CONTECIIONERY

G OI GARUDA MALL MAGRATH ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

563

SURYA BAKERY

LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

564

NAGRAJ

NO 30 ASHWATHNAGAR CROSS SANJAYNAGAR MAIN ROAD BANGALORE 94 PIN CODE: NA ,


STD CODE: NA , TEL NO: 23516103, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

565

B E L LABOUR WELFARE FUND

NEAR B EIL KALYANAMANTAP JALAHALL


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

566

VENU GOPAL NOL51 SHIVAJ NAGARA


BUS STOP

SHIVAJ NAGAR BANGALORE SGOO5I PIN CODE: NA , STD CODE: NA , TEL NO: 51132645, FAX
NO: NA, E-MAIL : N.A.

1995

51 - 100

567

***

NA

51 - 100

568

KWALITY BISCUI FACTORY

MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1980

101 - 500

SUBAR FACTORY NOBG KR GARDEN B BLOCK KORAMANGALA BANGALORE PIN CODE:


500095, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

51 - 100

NA

101 - 500

NO 30 ASHWATHNAGAR
E-MAIL : N.A.
,

SS ,

PIN CODE: NA , STD CODE: NA , TEL NO: 11, FAX NO: NA,

BANGALORE PIN CODE: 560031, STD CODE: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1542-Manufacture of sugar


569

***

NIC 2004 : 1543-Manufacture of cocoa, chocolate and sugar confectionery


570

BANGALORE SOFT DRINK FACTORY

H MAIN MYSORE ROAD BANGALORE-3G PIN CODE: 560039, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1549-Manufacture of other food products n.e.c.

45

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(2)

(3)

Employment
Class

(4)

(5)

571

A G MAHAMAD KHAN

GRIND WKLL ENTERPRISES KAMAGONDANA HALL PIN CODE: 560015, STD CODE: NA , TEL NO:
28389709, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

572

SLNGARAMMA FLOUR MILLS

NO 3IO 3 4 PHASE PEENVA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28362010, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

573

FRESH

NO IB SUBRAMANYA SMAMY STR E KUMARA PARK WEST BANGALORE ZO PIN CODE: 560020,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

574

M R ISTIFAR

ICE FACTORY DOOR NO SUDHAMA NAGARA BAN ALORE PIN CODE: 560027, STD CODE: 080,
TEL NO: 51240617, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

575

TATA COFFEE

RAILWAY PARALLEL ROAD WEST KUMAR PARK BANGALORE PIN CODE: 560020, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

576

SUNDEEP BHANDARY SUNVALLY NO O2


YARO MAN

SION HAUDIN ROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560042, STD CODE: NA , TEL NO: 25588428,

2002

10 - 50

577

B R NAYAK INNOVISIONFOODS PV LTD

SINGASANDRA HOSUR MAINROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

578

HATSUNAGROPRODCT LTD RG
CHANDRAMOGAN

NO96/2AECSLAYOUT SINGASANDRA HOSUR ROAD BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 25737878, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

579

BHARATH INOUSTRIES

#BB 1MAIN EPHASE PEENYA INDUSTRIAL ARZA BANGALORR PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

9701

10 - 50

580

SVT PRODUCTS

IN USTRIAL SUBRUB YESWANTHPURIBANGALORE Z2 PIN CODE: 560022, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

581

MANAGER

GUDRICH HERO SPEIS NO14 5MAIN INDUSTRIAL SUB Y P R BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

582

MANAGER

VEERABHADRASWAMY AGRO TNDASTRIAS NO324C PEENYA NDASTRIAL ESTA BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

583

ICON FOOD SUPPLY COMPANY

NO 354/I VENKE SWANY LAY OU KORAMANGLA Z BLOCK BANGALORE PIN CODE: 560095,
STD CODE: NA , TEL NO: 30922165, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

584

ROOTS DOG GEETHAZRISHAN NO932


ZALIKAMBA

COMPLEX SINGASANDRAPOS HOSURMAINROAD RANGALORE


560006, STD CODE: NA , TEL NO: 51119911, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

ONEST CAPE LIMITED

46

1FLOOR PIN CODE:

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

585

M K GUPTA

586

***

587

***

588

MANAGER

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

CHAMUNDI FIOOR MILL PV LTD GARWKBHAVIPAL YA HOSUR ROAD BANGLORE SI00G8 PIN
CODE: 560068, STD CODE: NA , TEL NO: 51100326, FAX NO: NA, E-MAIL : N.A.

1973

51 - 100

SAFAL DAILY FRESH # 8TH BLOCK, NR LAYOUT, KORAMANGALA PIN CODE: 560095, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

51 - 100

NA

101 - 500

NA

> 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

MADRAN FOOO INDUSTRIS NO30/0A 2 STAGE YPR BANGALORE PIN CODE: 560022, STD CODE:
NA , TEL NO: 23370103, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1551-Distilling, rectifying and blending of spirits; ethyl alcohol production from fermented materials
589

MANAGER

CAVERE DISTALERIS NO123A PEENYAIDUSTRIAL ARIA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

590

BANGALORE AMRUTH DISTILERS


COMPANY

RAJARAMMOHANROY ROAD BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

591

GROVER WINEYARD LTD ABAZ K


HEDIKER

MANAGER 127 FIRSTFLOOR NDEXTENTION JAYAMAHAL BANGALORE PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL NO:

NIC 2004 : 1552-Manufacture of wines


592

MB MURALIOHARAN

NI5 4 PHASE 1CROSS PEENYA INDUSTRSAL AREA BANGALORE PIN CODE: 560058, STD CODE:
080, TEL NO: 51172161, FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

NIC 2004 : 1554-Manufacture of soft drinks; production of mineral waters


593

MR VINODHJAKATHI

COCO COLA FACTORY SANJEEVIN NAGAR BELLARY TOAD BANGALORE PIN CODE: 560092,
STD CODE: NA , TEL NO: 23332418, FAX NO: 23435154, E-MAIL : N.A.

1980

10 - 50

594

MANGER

NO I26 HAR NIVAS 4 MAIN 11CROSS MELLESHWARAM BANGADRE PIN CODE: 560003, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

595

BISLARIE WATAR BOTTAL FACTORY

ASHWATH NARAYANA MINERALS FLAT NO G THRIMALAPPA NAGAR ATTUR 2ND STAGE PIN
CODE: NA , STD CODE: NA , TEL NO: 28563243, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

47

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2002

(5)
10 - 50

#1B 4 MAIN 3 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
080, TEL NO: 56999356, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

FORBES AQUATECH LIMITED

2CROSS RAGHAVENDRANAGAR KALYANNAGAR BANGALBRE PIN CODE: 560043, STD CODE:


NA , TEL NO: 25432114, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

ANANTH

BANGALOREWATERSUPPLYANDSEWARAGEBOARD OUTF RRINGROAD NEARNAGAVARLAKE


BANGALORE PIN CODE: 560032, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1970

10 - 50

NA

10 - 50

596

JAGANNATHAN
PREMIUMWATERPACKQEDDRINKING

WATER AND PETSODA BELMARESTATE BANGALORE NAGASANDRAPOST PIN CODE: 560073,


STD CODE: NA , TEL NO: 23724847, FAX NO: NA, E-MAIL : N.A.

597

SRIRAM ENTERPRISES

598

599

NIC 2004 : 1600-Manufacture of tobacco products


600

SIGFILL TO UMKUR ROAD

601

***

YASHWANTHPUR BANGALORG-22 ,
FAX NO: 23377981, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: 23370443,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1711-Preparation and spinning of textile fiber including weaving of textiles (excluding khadi/handloom)
602

MANAGER

NO6 SHANTALA SILK SAREES TANKBANDROAD BANGALORE PIN CODE: 560009, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1960

10 - 50

603

SHANKAR KUMAR

DODDA DEVANGA BEED ANEKAL OWN ANEKAL BANGALORE PIN CODE: 562106, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1979

10 - 50

604

RAJSHEKAR S/O VENKATAPPA

DODDADEVANGABEEDHI ANEKAL ,
NO: NA, E-MAIL : N.A.

1980

10 - 50

605

***

1980

10 - 50

1980

10 - 50

606

PIN CODE: 562106, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 562106, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

LL
E-MAIL : N.A.

IT T9 PIN CODE: 262106, STD CODE: NA , TEL NO: NA , FAX NO: NA,

607

SHIVARAJ

NO 148 KAREKAL KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

608

K M MANI

2ND MAIN BHUVANESWAR ROAD JARAGANAHALLI BANGALORE PIN CODE: 560078, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

48

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

609

POWER LOOM V ANAND

NO 13 2 MAIN SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22222002, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

610

ARVIND MILLS

NEAR KWALITM BISCUIT FACTORY MYSORE ROAD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

611

METALIC FRABRJCATION NORKS

#B KEMPPAGOWDA ESTATE 2STBGE MAGAO MBIN RGGD KAMAKSHIPALVA BANGALORE PIN


CODE: 560079, STD CODE: 9580, TEL NO: 23358333, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

612

K VENKATARAMANA

KAMAKSHMMMA BADAVANAY YELAHANKA CHOWDESWAR LAYOUT PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

613

NAGALAIAHI

KAMKSHAMMA BAPAVANAY YELAHANKA PIN CODE: 560064, STD CODE: 1, TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1984

10 - 50

614

D MUKUND WISTING FACTORV

BAJANEMANE BEEDI HOSEPE ANEKAL BANGALORE SOUTH PIN CODE: 562106, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

615

BOOMIREDDY

KAMKSHAMMA BADAVANAY CHOWDESWAR LAYOUT YELAHANKA PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

616

SRI LAKSHM SILK MILLS 33/1


MALLATHAHALL

BEHIND BANGALORE UNIVERSITY CAMPUS BANGALORE PIN CODE: 560056, STD CODE: NA ,
TEL NO: 23214515, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

FLOWER STREE ANEKAL PIN CODE: 562106, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1987

10 - 50

1987

10 - 50

1989

10 - 50

617

RAVIKUMAR THIMMARAYAPPA

618

LUMS

OUI JR CROSS LALBH GH ROA BAGAL ,


22237113, FAX NO: NA, E-MAIL : N.A.

619

CHANDERAPPA ENTERPRISES

MAJID ROAD ANEKAL ,


E-MAIL : N.A.

620

CHANDR SHEKAR

NO Z JC ROAD IS CROSS RAMANA GARDDN BANGALDRE ZT PIN CODE: 560027, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

621

P SHANKAR S/O SHIVASHANKARAPPA

DODDADEVANGA BEEDH ANEKAL ,


NO: NA, E-MAIL : N.A.

1990

10 - 50

622

MATHOD MARIAPPA POWERLOOM

NO25 2OTH CROSS CUBBONPE MAIN ROAD BANGALORE PIN CODE: 560002, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL NO:

PIN CODE: 562106, STD CODE: 29409, TEL NO: NA , FAX NO: NA,

PIN CODE: 562106, STD CODE: NA , TEL NO: NA , FAX

49

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

623

SILK FACTORY

NO45 2NDCROSS CKC GARDEN LALBAGH ROAD BA NGALORE PIN CODE: 560027, STD CODE:
NA , TEL NO: 22234684, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

624

RAJESH ADVOCATE LOOMS FACTORY

6TH CROSS MAIN SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL
NO: 22238650, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

625

SILK HARD FACTORY KAREKALLU


KAMAKSHIPALY

A BANGALORE ,
N.A.

1990

10 - 50

626

CHANPRASHEKHAR SILK FACTORY

KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1990

10 - 50

627

V SQUARE CLOTHING COMPANY

23 5TH CROSS AVAREKERE BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

628

POWER LODMS SILK

NO 156 ST CROSS KORAMANGALA VILLAGE ROAD 8TH BLOCK BANGALORE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

629

H NAGARAJU

DEVANGAPET CHIKKABEEDH ANEKAL ,


FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

630

BHAGAVANTHA SILK FACTORY

KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1992

10 - 50

631

NARASIMHA REDDY

EMAIN 4 H CROOSS KAMKSHAMMA BADAVANAY PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

632

VENKATA RAMAN

KAMKSHAMMA BADAVANAY YELAHANKA CHOWDESWAR LAYOUT PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

1993

10 - 50

633

R VISWANATHA

1285 2MAIN 2CROSS KAMKSHAMMA BADAVANAY YELAHANKA PIN CODE: 560064, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

634

MANJUNATH POWERLOOM

NO 12 16TH CROSS CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

635

KRISHNAPPA SILK FACTORY

NO 6MAIN KAMAKIPALAYA ,
E-MAIL : N.A.

1994

10 - 50

636

SUNIL GUPTA

NO 35 MUNISWAMEPPA LAYOU J CROSS MANGAMM APALYA BANGALORE 68 PIN CODE:


560068, STD CODE: NA , TEL NO: 51100635, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

PIN CODE: 560029, STD CODE: NA , TEL NO: NA

PIN CODE: 562106, STD CODE: NA , TEL NO: NA ,

PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA,

50

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(2)

(3)

Employment
Class

(4)

(5)

1994

10 - 50

POST OFFICE ROAD ANEKAL TQ BANGALORE SOUTH PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

637

PADMANABHA

638

POWERLOOMS FACTORY

639

NAGARAJU WISTINGFACTORY

OLD SYNDICATEBAVKROAD RAMASTEMPLE HOSEPE ANEKAL BANGALORESOUTH PIN CODE:


562106, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

640

R V VASANTHA REDDY

NO 1-441-I3 C CROSS KONDAPPA LAYOU YELAHANKA BANGALORE PIN CODE: 560064, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

641

DEVARAJ

KAMAKSHAMMA BADAVANEY YELAHANKA PIN CODE: 560006, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

642

RAMAIAH

2MAINE 6 HE CROSS DOOR NUMBER 177 KAMAKSHAMMA BADAVNBY PIN CODE: 560064, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

643

R NAJARAJA

5 MAIN FIRST CROSS CHOWDESWAR LAYOUT YELAHANKA


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

- PIN CODE: 560064, STD

1995

10 - 50

644

REDDY HANDLOOMS

CHINNA REDDY NO 2/164 2ND MAIN KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN
CODE: 560064, STD CODE: NA , TEL NO: 28476621, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

645

P PRA HAKAR D OR N

U HAMA NA ARA BANG LORE ,


NO: 1211, E-MAIL : N.A.

1996

10 - 50

646

POWER LOOM

NO IZ SUDHAMA NAGAR B CROSS BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22296492, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

647

HANO LOOMS K VENKA AMANA

NO IBIG RAMANJEENIYA H USES KAMAK HAMMA LAY U LAHANKA BANGALORE PIN CODE:
NA , STD CODE: NA , TEL NO: 28562281, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

648

ASA HAN LOOMS

M N GOVINDAPPA S A HOUSE ND CROSS CHOW ESHWARI LAYOU BANGALORE PIN CODE:


NA , STD CODE: 98, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

649

POWER LOOMS

BARAGURPET ANEKAL TOWN ,


NO: NA, E-MAIL : N.A.

PIN CODE: 562106, STD CODE: NA , TEL NO: 7829 018, FAX

1997

10 - 50

650

LOOMS FACTORY

N199 K S GARDEN LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22229033, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2MAIN 4 THE CROSS DOOR NO 1256 KAMKSHAMMA BADAVAWAY


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

MICO GOPAL

- PIN CODE:

PIN CODE: 560027, STD CODE: 94488, TEL NO: 27895, FAX

51

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

651

CHOWRA REDDY

NO 197 13 CROSS KONDAPPA LAYOU YELAHANKA PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

652

G N NARASIMAHALU NO 2/67 2ND MAIN

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28463707, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

653

GURAPPA

2MAINA4HECROSS DOORNUMRE1/280 KAMAKSHAMMA BADAVANAY YALAHANKA PIN CODE:


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

654

REDDAPPA HANDLOOMS

REDDAPPA NO 2/267 CHOWDESWAR LAYOUT YELAHANKA BANGALORE PIN CODE: 560064,


STD CODE: NA , TEL NO: 28463807, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

655

POWER LOOMS

BARAGURPET ANEKAL TOWN ,


NO: NA, E-MAIL : N.A.

1998

10 - 50

656

THIMMANNA LLL L LT

BARANDOORGALL ANEKAL TOWN BANGALORE


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

657

POWER LOOMS

#J135 10CROSS 3RD MAIN SRIRAMPURA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

658

SAIT POWER LOOMS

TAVAREKERE MAIN ROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

659

B N RAMAKRISHNAPPA HAND L00MS

DOOR NO 753 FIFTH CR SSS CH WDE HWARI LAYOU ELAHANKA B NGAL RSS4 PIN CODE:
55506, STD CODE: NA , TEL NO: 28462914, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

660

RIVENKATARAMANA HAND LOOMS

DOOR NO 718 WARD NO 1 SECOND CROSS CHOWDESHWARI LAYOU YELAHANKA


BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO: 28561023, FAX NO: NA, E-MAIL :
N.A.

1998

10 - 50

KAMKSHAMMA BADAVANAY YELAHANKA CHOWDESWAR LAYOUT PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

661

VENKATARAMANA K

PIN CODE: 562106, STD CODE: 94487, TEL NO: 63854, FAX

L PIN CODE: NA , STD CODE: 30981,

PIN CODE: 560029, STD CODE: NA , TEL NO: NA ,

662

M NARAYANA

DOOR NOI-7 GANESHA TEMPLE OPPOSITE KAMAKSHAMMA BADAVANE YALAHANKA PIN


CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

663

REDDY POWERLOOMS

GANGUL REDDY NO 3/I84 RAJJNNAS HOUSE KAMAKSHAMMA LAYOUT YELAHANKA


BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

664

GUNTLDARVANT

NOOL NDUSTRITS NO4TMAINROAD NDUDTIRIAL TOWN RAJAJINAGAR BANGQLORE PIN CODE:


560044, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

52

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

665

RAMANNA HA SILK SAREE FACTORY

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

666

MAHALAKSHMISILIKS

NO65HIKTHMAINIOTHCROSSILAKSHMINARAAYAPURA BANGALORE PIN CODE: 560021, STD


CODE: NA , TEL NO: 98085797, FAX NO: 11111111, E-MAIL : N.A.

1999

10 - 50

667

RAMU

NO6/1 5THMAINROAD BUVANESHWARI NAGARA MAGADI ROAD BANGALORE PIN CODE:


560023, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

668

R VENKATARAMANA

DOOR NO 563 WARD NO 1 CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN CODE:


560064, STD CODE: NA , TEL NO: 28561023, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

669

VENKATARAMANA-REDDY

DOOR-NO-1-803 WARD-NO-1 CHOWDESHWARI-LAYOUT-YELAHANKA BANGALORE64 PIN


CODE: 560064, STD CODE: 93417, TEL NO: 80337, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

670

MALLIKARJUNA HAND LOOMS

OOR NO G D WARD NO CHOWDESHWARI AYOU ELA A KA BANG LOREG PIN CODE: 560064,
STD CODE: NA , TEL NO: 28561097, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

671

***

VENKAT SUBBAIH NO G CHOUDESWAR LAY YELAHANKA BANGALORE PIN CODE: 560064,


STD CODE: NA , TEL NO: 28461642, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

672

***

N ENAYALU NO J G MANA ARTH THOTA YELAHANKA BA GALORE PIN CODE: 560064, STD
CODE: 94, TEL NO: 48329209, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

673

TWISTINGFACTORY

MAHADEVA

AMEERJHON STREET RAMASTEMPLE ANEKAL BANGALORE SOUTH PIN CODE: 562106, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

674

TWISTING FACTORY

MAHADEVA

AMEERJHON STREET RAMATEMPLE HOSEPE ANEKAL Q BANGALORE SOUTH PIN CODE:


562106, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

675

V ANANDAPPA S O B VENKATAPPA

BARANDOORGALLT ANEKAL TOWN BANGALORE SOUTH PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

676

LAKSHM NARAYAN DOOR NO 8I

SUDHAMA NAGAR BANGALORE ,


NO: NA, E-MAIL : N.A.

2000

10 - 50

677

SRINIVAS HAT SILK SAREE FACTORY

KAREKALLU KAMAKJHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

678

THIMMARAJU SILK FACTORY

KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560027, STD CODE: 22274, TEL NO: 104, FAX

53

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

679

RAJASEHKAR SILK THRAD FACTORY

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

680

SILK SARE FACTORY KAREKALLU


KAMAKSHIPALYA

BANGALORE ,

PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

681

NAVEEN SILK SAREE FACTORY

KAREKALLU KAMAKSHIPALYA BANUALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

682

THUNGA BHADRA MERCURY


MANAGEMENT CHACUNNY

TECHNICAL SERVICESP LTDNO37/5GOVINDAPUR ARABIC COLLEGE POS BANGALORE PIN


CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

683

V AD NARAYANA NO 2/15O

CHOWDESHWARI LAY OUT YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28560884, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

684

SHIVA SHANKAR NO.2/98

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: 94480, TEL
NO: 17352, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

685

G V RAMANA

DOOR NO 49 FOURTH CROSS WARD NO CHOWDESHWARI LAYOU YELAHANKA BANGALORE64


PIN CODE: NA , STD CODE: 2, TEL NO: 28461006, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

686

***

VENKATESH NO TG CROSS MA AVARTH THOTA YELAHANKA BAN ALORE PIN CODE:


560064, STD CODE: 98, TEL NO: 45482589, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

687

HAND LOOMS

RAMAPPA NO 2/246 2ND CROSS CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28561572, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

688

TWISTING FACTORY

GV RAMACHANDRA NO 2/217 7TH CROSS KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE


PIN CODE: 560064, STD CODE: 00080, TEL NO: 57725653, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

689

TWISTINGFACTORY DODDA
NARAYANAPPA

POSTOFFICE ROAD ANEKAL Q BANGALORE SOUTH PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

690

V CHANDRASHEKAR S O B VENKATAPPA

BARANDOORGALLI ANEKAL TOWN BANGALORE SOUTH PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

691

NH POWERLOOMNOI67CROSS
HOSAHALLIMANROAD

PADARANANAPURA BANGLORE 26 ,
NO: NA, E-MAIL : N.A.

2001

10 - 50

692

V ASHOK LOOMS & TWISTING FACTORY

NO 27 2ND MAIN 2ND CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE:
00080, TEL NO: 22244930, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX

54

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

693

VENKATESH AND VENKATAREDDY

92 17 MAIN ROAD JC NAGAR KURUBARAHALLI BANGALORE PIN CODE: 560086, STD CODE:
080, TEL NO: 3494838, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

694

CHANDAN TEXTILES

NO26 MAN VILAS GARDAN KAMALANAGAR BANGALORE 79 PIN CODE: 560079, STD CODE:
98861, TEL NO: 14705, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

695

NAGARAJU SILK SAREE FACTORY

KAREKALLU KAMA SHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

696

MPS

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

697

MURULIPHRA SILK FACTORY

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

698

THIMMARAJU SILK FACTORY

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

699

NARAYANAPPA SILK HRAD FACTORY

KAREKALLU KAMAKSHIPALYA RANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

700

POWERLOOMS CHANDRASHEKAR

SANTHEPE ANEKAL Q BANGALORE SOUTH PIN CODE: 562106, STD CODE: NA , TEL NO:
7829661, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

701

PDWERLOOMS

SANTHEPE ANEKAL Q BANGALORE SOUTH PIN CODE: 562106, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

702

POWERLOOMS C / O SHRINIVAS

POSTOFFICE ROAD ANEKAL Q BANGALORE SOUTH PIN CODE: 562106, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

703

SANJAY

58 NEAR GOVT SCHOOL VRUSHABHAVATHINAGAR KAMAKSHIPALYA BANGALORE PIN CODE:


79, STD CODE: NA , TEL NO: 23484110, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

704

KRISHNAPPA

KRISHNAPPA NEAR SHEEBA PLASTICS VRUSHABAV ATHINAGAR KAMAKSHIPALYA


BANGALORE PIN CODE: 560079, STD CODE: 080, TEL NO: 23480861, FAX NO: NA, E-MAIL :
N.A.

2002

10 - 50

705

SUBRAMANYAYESHAWARA
SILKEMPORIYAM

NOSI HTHMAINROAR STHCROSS LAKSHMTNARAYAN APURA BANGALORE PIN CODE: 560021,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

706

S RAJEGOWDA

N0 29 MAIN BEGURROAD HONGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

SILK FACTORY

NAGARAJU

55

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

707

BAYAIAH REDDY

NO 1-355, 16TH CROSS, KONDAPPA LAYOUT, YELAHANKA BANGALORE PIN CODE: 560064,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

708

NARAYANSWAMY WISTING FACTORY

OLDGYNDECATEBANK ROAD RAMASTEMPLE HOSEPE ANEKAL BANGALORE SOUTH PIN CODE:


562106, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

709

PRUTHV SILK NDUSTRIES

IO8 IS MAIN 5TH CROSS AVAREKE BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

710

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

711

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

712

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

713

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

714

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

715

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

716

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

717

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

718

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

719

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

720

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

721

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

722

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

723

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

724

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

725

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560029, STD CODE: NA , TEL

56

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

JAIGOPAL SRINIVAS SILK FACTORY

727

***

728

TWISTING FACTORY RUKMINAMMA

729

SHIVARAM

730

Address / Telephone / Fax / E-mail

(2)

726

CON SALES

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

NA

10 - 50

NO8O 4THCROSS MISSIONROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

KAREKALLU KAMAKSHIPALYA BANGAL0RE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

10 - 50

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

ND GAI2A KAVERIPUKA RAMAMANDIRA ROAP BANGALORE PIN CODE: 560079, STD CODE: NA
, TEL NO: 23288192, FAX NO: NA, E-MAIL : N.A.
,

UNITI

DISTRICT : Bangalore

PIN CODE: NA , STD CODE: 94482, TEL NO: 93460, FAX NO: NA, E-MAIL : N.A.

731

VEERABHADRAPPA

KAREKALLV KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

732

SUNANDAMMA

KAREKALLU KAMAKSHIPALVA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

733

ISHAWARMYA S KS AND SAREEB

NUY4Z7 ZTH MAINROAD LAKSHMINARAYANAPURAM BANGALORE PIN CODE: 560021, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

734

R VEDA MURTHY

1ZIZ O TH CROSS CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22249904, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

735

R H NARAYANA

IG B H CRDSS CUBBONIPET BA GALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

736

SONASHEKAR

I3 IOTH CROSS CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22228403, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

737

S SOWDADAR RAJ

A B TH CROSS CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22217279, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

738

N SHRIKANTAIH

23/1 8 H CROSS CUBBDN PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

739

S N GANGADARA RAD

GI B TH CRDSS CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22245375, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

57

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

7/1 IO H CROSS CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

C R BHASKAR

27 I TH CRDSS COBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22210956, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

743

MANJUNTHA

13 9 H CROSS CUBBONPF BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

10 - 50

744

H S DEVA RAJ

I9 8 H CROSS CUBBDNPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: 22213062,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

745

MATHOD MALLAPPA

NO ZA IB H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

746

L PURUSHOTHAMA

KAMAL SILK HOUSE NO 66 ZTH CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

747

CHIKKANNA

N0 32 13 H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22213928, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

748

RANGHA SWAMY

N0 SO I1 H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

749

UMASHANKAR POWERLOOMS

#40/1 OLD CHAMARAJPE BP WADIA ROAD BASAVANAGUDI BANGALORE PIN CODE: 560002,
STD CODE: 00080, TEL NO: 51243131, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

750

ROWEL FACTORY

43 SUNGALPET CROSS BANGALORE PIN CODE: 00002, STD CODE: NA , TEL NO: 22225437,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

751

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

752

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

753

***

NA

10 - 50

754

***

NA

10 - 50

740

INDUSHEKAR

22 10 TH CROSS COBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

741

R KRISHNA MURTHY

742

KARNATAKA TEXTILES KUPPASNAMY COMPOUND ARABIC COLLEGE POS BANGALORE PIN


CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

58

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NO 360 361 PENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28362002, FAX NO: 28366196, E-MAIL : N.A.

NA

10 - 50

GAJENDRA

SILKFACTORYSAJJEPALYABANGALORESI ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

758

SRINIVAS

SILKFACTORYBANGALOREBANGALORE9 ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

759

***

NA

10 - 50

760

RAMAKRISHNA HANDLOOMS LD NO
GSS

NA

10 - 50

761

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

762

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

763

RAGHU TWISTING

RAGHU NO
KAMAKSHA MA LAYO YELA ANKA OANGALORE PIN CODE: NA , STD CODE: 98,
TEL NO: 86581291, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

764

MALBARY SILK LTD

NOIO2I2 3 CROSS RC ROAD RAJIVGANDINAGAR BANGALORE PIN CODE: 560008, STD CODE:
NA , TEL NO: 51110489, FAX NO: NA, E-MAIL : N.A.

1998

51 - 100

765

ASHWATHNARAYANA

NO T7 SH MAINROAD BUVANESHWARINAQARA MAGADIROAR BANGALORE- PIN CODE:


560023, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

766

BOSCO INDUSTRIES

#ZZ 5MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 30926268, FAX NO: NA, E-MAIL : N.A.

2004

51 - 100

767

ZANAV HOME COLLECTION

NO 38/3 BLOCK 2 LAKSHM INOUSTRIAL COMPLE X HDSUR ROAD GARVEBHAVIPALYA


MADIVALA B68 PIN CODE: 560068, STD CODE: NA , TEL NO: 25733687, FAX NO: NA, E-MAIL :
N.A.

1995

101 - 500

768

THUNGA BHADRA MERCURY


MANAGEMENT CHACUNNY

TECHNICAL SERVICES PLTD NO37/5GOVINDAPURA ARABIC COLLEGE POS BANGALORE PIN


CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

101 - 500

769

STTELLA SILK LIMITED NARAYANAPURA


ANEKAL

TALUK BANGALORE DIST ,


E-MAIL : N.A.

NA

101 - 500

755

HANUMAN WEAVING FACTORY

NO 473 B 2 11 CROSS 4 PHASE BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

756

EXEL DRILLING EQUIPMEN PRIVATE


LTD

757

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

ST MAIN KAMAKSHAMMA LAYOUT YELAHANKA BANGALDRE PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 562106, STD CODE: NA , TEL NO: NA , FAX NO: NA,

59

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 1712-Finishing of textile excluding khadi/handloom


770

MADESH

#2 B MAIN ROAD NANJAPPA LAYOUT ADUGODI BANGALORE PIN CODE: 560030, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

771

ANQNTHARAMIAH

329/1MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1987

10 - 50

772

K C KUMAR NO 18 3RD MAIN

SOCITY COLONY NANJAPPA LAYOU ADUGOD BANGALORE PIN CODE: 560030, STD CODE: NA
, TEL NO: 22273867, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

773

K C MANJUNATH

NO17 3 MAIN SOCIETYCOLONY NANJAPPA LAYOU ADUGOD BANGALORE PIN CODE: 560030,
STD CODE: NA , TEL NO: 22215914, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

774

ARDHANAR

#3 CROSS NANJAPPA LAYOUT ADUGODI BANGALORE PIN CODE: 560030, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

775

MANJUNATHA GARMENTS

NO 350 BAIRAPPA COMPOUND DEVARJEEVANA HALLI BANGALORE 45 PIN CODE: 560045, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

776

#97 VARALAKSHM ENTERPRISES


3CROSS ANJANE

YA TEMPLE ROAD NEAR YPR RAILWAY STATION YESHANTHPURA BANGALORE PIN CODE:
560022, STD CODE: 23370, TEL NO: 39, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

777

ANAND ANUBAGS

N017 8RUDRAPPAGARDEN 5THCROSS KASTURABANAGAR MYSOREROAD BANGALORE PIN


CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

778

D LINK LTD SOFTWARE AND GED


CENTER

NO 65 35 MAIN 100 FEET RING ROAD 1 STAGE BTMLAYOU BANGALORE PIN CODE: 560068,
STD CODE: 08067, TEL NO: 88345, FAX NO: 789625, E-MAIL : N.A.

1995

10 - 50

779

MONEE COMPANY PV LTD


NO-163INDUSTRILS U

2STAGE YESHWANTHPUR TUMUKUR ROAD BANGALORE PIN CODE: 560022, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

780

ANIL GARMENTS

RAMACHANDRAPURA BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1998

10 - 50

781

SRINIVAS GARMENT

6O MEENAXINAGAR KAMAXIPALYA ,
NO: NA, E-MAIL : N.A.

1998

10 - 50

782

AMITHASHARMA

Z GANGADARA SHE Y ROAD BANGALORE PIN CODE: 560042, STD CODE: NA , TEL NO:
52739123, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX

60

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

783

SSSRAVITRI

SSGARMETS RATA NAGAR PIN CODE: NA , STD CODE: 23348, TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2001

10 - 50

784

V S ENTERPRISES TAILORS GARMENTS


NAGARAJ

1/49 OPP BP PETROLBANK MAGADI MAIN ROAD BANGALORE 23 PIN CODE: 560023, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

785

BLACKBOARD GARMENTS SHIVA KUMAR

ANNIPURA MAIN ROAD SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

786

HARISHCHANDRA ANAND

NO 327, 2 CROSS 2 BLOCK R M V 2 STAGE BANGALORE PIN CODE: 560094, STD CODE: NA ,
TEL NO: 30612890, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

787

WAZIR BEGE AILORING WORKS

11THCROSS WARDNO 43 WEST DADARAYANAPUBA ARFATH NAGAR PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

788

SANJAY NOBEL PROJECTS NO 24


HAUDIN ROAD

ULSOOR BANGALORE ,
25325036, E-MAIL : N.A.

2004

10 - 50

789

SREE SIDDARAJU GARMENTS

NO1166 VEERA BHADQESHWARA TACKEES ROAD KAMALANAGAR BANGALORE 79 PIN CODE:


560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

790

SONY AILORING WORKS

NOII2 MARKE MAIN ROAD KAMALANAGARA BANGALORE PIN CODE: 560079, STD CODE:
98806, TEL NO: 08685, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

791

***

NA

10 - 50

792

DEVAKI DESIGN NO49 HILL HO


BUILDING NAYA

NDALLI MYSORE ROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

793

ADITHYA DESIGNS

NO 2511I NAYANDAHALY BANGALORE - PIN CODE: 560039, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

794

***

NA

10 - 50

795

ALEKANDER MENS WEAR TAILORS

M GIROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: 11111111, FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

796

TAILORING DESIGNER WEAR

CRESEN ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560042, STD CODE: NA , TEL NO: 25580030, FAX NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560039, STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

61

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

FUS11 MIAN 1CRASS DAYANANDANAUAH SRIRAM APURA BANUALORE PIN CODE: 21, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

M S B LINE C A R HQTRS MYSORE ROAD BANGALORE PIN CODE: 560018, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1990

101 - 500

HANDLOOMS NO38 A MAIN NANJAPPA LAYOUT ADUGOD BANGALORE PIN CODE: 560030,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

797

P N RAO MENSIWEAR

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

798

MANJUNATHAENTERPRESES

799

C A R POLECE KALYANA KENDRA

800

***

801

***

802

***

803

***

804

GAYATHRI YS WELFARE OFFIIE

GOKALDAS MAGESPVT LTD 78/2INDUTRIAL SUBURB 2NDSTAGE YESHWANTH TUMKURROAD


PIN CODE: 560022, STD CODE: 9180, TEL NO: 3474030, FAX NO: 3377064, E-MAIL : N.A.

NIC 2004 : 1713-Preparation and spinning of textile fiber including weaving of textiles (khadi/handloom)
805

PAPANNA

OY

806

SWADESHI SILKS

NO 41 1 MAIN ROAD S R NAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22221667, FAX NO: 22228114, E-MAIL : N.A.

1975

10 - 50

807

UCNLON METALIC NDUSTRIES

S MAIN A PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28395942, FAX NO: 28395942, E-MAIL : N.A.

1980

10 - 50

808

LAKSHMINARAYANA K

DOOR NOI169 2MAINE GTHF CROSS. KAMAKSHAMMA BADAVANAY YELAHANKA PIN CODE:
560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

809

SURESHKUMARREDDY

EMAIN 4TH CROSS KAMAKSHAMMA BADAVANE YRLAHANKA PIN CODE: 560064, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

810

SURESH KUMAR REDDY

ND MAIN, 4TH CROSS, KAMAKSHAMMA BADAVANAY, YELAHANKA PIN CODE: 560064, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

811

34/10 IMAIN ROAD

GANDHINAGAR BANGALORE PIN CODE: 560009, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1986

10 - 50

62

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

812

SURAELECRICALS

NO358-359 4 PHASE PENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28364561, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

813

POWER LOOMS

NO14 NANTAPPA LAYOUT 14MAINROAD KAMAKSHI PALYA VRUSHABHAVATHINAGAR


BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

DRO NO1/2232MAIN 6THECROSS KAMKSHAMMMABAUAVANAY PIN CODE: 560064, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

814

LAKSHMINARASAIAH

815

NSGARAJU

9 MAINROAO VRUSHABHSVATHINAGAR KAMAKSHIPA LYA BANGALORE PIN CODE: 79, STD


CODE: NA , TEL NO: 23586145, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

816

SRILAKSHAICORPORATION

BHARATHINDUSTRIALAREA BANNERGHATTAROADBANGALORE PIN CODE: 560076, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

817

R SRINIVAS NO 63 2ND MAIN ROAD


CROSS

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

818

RAMACHANDRA B 2ND MAIN ROAD

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28460451, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

819

A S RAJU NO 2/87 MAIN 3 CROSS

KAMAKSHAMMALAY OUT YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28460729, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

820

R N RAMACHANDRA AMAR APE


INDUSTRIES

IT A CROSS AGRAWARADASARAHALLI BANGALORE TQ PIN CODE: 560079, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

821

SANBUKUMARJHUNJHUNWALA

PUSHPANJALISILKPVT MANANDAARCADEC0MPLEX SCROADSESHADARIPURAMBANGALORE


PIN CODE: 560020, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

822

G D SURESH NO 15 ST CROSS
CHIKKASWAMY

LAYOUT J P NAGAR POS BANGALORE ,


56963304, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

823

VENKATARAMANA NO 1689 2ND MAIN

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

824

SWAM POWERLOOMS

NARAYANSWAMY NO 2/302 10TH CROSS KAMAKSHAMMA LAYOUT BANGALORE PIN CODE:


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

825

SILK FABRICATION

NO 21 SECOND CROSS MUNISWAMYPALYA LAYOUT BDMMANAHALLI BANGALORE 68 PIN


CODE: NA , STD CODE: NA , TEL NO: 25736895, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

PIN CODE: 560078, STD CODE: NA , TEL NO:

63

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

826

SV CHALAPATH

827

CHOWDAPPA

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

RMAINE AEHECROOS KAMAKSHAMMA BADAVANEY TRAINTRACK PIN CODE: NA , STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

GANESHA TEMPLE OPPOSITE KAMAKSHMMABADAVANEY YELAHANKA PIN CODE: 560064,


STD CODE: 1, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

JI J CROSS PURSHOTAMS HOU E KAMARSHAMMA LAYOUT YELAHANKA BANG L RE PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

SUDHAKAR NO
MAN VART
THA YELAHA KA BAN ALORE PIN CODE: 560064, STD CODE:
NA , TEL NO: 28565157, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

828

JA ARAMA H PGWER LOOMS

829

***

830

GOUSIAN PO POWER LOOMS

NO 55 1S A MAIN ROAD NANJAPPA LAYOU ADUGOD BANGALORE PIN CODE: 560030, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

831

NAGARAJU

NO Z S MAINROAD VRUBHABHAVATHINAGAR KAMA KSHIPALYA BANGALDRE PIN CODE: 79,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

832

SRFRNIVAS

KAREKAL VRUSHABHAVATHINAGAR KAMAKSHIPALYA BANGALORE PIN CODE: 79, STD


CODE: NA , TEL NO: 93417019, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

833

KANCHIKAMAKSHISIIKSANDSAREES

NO98 4THMAIN LAKSHMINARAYANAPURA BANGALORE PIN CODE: 560021, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

834

A CHANDRASHEKAR NO 16 2ND MAIN


2ND

CROSSICHIKKASWAMY LAYOUT J P NAGAR POST BANGALORE PIN CODE: 560078, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

835

M NAGENDRAPPA

DNO41 IMAIN MARUTH]NAGARA YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA
, TEL NO: 28461184, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

836

G VENKATESH

2 MAIN6THECROSS DRONOI 74 RAMKSHAMMA BADAVAVANAY PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

837

***

AMARNAT4 NO IZ MANAVARTHI 4OTA YELAHANKA BANGALORE PIN CODE: 560064, STD


CODE: 98, TEL NO: 45288774, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

838

G NAGARAJ NO J B MANAVA TH THOTA

ST CROS E AHANKA BANGALOR ,


FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

839

POWER LOOMS

NOG3 4MAINROAD NANJAPPA LAYOU KAMAKSHI PALYA VRUSHABHAVATHINAGAR


BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: 98866754, FAX NO: NA, E-MAIL :
N.A.

1998

10 - 50

PIN CODE: 560064, STD CODE: NA , TEL NO: 28561024,

64

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(3)

Employment
Class

(4)

(5)

840

SUBRAMANYAM

BARANI ETTILES I5 MAINROAD VRUSHABHAVATM NAGAR KAMAKSHIPALYA BANGALORE PIN


CODE: 79, STD CODE: NA , TEL NO: 23285760, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

841

SHIVAKUMAR VRASHABHAVATH NAGAR


WARD 17,9

BLOCK MAGADI MAIN ROAO KAMAKSHIPALYA BANGALORE 560079 PIN CODE: 560079, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

842

R VENKATA SIDDALU NO 915 MAIN 2ND


WARD

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28462862, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

843

B V VENKATA RAMANA

DOOR NO 572 FOURTH CROSS WARD NO-I CHOWDESHWARI-LAYOO YELAHANKA


BANGALORE64 PIN CODE: 560064, STD CODE: NA , TEL NO: 28560785, FAX NO: NA, E-MAIL :
N.A.

1998

10 - 50

844

R RAMACHANDRA HAND LOOMS

DUOR NOTI8 THIRD CROSS CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN CODE:
560064, STD CODE: NA , TEL NO: 28561023, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

845

A S SRINIVAS DOOR BOZ

DURGA MDHALLA XROSS YELAHANKA BANGALORE PIN CODE: 560006, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

846

RAVI

KAMAKSHAMMA BADAVANAY YELAHANKA CHOWDESWAR LAYOUT PIN CODE: 560064, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

847

NAGAREDDY

GANESHA TEMPLE OPPOSITE KAMAKSHAMMA BADAVANE YELAHANKA PIN CODE: 560064,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

848

L RAMAKRISHNA PA POWER L OMS

NO B O O BHA H E GLIS SCHO L KAM K H MMA LAY U YELAHAN A A


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

849

KRISHNA POWER LOOMS

KRISHNIAH NO 2/187 OTH CROSS KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: 00080, TEL NO: 28560787, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

850

PURUSHOTHAM POWERLOOMS

PUROSHOTUM NO 2/227 7TH CROSS KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28562755, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

851

SREENIVASA POWERLOOMS

SREENIVASA NO2/187 10TH CROSS RAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28460446, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

852

RAJ POWER LOOMS

RAJANNA NO 2/256 CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN CODE: 560064,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

853

GANGA POWER LOOMS

GANGADHARA NO 1793E 1S MAIN CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: 00080, TEL NO: 28564369, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

65

ORE PIN CODE:

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

854

CHANDRAMMA

NO IA CROSS A MAIN SAMPANGIRAMANAGAR BANGALORE-27 PIN CODE: 560027, STD


CODE: NA , TEL NO: 22233904, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

855

HEMALATHA

#30 8 MAINROAD JC NAGAR KURUBARAHALL BAN GALORE PIN CODE: 560086, STD CODE:
080, TEL NO: 23408600, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

856

VENKATARAMANAPPA

NO2 I5 MAINROAD VRUSHABAVATHINAGAR KAMAK SHIPALYA BANGALORE PIN CODE:


560079, STD CODE: NA , TEL NO: 23586145, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

857

PRAKASH

SHIVAFORM #1135 MAGADI MAIN ROAD KAMAKSH PALYA BANGALORE PIN CODE: 560079,
STD CODE: 9580, TEL NO: 23288611, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

858

SRINIVASULU NEW BUILDING


PUTTANAHALLIROAD

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28460958, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

859

N VENKATARAMANA

1ST CROSS, KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN CODE: 560064, STD
CODE: 00080, TEL NO: 28560569, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

860

VENKATARAMANA POWERLOOMS

WARD NO CHOWDESHWARI LAYOU THIRD CROSS DOOR NO 731 YELAHANKA BANGALORE


64 PIN CODE: 560064, STD CODE: NA , TEL NO: 57671428, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

861

J KRISHNAIAH POWERLOOMS

DOOR NO 576 4 CROSS CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN CODE:


560064, STD CODE: NA , TEL NO: 28462719, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

862

G V NAGAYYA POWER LOOMS

DOOR NO 566 FOURTH CROSS CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN


CODE: 560064, STD CODE: 00080, TEL NO: 28561, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

863

RAVINDRANATH POWER LOOMS

D NO 753 2ND CROSS WARD NO 1 CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN


CODE: 560064, STD CODE: NA , TEL NO: 28560973, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

864

LAKSHMIPATHY POWER LOOMS

DOOR NOI 31 SIXTH CROSS CHPWDESHWARI LAYOO YELAHANKA BANGALUREGE PIN CODE:
560064, STD CODE: NA , TEL NO: 57600155, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

865

VENKATA RAMANA POWER LOOMS

DOOR NO TIB WARD NO CHOWDGSHWARI LAYOU YELAHANKA BANGALOREGX PIN CODE:


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

866

G RAMIAH DOOR NO 289

MOSQOE ROAD YELAHAKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO:
8460382, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

867

POWER LOOM

REDDAPPA NO 1651, 1ST MAIN KAMAKSHAMMA LAYOUT, YELAHANKA, BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28460671, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

66

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

868

MURTHY POWERLOOMS

BALAMURTHY NO1740 2ND MAIN ROAD KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE


PIN CODE: NA , STD CODE: 00080, TEL NO: 28462025, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

869

POWER LOOMS

SREENIVASULU NO 207 7TH CROSS KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28562654, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

870

POWERLOOMS

MAHADEVIAH NO 2/300 KAMAKSHAMMA LAYOUT YELAHANKA BANGALORE PIN CODE:


560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

871

SUDHA POWERLOOMS

SUDHAKAR NO 2/255 2ND CROSS CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28561227, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

872

NAGARAJA POWER LOOMS

S NAGARAJA NO 2/236 2ND A MAIN CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28561856, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

873

YOGESH POWER LOOMS

YOGESH NO 2/254 2ND A MAIN CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN CODE:
560064, STD CODE: 00098, TEL NO: 80609031, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

874

CHOWDAPPA POWER LOOMS

CHOWDAPPA NO 2/252 2ND A MAIN CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: 28563121, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

875

JAYARAJ

SS NEAR GOVT PRIMARYSCHOOL VRUSHABHAVATH NAGAR KAMAKSHIPALYA BANGLORE


PIN CODE: 79, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

876

MANJUNATH

1594 CHENNANARASIMAIAH ND ESTATE KAMAKS HIPALYA BANGALORE PIN CODE: 560079,


STD CODE: 98861, TEL NO: 42567, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

877

NAGARAJA

DOOR NO 56 0 FOUTH CROSS CHOWDGSHWARI LAYOU YELAHANKA BANGALORE64 PIN


CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

878

SREGNIVASA CCPRASAD APTCL

7ZIA FIFTHICROSS WARD NO CHOWD SHNARI LAYOO XELAHANKA BANGALORE64 PIN CODE:
560016, STD CODE: NA , TEL NO: 28567872, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

879

RAVINDRA-POWERLOOMS

DOOR-NO 796 CHTRD CROSS WARD NO 1 CHOWDESHWARI LAYOU YELAHANKA


BANGALOR564 PIN CODE: 560064, STD CODE: 00094, TEL NO: 48237105, FAX NO: NA, E-MAIL
: N.A.

2000

10 - 50

880

B RAMAMURTHY POWER LOOMS

DOOR NO 574 4TH CROSS CHOUDESHWARI LAYOU YELAHANKA BANGALORE PIN CODE:
560064, STD CODE: 00080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

881

CHANDRA MOUL POWER LOOMS

DOOR NO. 86 NEAR ANK CHOWDESHWARI LAYOU YELAHANKA BANGALORE PIN CODE:
560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

67

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

882

SRININASA PDWER LOOMS

DOOR NOG Z WARD NO CHOWDESHWARI LAYOU YELAAANKA BAMGALORE64 PIN CODE:


560064, STD CODE: NA , TEL NO: 28561939, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

883

B RAMCHANDRAPPA NO3 24

BESTER BEEDL CROSS MOSAUE ROAD YELAHANKA BANGALORE PIN CODE: 560064, STD
CODE: NA , TEL NO: 28469100, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

884

***

SREERAMULU
J CROSS KAMAKSHAMMA LAYOUT ELAHANKA B NGALORE PIN CODE: NA ,
STD CODE: NA , TEL NO: 28567930, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

885

***

KRISHNAPPA NO ZIZGA MANAVARTHI MOOTA CROSS YELAHANKA BANGALORE PIN CODE:


560064, STD CODE: NA , TEL NO: 28584292, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

886

EESSHA VASSHYAM

NO68 4MAIN DCROSS NANJAPPA LAYOUT KAMAKS HIPALYA VRUSHABHAVATHINAGAR


BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

2001

10 - 50

887

ESHWAR

ESHWAR 7 CROSS MARUTHINAGAR KAMAKSHIPALYA VRUSHABHAVATHINAGAR BANGALORE


PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

888

R SRINIVASA

DOOR NO 768 TANK BUND ROAD WARD NO 1 CHOWDESHWARI LAYOU YELAHANKA


BANGALORE64 PIN CODE: 560064, STD CODE: NA , TEL NO: 28460446, FAX NO: NA, E-MAIL :
N.A.

2001

10 - 50

889

ANUSUYA WO VENKATESH

DOOR NO 727THLRD CROSS WARD NO CHOWDESHWARI LAYOU YELAHANKA BANGALORE


PIN CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

890

SHANKAR

DOOR NO 768 FIFTH CROSS WARD NO CHOUDESHWA LAYOU YELAHANKA BANGALORE64


PIN CODE: 560064, STD CODE: NA , TEL NO: 28562325, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

891

BABU

IOJ, CHANDRASHEKHAR REDDY BUILDING AGRAHARA LAYOUT, JAKKUR PO. YELAHANKA PIN
CODE: 560064, STD CODE: 98, TEL NO: 45101049, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

892

POWER LOOMS

N013 13 MAIN KAMAKSHIPALYAMAINROAD VRUSHA BHAVATHINAGAR KAMAKSHIPALYA


BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

893

INDUSTRIAL FACTORY KUDLU HOSUR


BANGALORE

-68 ,

2002

10 - 50

894

J NAGARAJA

DOOR NO 575 FOURTH CROSS CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN


CODE: 560064, STD CODE: NA , TEL NO: 28563118, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

895

JAYARAM POWERLOOM S/O


LAKSHMAYYA

DOOR NO 559 3RD CROSS WARD NO 1 CHOWDESHWARI LAYOUT YELANKA BANGALORE PIN
CODE: 560064, STD CODE: NA , TEL NO: 28561082, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

68

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

896

ADINARAYANA POWER LOOMS

DOOR NO 749 CHOWDESHWARI LAYOU WARD NO 1 THIRD CROSS YELAHANKA BANGALORE


64 PIN CODE: 560064, STD CODE: NA , TEL NO: 28564294, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

897

B H ANAND

APS FASHIONS NO 1332 NR LAYOUT VIRATNAGAR BOMMANAHALLI BANGALORE PIN CODE:


NA , STD CODE: NA , TEL NO: 2 732196, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

898

SUNRISE SILK UDYOG NO 4I 18 CROSS

MUNIREDDY LAYOUT MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN CODE: 560068,


STD CODE: NA , TEL NO: 25736736, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

899

DAYANANDHA

JOROHN SILKS NOI06 4 CROSS BEGUR ROAD BOMMANAHALLI BANGALORE-56OO68 PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

900

VINOD

51BPIPELINEROAD DA HRAYA TEMPLE ROAD MALLESHWARAM BANGALORE PIN CODE:


560003, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

901

MANAGER

FAN SILK PVT LID NOIOT OB HSIAGE PEENYA INDUSTRIAL ARZA BANGALORK PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

902

***

NA

10 - 50

903

HANUMANTHAPPA

NA

10 - 50

904

***

NA

10 - 50

905

POWER IOOM FACTORV

ND 5/I 7TH CORSS CUBBON-PE BANGALDRE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

906

CHANDRA SHEKHAR BELL MAGGA

NO 969 SHERKHAN STREET NAGARTHAR PET BANGALORE PIN CODE: 560002, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

907

NAJUNDPPA

HONNURAPPA LANE CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

908

RANGHANATHA

DO NO I4 HONNURAPPA LANE CUBBON PETIBANGALORE PIN CODE: 560002, STD CODE: NA ,


TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

909

D GOPAL

DO NO SO/I HONNURAPPA LANE CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

910

R GOPAL POWERLOOM FACTORY

DO NO 34 CHOWLA GALL SIDDANNA LANE BANGALORE PIN CODE: 560002, STD CODE:
00080, TEL NO: 98863399, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NOII8 4THCROSS MISSIONROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

69

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

911

RAJANNA POWERLOOM FACTORY

DO NO 20 HONNURAPPA LANE CUBBON PET BANGLORE PIN CODE: 560002, STD CODE: 00080,
TEL NO: 22213823, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

912

C CHIKKA HANUMANTHAPPA S SON

NO Y TH CROSS CUBBON P J BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22270159, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

913

C CHIKKA HANUMANTHAPPA G SON

NO 3 TH CROSS CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22270159, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

914

MUNISWAMY

NO IB IZ H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
51243339, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO 17 12 H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22216403, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

915

CHENNAPPA

916

SOMA SHEKAR M

NO 3 JORI PET CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

917

RAJANNA

NO Z GANJGARA B LANE CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

918

RANGANNA

NO ZBI3 GANIGARA C LANE CUBBONPE BANGALORE PIN CODE: 560007, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

919

PURUSHOTHAM

NO 9 2 CROSS CUBBONPE BANGALORK PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

920

KISHORE

NO 1/7 12TH CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

921

BHASKAR

NO 1/8 2 CROSS LUBBONPK BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

922

VASANTH

NO 28/2 13 CROSS CUBBONPEI BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

923

MARIYAPPA

NO 24 13 CROSS CUBBONPIT BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

924

NATARAJ

NO I4 I4 CROSS CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

70

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

925

BANGARU KRIHNAYYA

DOOR NO 570 FIFTH CROSS CHOWDESHWARI LAYOU YELAHANKA BANGALORE64 PIN CODE:
560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

926

LOOMS VENKAJARAMANAJDOOR NO 89
STFCROSS

CHOWDESHWAKI LAYOU FIRST WARD YELAHANKA BANGALORE G4 PIN CODE: 560064, STD
CODE: NA , TEL NO: 28460719, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

927

LAKSHMINARAYANA POWER LOO S

DOOR NO. - 533 WARD NO-1 CHOWDESHWARI LAY OUT YELAHANKA BANGALORE PIN
CODE: 560064, STD CODE: NA , TEL NO: 28460924, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

928

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

929

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

930

POWER LOOMS

ANJEENAIH A S BM MANAVARTH CROSS CHOWDESWAR LAYOVT YEL HAN A BAN LORE


PIN CODE: 560064, STD CODE: NA , TEL NO: 2846229, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

931

POWER LO MS

NARAYANA NO G C INNAPPA HOUSES KAMAKSHAMMA LAYOUT YEL HANKA BANGALORE


PIN CODE: NA , STD CODE: NA , TEL NO: 30575, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

932

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

933

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

934

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

935

***

NA

10 - 50

936

MANAGER GANGA POWERLOOMS

NO27, 8TH CROSS, KEMPAPURA AGRAHARA MAGADI ROAD BANGALORE PIN CODE:
560023, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

51 - 100

937

ESTEEM SILK CREATIONS

NO. 11/1, 80 FEE ROAD, 6TH BLOCK, KORMANGALA, BANGALORE PIN CODE: 560095, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

938

PANCHAJANYA TEXTILES

NO 34/5 MAIN ROAD GANDHINAGAR BANGALORE PIN CODE: 560009, STD CODE: NA , TEL
NO: 22257290, FAX NO: NA, E-MAIL : N.A.

1985

101 - 500

939

ANANTHXUMAR SILKEXPORT COMPANY

SINGASAWDRA BANGALORE ,
NA, E-MAIL : N.A.

1998

> 500

VENKATRAMANNA NO B MA AVAR HI HOOTA YELA ANKA BANGALOR PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO:

NIC 2004 : 1714-Finishing of textiles (khadi/handloom)

71

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

940

KHAD BHANDARA

NAGARAJ M B NO 28 I5CROSS 7TEMPLE ROAD MALLESWARAM BANGALORE PIN CODE:


560003, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

941

RAMSONS GARMEN EINISHING


EQUIPMENI PVTLTD

OPPOSITE BHEL MYSORE RMAD RANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

942

MAHALAKSHM SCREEN PRINTING

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

943

PACHAPPA

NO2 8 CROSS MAGADIROAD BANGALORE PIN CODE: 560023, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

944

SILK DYING FACTORY SHIVA NANJA


GOWDA

#14 CROSS CUBBON PET BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

945

H S KRISHNAIH

NO IP IZ H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22217812, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

946

SHIVA NAJE GOWDA

NO 2O 12 H CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
51227405, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

947

RAJAGOPAL N

NO 3 GANIGARA B LANE CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

948

KANDHAPPA

NO Z O ULSOOR PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

949

A R NAGARA

NO SZ GANIGARA A LANE CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

950

SHIVANANJEGOWDA

NO I4 I4 CROSS CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

951

NO6 SHIVAPRASAD
DYINGANDDARNINGANDWASHING

CENTRE MARUT NAGAR MADIVALA BANGBLORE PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

952

SHREYASENTCRPRISES NO33/1
MALLATHALL

BEHANDBANGALOREUNIVERSITYCAMPUS BANGALORC PIN CODE: 560056, STD CODE: NA ,


TEL NO: 23212761, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

953

***

1995

51 - 100

PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,

SVNAV SILKS PZIVATE LIMITED H599 KORAMANGALA VILLAGE BBLOCK BANGALORE PIN
CODE: 500095, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

72

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 1721-Manufacture of made-up textile articles, except apparel


954

ESSKAY APPARELS

NO209 3 BESIDE KINOTHEATER S C ROAD BANGALORE PIN CODE: 560020, STD CODE: NA ,
TEL NO: 23343414, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

955

UMA GARMENTS

RAMACHANDRAPURAM BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1995

10 - 50

956

HOSEIREES DESIGNERS

RAMACHANDRAPURAM BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1998

10 - 50

957

SOORAJ CRAFTS

PETELNANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

958

SHYAM TEXTILES

PETECHANNAIPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23486394, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

959

RAMPRASAD

ARC INTERNATIONAL GARMENTS AD HALLI MAGAD ROAD BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

960

MBHESHWAR SHIVFORM

9 CROSS MAGADI MAIN ROAD KAMAKSH PALYA BANGALORE PIN CODE: 560079, STD CODE:
9580, TEL NO: 23284594, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

961

SOLLEPARADE FACTORY

NO-19 2ND CROSS 6TH BLOCK RAJAJIRAGAR BANGALORE PIN CODE: 560010, STD CODE: 1,
TEL NO: 23094671, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

962

ABDUL RAZAK NO 15 9ACROSS

PARK AREA WILSON GARDEN BANGALORE 560030 PIN CODE: 560030, STD CODE: NA , TEL
NO: 57606120, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

963

PINNISAY GARMENTS

IZTH CROSS WILSONGARDEN BANGALORE ZT ,


FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

964

***

NA

10 - 50

965

KSMB

H S R M CUBBON PET MAIN ROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

966

S KRISHNAPPA

NO ZBIZ IB H CROSS CUBBONPE BANGALOAE PIN CODE: 560002, STD CODE: NA , TEL NO:
22212118, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 1, STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

73

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1973

(5)
51 - 100

NO65 MAIN ROAD OKALIPURAM NEAR RRR KALYANAMANTAPA BANGALORE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

51 - 100

SHIVAKUMAR

RAMKUMAR MILLS RAJAJINAGAR BANGALORE ,


NO: 23388801, FAX NO: NA, E-MAIL : N.A.

1981

101 - 500

970

ZINITHEXPORTS

TAVAREKERE MAINROAD KRISHNAMURTHYLAYOUT S G PALYA


560029, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

101 - 500

971

CRIMSON CLOTHING

OPPOSITE BHEL, MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

972

RAVI

PETECHANNAQPA INDUSTRIALFAREA KAMAKSHIPALYA BANGALDRE PIN CODE: 560079, STD


CODE: 98, TEL NO: 80505772, FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

973

***

NA

101 - 500

967

BOBBY TOP STITCH APARELS PVT LTD

NO.37 MAIN RAMACHANDRAPURA BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

968

FAREWELL GARMENTS

969

PIN CODE: 560021, STD CODE: NA , TEL

PIN CODE: 560010, STD CODE: 080, TEL

BANGALORE 29 PIN CODE:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1722-Manufacture of carpet and rugs other than by hand


974

GIRIDARSINGH

975

***

976

BASHETTY

#3952/37672BHADRAPPA NDUSTRIAL ESTATE XA MAKSHIPAYA BANGALORE PIN CODE:


560079, STD CODE: 9580, TEL NO: 30616809, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

42KARNATAKASTATECOIRDEVELOPMENTCORPOATION LIMITED BANGALORE_52 PIN CODE:


560052, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

NA

10 - 50

NA

51 - 100

1963

51 - 100

1993

10 - 50

NIC 2004 : 1723-Manufacture of cordage, rope, twine and netting


977

KURLON LTD JALAHALLI

CAMP ROAD JALAHALL BANGALORE-22 PIN CODE: NA , STD CODE: 55555, TEL NO: 23470470,
FAX NO: 23370101, E-MAIL : N.A.

NIC 2004 : 1724-Embroidery work, zari work and making of ornamental trimmings by hand
978

VENUGOPAL VINAYAKA CREATIONS

COMPUTERISEDEMBRODERYWORKS NO37 IND CROSS CHIKKABEGURGATE BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 51115652, FAX NO: NA, E-MAIL : N.A.

74

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

979

HAFEEZ

TAJ FASTION EMBRADY WORK 20 MAIN BTM LAYOUT 7TH CROSS BANGALORE PIN CODE: NA
, STD CODE: NA , TEL NO: 26680795, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

980

AMBIKACRAFTS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 55682090, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

981

SUDHA EMBROIDARY CORNER


71/2

71 NEARCHECKPOST KAMAXIPALYA MAGAD MAIN ROAD PIN CODE: 560079, STD CODE: NA ,
TEL NO: 23487970, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

982

SHAHEEN HAND EMBRIDER

NO80/2, 7TH B CROSS, ROSE GARDEN, NEELASANDRA, BANGALORE-47 PIN CODE: NA , STD
CODE: NA , TEL NO: 25717126, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

983

LIMRA EMBROIDARY WORKS

NO 176 SOUTH STREE NEELASANDRA BANGALORE PIN CODE: 560047, STD CODE: NA , TEL
NO: 57737818, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

984

OM SAI PRINTS

NO-23 R C SUBRAMNAM HULIMAVU B G ROAD BANGALORE PIN CODE: 560076, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

985

EHTHIYASAHMED

KHANBUILDINGKUSHALNAGARBANGALORE 45 ,
NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560045, STD CODE: NA , TEL

2001

10 - 50

986

K V MADHUSUDHAN NEW STAR


EMBROIDERY

A WEST OF CHORD ROAD RAJAJINAGAR BANGAL ORE PIN CODE: 560044, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

987

RAV

SUJATHA HAND EMBRIDARY NO 11 CHINNAMA RED DY 33 MAIN 2 CROSSDOLLERS BTM


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 55318958, FAX NO: NA, E-MAIL :
N.A.

2002

10 - 50

988

EMBRAIDARAY DESINER

NO I58, KORAMANGALA MAIN ROAD 4TH CROSS EIGHTH BLOCK, BANGALORE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

989

BENAKA EMBROIDARY

NO G B CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
56961372, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

990

***

2003

10 - 50

991

EMRAIDRING

NO 628 2ND B CROSS DURGA HOUSE JAYANAGAR 7TH BLOCK BANGALORE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

992

KANCHAN EMBRODERY 2081 3 A MAIN


ROAD

BRGUR ROAD BOMMANAHALL BANGALORE S6OO68 ,


NO: 25733959, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

PIN CODE: 560021, STD CODE: NA , TEL NO: 23120708, FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL

75

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2403

10 - 50

993

VASANT PRINTS

994

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

995

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

996

GOVINO RAJ

ROJA EXPORTS SRI RAMPURA GAREBAVIPALYA MA OPPOSITE CRYSTLE APPERTMEN


BOMMANHALL PIN CODE: 560068, STD CODE: NA , TEL NO: 51100758, FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

997

EMBROIDERY AND DYING SERVICES

MRHMISA M/S RAZIA MANZIL D NO 1347 KG HALLI BANGALORE PIN CODE: 560045, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

998

N N PRAKASH

COMPUTECH STICHES & FASHION 284/ GARWEBHA VIPALYA HOSUR ROAD BANGLORE 56OO68
PIN CODE: 560068, STD CODE: NA , TEL NO: 25731541, FAX NO: NA, E-MAIL : N.A.

2004

51 - 100

2002

10 - 50

NO-930/2 22CROSS KRISHNA BADAWANE HULIMAVU BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: 31815670, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 1725-Manufacture of blankets, shawls, carpets, rugs and other similar textile products by hand
999

HOME WEAVERS PRIVATE LIMITED

NO 1, ANDALAMMA MANSION 6TH MAIN LAYOUT R NAGAR BANGALORE 32 PIN CODE:


560032, STD CODE: NA , TEL NO: 23545889, FAX NO: 23545889, E-MAIL : N.A.

1000

SRI VENKATESHWARA BINDING WORKS

36/2 HANUMANTHAPURA BEHIND HAL BUS STOP ,


NO: 871, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560021, STD CODE: 23526, TEL

NA

101 - 500

NIC 2004 : 1729-Manufacture of other textiles n.e.c.


1001

CHAMUNDI EXTILES

NO2 2ND MAIN AGRAHARA DASARAHALL BANGALORE PIN CODE: NA , STD CODE: NA , TEL
NO: 23350938, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1002

M NAGENDRAPPA

NO 41 1S MAIN MARUTHINAGARA YELAHANKA BANGALORE PIN CODE: 560064, STD CODE:


NA , TEL NO: 28461184, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1003

RAVIKUMAR

NO 578 3 STAGE NEAR WATERTANK AVESWARANAGARA BANGALORE PIN CODE: 560079,


STD CODE: 080, TEL NO: 23224097, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1004

HEMROIDARY WORKS

N8 7CROSS H SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22230090, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

76

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2001

(5)
10 - 50

329 ANNAPPA REDDY BLOCK RAMAMURTHV NAGAR BANGALORE PIN CODE: 560016, STD
CODE: 0000, TEL NO: 5651236, FAX NO: 5654121, E-MAIL : N.A.

2002

10 - 50

MUKESH ASHAR

UNITED BUFF MANAGEMENT PVT LTD #139/1/2 S NAGAR BILEKAHALL BANGALORE PIN CODE:
560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1008

TRILLOKE GUDRA MULBERRY SILK


WISTING

UNIT NO 6 VENKE SWAMY LAYOUT KORAMANGALA BANGALORE PIN CODE: 560047, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1009

PATH SILK FACTRY NO 364

VENKET SWAMY REDDY LAY OUT KORAMANGALA VILLAGE BANGALORE GS PIN CODE:
560065, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1010

SARWANA AGARWAL NO 365

BALAJI SILK NO 24 VENKET SWAMY LAY OUT BANGALORE PIN CODE: 560095, STD CODE: NA
, TEL NO: 25744060, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1011

SERVESH REDOY SILK FACTRY

NO 365 VENKE SWAMY LAY OU 8 BLOCK KORAMANGALA BANGALORE 95 PIN CODE:


560095, STD CODE: NA , TEL NO: 25713722, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1012

KAMALAM HANDLOOMS PV LTD

OPP VIJAYAROLLINGMILL 4PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28397137, FAX NO: NA, E-MAIL : N.A.

2002

51 - 100

1013

MONAPPA B N

COTON WORLD 30/1 AMRUTHAHALLIBANGALORE PIN CODE: 560092, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1996

101 - 500

1014

BALASUBRAMANYAM

CREATIVE VEAR NO B0 BO BHIC BUILDING KDRAMANGALA 5THBLOCK BANGALORE 9S PIN


CODE: NA , STD CODE: NA , TEL NO: 25572135, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

1015

RANTITH

ZODIAC CLOTHING COMPANY LTD NO107/108 4TH CS 5 BLOCK KORAMANGALA BANGLORE


PIN CODE: 560095, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1016

TYRELEIRADINGFACTORY

KSSIDC KHB YELAHANKANEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2001

> 500

1994

10 - 50

1005

MAMPO EXPORTS

BESIDE RING ROAD NAGAVARA ARABIC COLLEGE POST BANGALORE PIN CODE: 560045, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1006

S M PHARAMACEUTICALS

1007

NIC 2004 : 1730-Manufacture of knitted and crocheted fabrics and articles


1017

3RDMAIN ROAD 2 CROSS

SHAMANNA NAGAR BANGALORE ZG ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560026, STD CODE: NA , TEL NO: NA ,

77

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

1018

NIRMALABATIGA

1019

***

1020

MANAGING DIRECTOR

(3)
FABRICATIONWORKS SUMANAHALLYMAINROAD BANGALORE 91 PIN CODE: 560091, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

SUBADRA TEXTILE P LTD MAGADI MAIN ROAD RAJAJINAGAR BANGALORE PIN CODE: 560079,
STD CODE: 080, TEL NO: 23300167, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NA

10 - 50

1990

101 - 500

1944

10 - 50

1955

10 - 50

1960

10 - 50

1973

10 - 50

NIC 2004 : 1810-Manufacture of wearing apparel, except fur apparel


1021

S U N B E E M, IS CROSS,

VIVEK NAGAR POST, BANGALORE ,


NO: NA, E-MAIL : N.A.

1022

HOOT LADIES NEAR

S MAIN ROAD CHAMARAJPE BANGALORE ,


26600007, FAX NO: NA, E-MAIL : N.A.

1023

NO34O RANGANATHCOLONY
MYSOREROAD BANGALOR

E26 ,

1024

CRATIW APALS GARMANTS

CAMSTRIL STREE BANGALDRE ,


FAX NO: NA, E-MAIL : N.A.

1025

AHMEDIA AGENCYS SADHIK AHAMED


SHARIEF

COTTON GARMENTS AHMEDTA AGENCYS NO G7 STH CROSS H SIDDAIAH ROAD BANGALORE


PIN CODE: 560027, STD CODE: NA , TEL NO: 22225608, FAX NO: 22236474, E-MAIL : N.A.

1980

10 - 50

1026

KRISHNAN

MGK INFLEX PRIVATE LIMITED NO 6 NAGASHE YHALLI BUS STOP BANGALORE PIN CODE:
560094, STD CODE: 00080, TEL NO: 23416612, FAX NO: 23511113, E-MAIL : N.A.

1982

10 - 50

1027

NANDAKUMAR

NO329 6THBLOCK RAJAJINAGAR PIN CODE: 560010, STD CODE: NA , TEL NO: 23381708, FAX
NO: NA, E-MAIL : N.A.

1986

10 - 50

1028

SHRINGAR FASHIONS

NO I CROSS MAIN EX SERVICEMEN COLONY DINNUR RT NAGAR PIN CODE: 560032, STD
CODE: 080, TEL NO: 23439410, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1029

ALBA EQUIPMENTS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 56982098, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

1030

DECCAN GRODPS

AZ DECCAN GROUPS UMKUR ROAD YESHAVATAPUR BANGALORE PIN CODE: 560022, STD
CODE: 080, TEL NO: 23375165, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

1031

PANDIAN MOTHERLAND LOUNDRY


GARMENTS

MAGADI MAIN ROAD BANGALORE 23 PIN CODE: 560023, STD CODE: 00080, TEL NO: 23209707,
FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

PIN CODE: 560047, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 560018, STD CODE: NA , TEL NO:

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560001, STD CODE: NA , TEL NO: 25589825,

78

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1032

ANKI GARMEN

NOGOI4 MTB ROAD AODRNAXISTCOLONY JCROAD BANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: 26703361, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1033

ASIAN EXPORT MR DEEPAK

107 WHEELERS ROAD COX TOWN BANGALORE 56005 PIN CODE: NA , STD CODE: NA , TEL NO:
51251221, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1034

M/S CU N PACK

59TH CROSS 4TH BLOCK RAJAJINAGAR BANGALOR E PIN CODE: 560010, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1035

CAMELLIA CLOTHING PRIVATE


GARMENTS LTD

64/3 L R BANDE MAIN ROAD KAVAL BYRASANDRA R NAGAR BANGALORE PIN CODE:
560032, STD CODE: NA , TEL NO: 23332809, FAX NO: 23336417, E-MAIL : N.A.

1991

10 - 50

1036

SHWETHA ENIERPRISES

FLOWER GARDEN OPPOSITE BHEL MYSORE ROAD BANGALOE PIN CODE: 560026, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1037

MARUTH GARMENTS

7 CROSS VRUSHABHAVATHINAGAR BANGALORE ,


NO: 23288121, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

1038

UNITY GARMENTS

NO 59/A CROSS ROAD 4TH N BLOCK RAJIJINAGAR BANGALORE PIN CODE: 560010, STD
CODE: 00080, TEL NO: 23125157, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1039

CNS TEXTILES

#2ND MAIN 2ND CROSS NEAR SHIVAGANGANELAYA NANGAPPA LAYOU ADUGONDI PIN
CODE: NA , STD CODE: NA , TEL NO: 22216390, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1040

BANU GARTEXTS

I0II BANUGATEXTS D BLOCK RAGHAVENDRA LAYO UT YESHAVANTPUR BANGALORE PIN


CODE: 560022, STD CODE: 080, TEL NO: 23377299, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1041

GOPAL BANGER

I/4 HCYOSS4 MAIN HONGASADRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
25736424, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1042

SHE TEMPLE

29O/7 8 D MAIN OPP ELEPHONE EXCHANGE 4 BLOCK JAYANAGAR BANGALORE PIN CODE:
560011, STD CODE: NA , TEL NO: 26554459, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1043

LEELA SCOTTISH LACE PV LTD EOU 11

NO 26/1A2 26/B2 8THMILE MYSORE ROAD BANGALORE 98 PIN CODE: 560098, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1044

SUPERO999

SAMPINGE ROAD NEAR HALL MANE MALLESHWERAM IBANGALORE 560003 PIN CODE: NA ,
STD CODE: NA , TEL NO: 23318221, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1045

NAGARAJ GARMENTS

42/1 4TH CROSS A D HALL BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

PIN CODE: 560079, STD CODE: 080, TEL

79

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1046

RAJU

LOLLY TOGS GARMENT MANUFACTURER EXPORTER NO 8 4 MAIN DOLLER SCHEME N


SPALYABANGALO PIN CODE: 000076, STD CODE: NA , TEL NO: 26686454, FAX NO:
96682387, E-MAIL : N.A.

1996

10 - 50

1047

REPUBLIC NTERNATIONAL

NO 64 7THCROSS BASHYAMNAGAR SR RAMPURAM BANGALORE PIN CODE: 560021, STD


CODE: NA , TEL NO: 23126654, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1048

KRISHNA REDDY

MEGHA TAILORING INSTITUTE GARUDACHARPALY B 48 PIN CODE: 560048, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1049

PRIYAGARMENTS

NO1ZOPANDTCOLONYVENKATESHNARAMAINROADBANG ALORE4S PIN CODE: 560045, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1050

JASMIN APARALS PRIVATE LIMITED

NO 14, 2 CROSS 8O FEET ROAD R M V 2 STAGE BANGALORE PIN CODE: 560094, STD CODE:
NA , TEL NO: 23411761, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1051

KUMARIOVERSEASPRIVATELIMITED

NO7/33RDCROSSPADARAYANAPURA BANGALORE 26 PIN CODE: 560026, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1052

SADANANDAIAA

SADANANDAIAH MARUTHI COMFLEX VRUSHABHAVA HINAGAR RAMAKSHIPALYA BANGALORE


PIN CODE: 79, STD CODE: NA , TEL NO: 98950653, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1053

SURYAPRAHASHREDDY MAYURISPICE
CORIDOR

NOI313SHREEF COMPLEX HOSUR-ROAD MADIVALA BANQALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1054

CLASSIC FASHIONS

NO9 BETWEEN TFBTHCROSS 5TH MAINROAD MALLESHNARAM BANGALORF PIN CODE:


560003, STD CODE: NA , TEL NO: 23567870, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1055

RAJEEXJUNJANVALA NOIZ IMAIN


2BLOCK GORA

GUNTE PALYA BANGALORE ZZ ,


NO: NA, E-MAIL : N.A.

1999

10 - 50

1056

VENKATESWARA GARMENTS

S7 A CROSS W N BLOCK RAJAJTNAGAR BANGALOR ,


TEL NO: 23125768, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1057

THENMOZHLI CHELLAPPA

NO 27 VIGNESHWARA ENTERPRISES B NO 5 STREET OLD MADRAS ROAD ULSOOR BANGALORE


PIN CODE: 560008, STD CODE: NA , TEL NO: 69979989, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

I25 5TH CROSS KALAJIPALYAM BANGOLRE 560002 PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

DVG ROAD BASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1058

1059

PAPRIKA WEAR

MEDIA JENI

PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 560010, STD CODE: NA ,

80

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1060

NO3I EXPOR TEXTILES 2NDCROSS

MARUTI NAGAR MADIVALA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1061

FLAIR FASHIONS GARMEN

ND 49SARJAPUR ROAD 1S CROSS JAKKASAND RA EXTENSION KORMANGALA BANGALORE


PIN CODE: 560034, STD CODE: NA , TEL NO: 25538482, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1062

BHAGAVATHI GARMENTS

NO 90/3 HONGASANDRA BEGUR ROAD BANGALORE 560008 PIN CODE: 560068, STD CODE: NA
, TEL NO: 57658061, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1063

AMRITHSAR SWADESH WOOLEM MILLS

AMRITHSAR SWADESH WOOLEN MILLSIGARMENT DIVISION G7 YESHWANTHPUR BANGALORE


5GOOZ2 PIN CODE: 560022, STD CODE: NA , TEL NO: 23370302, FAX NO: 23371124, E-MAIL :
N.A.

2000

10 - 50

1064

SHAREEF N H

GARMEN N0 5/1 7 CROSS H SIDDIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: 22271,
TEL NO: 345, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1065

SSPL

NO 51 1 CROSS RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO:
25323445, FAX NO: 25320829, E-MAIL : N.A.

2000

10 - 50

1066

SRI RAMA AND SONS G N NURSERY

6TH CROSS TAVAREKERE BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560029, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1067

MANJUNATHA GARMENT

MAIN ROAD CASIO LAYOU BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1068

RUBICON FASHION ACCESSORIES

NO19 2FLOOR 1CROSS 1BLOCK JAKKASANDRAEXT INDUSTRIALLAYOUT KORMANGALA


BANGALORE PIN CODE: 560034, STD CODE: NA , TEL NO: 25529525, FAX NO: NA, E-MAIL :
N.A.

2000

10 - 50

1069

NAGARAJRAO

325 7THMAIN RAOD 4TH B CROSS 6TH SECTOR HSR LAYOUT BANGALORE PIN CODE: 500034,
STD CODE: NA , TEL NO: 57610256, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1070

TEXWORLD EXPOR PRIVATE LIMIIED

#I65 2MAIN 3PHASE PEENYA RNOUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1071

LOTAL CLOTHING COMPANY

PETEEHANNAPPA INDUSTRIALIAREA KAMARSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23487488, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1072

KALYAN EXPORTS

NO10 11 AZIZ SHE INDUSTRIAL OWN NAYANDAHALLI MYSORE ROAD BANGALORE PIN
CODE: 560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

81

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2001

(5)
10 - 50

NO 43 AMSTRONG ROAD FIRS CROSS BANGALORE 1 PIN CODE: 560001, STD CODE: NA , TEL
NO: 25540888, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

844/832VRUSHABHAVATHINAGAR KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: 21484143, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

NO 5O2 MAIN ROAD 5 CROSS CHANNANARASIMH AYYA ESTATE KAREKAL KPALYA


BANGALORE 79 PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

SATISHBABU BANGALOREBABYWEAR
COMPHNY

PVT LTD HOSURROAD SINGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1078

SUPER MARKET WEAR HOUSE

224 OMKAR NAGAR BEHIND AGN KALVANAMANTAP ARAKERE GATE BANNERGHA A ROAD
BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: 51305656, FAX NO: NA, E-MAIL :
N.A.

2001

10 - 50

1079

MANAGER SHILPA LEATHER GARMENTS

NO 2O 5THCROSS PIPE LANE CHOLARAPALYA VIJAYA NAGAR BANGALORE PIN CODE:


560040, STD CODE: 080, TEL NO: 23108266, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1080

RAMESHRANGER A

#3955 BHADRAPPA INDISTRIAL ESTATE KAMBKS POLYS BANGALORE PIN CODE: 560079, STD
CODE: 9580, TEL NO: 23483764, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1081

BABU AN GARMEN FACTORY 4TH


CROSS

CHIKKA ADIGUDI BANGALORE 68 PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

2002

10 - 50

1082

VENUS GARMENTS

NAGARABHAV MAIN ROAD MOODALAPALYA BANGALORE 72 PIN CODE: 560072, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1083

GARMENTS ADWAN NO 33/1 2NDFLOOR

N9THCROSS H SIDDAIAH ROAD M KRISHNAPPA LAYOUT BANGLORE PIN CODE: 560027, STD
CODE: NA , TEL NO: 22272107, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1084

BHARGAVI GARMENTS

IOB 1S MAIN ROAD STH CROSS TAVAREKERE BA NGALORE PIN CODE: 560029, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1085

ARJUN GARMENTS FACTORY 5IH


CROSS

CHIKKA ADIGUDI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2004

10 - 50

1086

DEEPAK

NO 14 MUNI REDDY BUILDING 9 MAIN HONGASANDRA BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1073

KEVINANCHAN I4 DOMLUR 2ND STAGE

BANGALORE ,
E-MAIL : N.A.

1074

MANI KUMAR

1075

SUSHINE FASHIONS

1076

VIGNESHWARA GARMENTS

1077

PIN CODE: 560071, STD CODE: 91 80, TEL NO: 25356085, FAX NO: 25350082,

82

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1087

ANJANADR APERELES

N3RD F CROSS ROAD 8TH MAIN ROAD HEGGANAHALLI VISHWANEEDAM BANGALORE PIN
CODE: 560091, STD CODE: NA , TEL NO: 57680583, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1088

TJ APPARELS

N 5/1 2ND CROOS LALBAGHROAD BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1089

BHAGYAMMA

BEGUR MIAN ROAD HONGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
56993039, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1090

GARMEN FACTORY

BASAVANAGAR MAIN ROAD HOOD BANGALORE PIN CODE: 560048, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1091

NEW BHARATH GARMENTS

136 4TH CROSS NAGAPPA BLOCK BANGALORE 21 PIN CODE: 560021, STD CODE: NA , TEL
NO: 23420232, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1092

MR JITHU QARMENTS

5O16 NDISTRIAL SUBRUB YESWANTHPUR BANQALORE ZZ PIN CODE: 560022, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1093

GALCOND CASTING

GALCOND CASTINGS PRIVATE LIMITLD NDUSTR AL SUBURF VESHWANTHPUR BANGANORE 22


PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1094

MANAGER

G S CLOTHIG PV LTD SID PEENYAIDUSTRIALAR IA 1 STAGE PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1095

MANAGER

LAKK TEXS GARMENTS NO3 YASWANTAPURASUB TUMKURROAD BANGALORE PIN CODE:


560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1096

MANAGER

GOKULDAS GARMENTS NO3Z/ RING ROAD YASWAN APURA BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: 51272388, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1097

MANAGER

TEX FOUR GARMENTS NO154 NDUSTRIAL ARIA Y P R BANGALORE PIN CODE: 560022, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1098

MANAGER

DISANAR SUTS GGRMENTS NOI6/ATUMKUR ROAD Y P R SUB BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: 23741326, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1099

MANAGER

SHIVA READY MAID CENTER NO41 PEENYA INDUS TRIAL EASTE BANGALORE 560O58 PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1100

MANAGER

MAIN DRESTNG NOIG3 ISSFGE PEENYAIDUSTRIA RIA BANGGLORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28392111, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL

83

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1101

MANAGAR

BANGALORE CLATHIG HOUSE NOIZ IHSTAGE PEE NYA INDOSTRIAL ARIA BANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1102

MANAGER

APPEX TEXTILS NO223/3PEENYAINDUSTRIAL ARE A BANGALORE PIN CODE: 5600, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1103

MANAGER

SAP GARMEMTS 3CROSS MI2B/1 STAGE PEENYA NDUSTRIAL ESTATE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1104

MANAGER

PRATHIBA FASHIONS NO 265 VCROSS ISTAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN
CODE: 560055, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1105

MANAGER

DCLTA FASHION NOAI9O4THCROSSISTSTAGE PEENYA NDUSTRIAL TOWN BANGALORE


5GOOS8 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1106

WEAR WEL

5I BANGALORE ZNDUSTRIAL ESTATEI BANGALORE PIN CODE: 560021, STD CODE: NA , TEL
NO: 23120698, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1107

WEAR WEL

#5 BANGALORE CO-OP INDUSTRIAL ESTATE OKALIPURAM BANGALORE PIN CODE: 560021,


STD CODE: NA , TEL NO: 23120698, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1108

***

NA

10 - 50

1109

MR GUTAM CARLO HE UNLIMITED

N3FLOOR KOMAL MENSION MINERVA CIRCLE BANGALORE PIN CODE: 560002, STD CODE:
00080, TEL NO: 51323090, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1110

QARMENTS

8 CROSS H SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
51248954, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1111

GARMENTS

Z 8CRDSS H SIDDAIAH RDAD BANGALDRE PIN CODE: 560027, STD CODE: NA , TEL NO:
51141181, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1112

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1113

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1114

MADHURA GARMENTS

GRAN ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

1115

S A VICTAL RAO GARMENTS

# I0, 6TH STREET, MARKHAM ROAD CROSS BANGALORE PIN CODE: 560025, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

84

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

1116

BANGALORE GOKULDAS GARMENTS

1117

***

1118

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

KAATHIK GARMENTS

3O CROSS BAGALORE LAYOUT PILLANNA GARDEN BANGALORE PIN CODE: 560045, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1119

PRADEEP GARMENTS

KADUGONDANAHALLI BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

1120

SANCHITA FABRICKS

RMV 2STAGE BANGALORE ,


NO: NA, E-MAIL : N.A.

NA

10 - 50

1121

PREEMIER LIGHTING

87A KAMAKSHIPALYA BANGALORE ,


NA, E-MAIL : N.A.

NA

10 - 50

1122

SARF NTERNATIONAL GARMENTS

1ST FLOOR NO 17 4TH CROSS KALASIPALYAM NEW EXTENSION BANGALORE PIN CODE:
560002, STD CODE: 00080, TEL NO: 51241800, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1123

BRAHMAPPA

DIVYASHREE GARMENTS NO 56O NAGENDRA BLOCK BSK STAGE BANGALORE 50 PIN CODE:
560050, STD CODE: NA , TEL NO: 26728816, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1124

SRI SR REPROGRAPHICS

# 27 MAIN 7 BLOCK 4 PHASE BSK 3 STAGE BANGALORE PIN CODE: 560085, STD CODE: 080,
TEL NO: 26699835, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1125

SRI SRINIVASA GARMENTS AND


ENTERPRISES

A G RLOCK BSR 3 STAGE A PHASE BANGAGORE PIN CODE: 560085, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1126

***

NA

10 - 50

1127

GARNAMANTS FACTORY MAIN


CHIKKAADUGOD

MAIN RDAD BANGALORE SOUTH BANGALORE PIN CODE: 560029, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1128

GARNAMENTS ST MAIN CHIKKA


ADUGODI

THAVAREKERE MAIN ROAD BANGALORE SOUTH BANGALORE PIN CODE: 560029, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1129

GARNAMENTS FACTARV 1ST MAIN


CHKKAAOUGDDI

THAUAREKERE MAIN ROAD BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1130

***

NA

10 - 50

DOOR NO9 MLSSION ROAD SR NAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: 560094, STD CODE: NA , TEL NO: 23416123, FAX

PIN CODE: 79, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560024, STD CODE: NA , TEL NO: NA

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

85

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

1131

LOKESH SRI SHAILA WEIGHERS 47O/I2


CROSS

1132

***

1133

***

1134

***

1135

SAPTHAGIRI CLOTHING OBALAREDDY


BUILDING

1136

N0420/2OASLMFACTURY MYSOREROAD
BAGALORE26

1137

BOBBY

1138

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

1905

51 - 100

VINAYAKA GARMENT BLOW UP FASHION P LTD UNITIV NO.37 FLOOR 2MAIN RCPURAM BLORE
PIN CODE: 560021, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1970

51 - 100

JYOTHI BALAKRISHNA GARMENTS

LAKSHM EMBROIDARY NO28 I0IH MAIN ROAD 4TH CROSS CHALUVAPPA GARDEN BANGALORE
PIN CODE: 560023, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1972

51 - 100

1139

ST MARIS ENGLISH SCHOOL

DASARA HALLY BANGALORE ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

1982

51 - 100

1140

NITHYA CLOTHING

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALOLE PIN CODE: 560079, STD


CODE: 94, TEL NO: 48224621, FAX NO: NA, E-MAIL : N.A.

1993

51 - 100

1141

TBEME APPARELSINDIA PV LTD

49IJAKKASANDRA KORAMANGALA 1ST BLICK OFF SAJAPUR ROAD BANGALORE NDIA PIN
CODE: 560034, STD CODE: NA , TEL NO: NA , FAX NO: 51309714, E-MAIL : N.A.

1993

51 - 100

1142

SRIKANTAIAH C

NOII32 11THCROSS NAGPURA BANGALORE PIN CODE: 560010, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1994

51 - 100

1143

TIRUPATH ENTARPRISES

B G N COMPLEX 4THCROSS 4THMAIN JAIBHIMA NAGAR BANGALORE PIN CODE: 560029, STD
CODE: 6600, TEL NO: 26681646, FAX NO: NA, E-MAIL : N.A.

1994

51 - 100

1144

SUNDARRAJ

SUNDARRAJ FLDOR MARUTHICOMPLEX GOV SCH OOL OPP KAMAKSHIPALYA BANGALORE


PIN CODE: 79, STD CODE: NA , TEL NO: 23482184, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

1145

MAXWELL INDUSTRIES LIMITED

NO 196 4TH MAIN ROAD 3RD BLOCK 3RD STAGE BASAWESHWARNAGAR PIN CODE: 560079,
STD CODE: NA , TEL NO: 23231718, FAX NO: 323327, E-MAIL : N.A.

1998

51 - 100

4THPHASE PEENYA INDUSTRIAL AREA BANGALORE SB PIN CODE: 580056, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

DODDANEKUNDI NDUSTRIAL AREA MAHADEVAPURA POS BANGALORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: 560026, STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

86

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1146

J K GARMENTS

S9 A CROSS N BLOCK RAJAJLNAGAR BANGALOR ,


TEL NO: 23126314, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560010, STD CODE: NA ,

1998

51 - 100

1147

RAMA CHANDRA EXPOR GARMENTS


NO37

IST FLORE 9TH CROSS H STDDATAH RAOD M KRISHNAPPA LAYOU BANGLORE PIN CODE:
560027, STD CODE: NA , TEL NO: 22233008, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

1148

PRAKASHJAIN

SHIVAFORM MAGADI MAIN ROAD KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD
CODE: 9580, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

1149

ASHISHMUKRJI EXTRAN NO 9O HOSUR


ROAD

MADIVALA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1999

51 - 100

1150

***

DIRECTION GARMENTS 8BLOCK KORAMANGALA BANGALORF PIN CODE: 500095, STD CODE:
NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

1151

VINESHAGARWAL

STRANDS INTERNAPIONAL NO194/2 N S PALYA BANNERGHATTAROAD BANGALORE PIN CODE:


560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

1152

PURUSIMA

PURUSIGD NSPECTION CENTRE 5 CROSS OPP ME 1 RAGHAVENDRA LAYOUT Y P R BANGALORE


PIN CODE: 560022, STD CODE: 08101, TEL NO: 23379714, FAX NO: NA, E-MAIL : N.A.

2005

51 - 100

1153

MR RAGHUNNTH SKYHIGHPASTION

NO49/1INDUSTRIAL BUBRUB MEC ROAD YESWANTHPUR BANGALORE PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1154

MR RAGHUNATH LEATHER GARMENTS

NO49 5 NDUSTRIAL SUBRUB YESWANTHPUR BANGALORE 22 PIN CODE: 560022, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1155

MANAGER

IMPEX GARMENTC NO32 RINGROAD YASWANTHAPUR SUB BANGALORE 56OO22 PIN CODE:
560022, STD CODE: NA , TEL NO: 51272387, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1156

MANAGER

SANSHA GARMENTS N0I2O VAMAIN 9EENYAIDVSTR IAL ARLA EANGAZORE PIN CODE:
560058, STD CODE: NA , TEL NO: 51170610, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1157

NO 10 NEWAGE APPARELS PRIVATE


LIMITED

FIRS A MAIN ROAD BANGALORE PIN CODE: 560045, STD CODE: NA , TEL NO: 25480916, FAX
NO: NA, E-MAIL : N.A.

NA

51 - 100

1158

AUTHENTIUITY

D-C-O2 BRIGADE MM KRROAD BANGALORE ,


26767218, FAX NO: 26762403, E-MAIL : N.A.

PIN CODE: 560070, STD CODE: 91180, TEL NO:

NA

51 - 100

1159

3SGARMEN NOIG7IGB AVAREKERE BUS


STOP

TAYBHEEMANAGARMAINROAD BTMISTSTAGF BANGALORESGO079 PIN CODE: NA , STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

87

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

1160

***

1161

SONALGARMENTS

1162

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

51 - 100

NO79INDUSTRIALSUBRUBSECONDSTAGETUMKURROAD BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1976

101 - 500

GARTEX NSTRA APPARELES

NO I7 59TH CROSS MTH BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

101 - 500

1163

MADURA COATS JNDIA NO 85 OLD


MADRAS ROAD

DOORVANINAGAR BANGALORE ,
NO: NA, E-MAIL : N.A.

1982

101 - 500

1164

GARDEN CITY FASHAN PRTVATE


LIMITED

GARDEN CITY FASHAN PRTVATE LIMITED N84 YESHAWANTH PURA BANGALORE 22 PIN CODE:
560022, STD CODE: NA , TEL NO: 51535180, FAX NO: 51535174, E-MAIL : N.A.

1983

101 - 500

1165

DHATRICREATIONS

O6 UNI 2 B CROSS KAMAKSHIPALYA BANGALORE ,


TEL NO: 55328883, FAX NO: NA, E-MAIL : N.A.

1989

101 - 500

1166

***

HIGHIHAGES PEENY 2STAGE BANGALORE PIN CODE: 560022, STD CODE: NA , TEL NO:
23378221, FAX NO: NA, E-MAIL : N.A.

1992

101 - 500

1167

JD CLOTHING COMPANY

JD CLOTHING COMPANY N 9 RAJAJINAGAR INDUSTRIAL SUBURB BANGALORE 22 PIN CODE:


NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1168

TEX PORT OVERSES

I03/ 1 NDUSTRIAL SUBURB N 2 STAGE YESHWANTHPUR BANGALORE PIN CODE: 560022, STD
CODE: NA , TEL NO: 23576556, FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1169

MITTAL CLOTHING CO

IOZ THIROCROSS 3 MAIN Z STAGE JNOUSTRIAL SABURB YESHWANTHPUR BANGALORE PIN


CODE: 560022, STD CODE: NA , TEL NO: 23370286, FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1170

OKULDASENPORTS

NO SFIRSTCROSSMISSIONROAD NGACORE ,
NA , FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1171

YAMINI NTERIORS PRIVATE LIMITED

NO 92 1S MAIN JAKKASANDRA EXTENSION 1ST BLOCK KORAMANGALA BANGALORE PIN


CODE: 560034, STD CODE: NA , TEL NO: 25523762, FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

1172

INDUS INPOVEK PRIVATE LIMITED

9O 91 7MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

1173

INTER NATIONAL EXTIE CORPORATION

INTER NATIDNAL EX ILE CORPORATION SSV C OMPLEX RAGAAVENDRA LAYOU YPR


BANGALDRE PIN CODE: 560022, STD CODE: 080, TEL NO: 22973435, FAX NO: NA, E-MAIL : N.A.

1997

101 - 500

PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 560079, STD CODE: NA ,

PIN CODE: 560027, STD CODE: NA , TEL NO:

88

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1997

(5)
101 - 500

NO 4O/2 CHOLUR PALYA MAGAD ROAD BANGALORE PIN CODE: 560023, STD CODE: NA , TEL
NO: 23101555, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

IMYANUAL CRCATIONS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23588550, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

1177

MUKKESH MJTHAN

5ISPHASE PEENUA INDUSTRIAL AREA JALBHBLL SM ROAD BBNGALORE PIN CODE: 560058,
STD CODE: 080, TEL NO: 23721105, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

1178

MOHAN REDPY GOKULAN GARAMENTC

K H B COLONY 3RD CROSS 3RD BLOCK KORAMANGALA BANGALORE 95 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

1179

DYNO FASTI0NS

SG A CROSS W N BLOCK RAJAJINAGAR BANGALOR ,


TEL NO: 23121002, FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

1180

***

GARMEN SHOPH CAMBREEZ ROAD ULSOOR BANGALORE PIN CODE: 560008, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

1181

BAGARAJA GARMENTS 45/13

GARMENTS 45/I3 STFLOORINDUSTRIAL SUBURB IUMKUR ROAD BANGALORE 22 PIN CODE:


560022, STD CODE: NA , TEL NO: 51276096, FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

1182

GARMENTS HOUSE OF INDIA

59 A CROSS 4TH BLOCK RAJAJINAGAR BANGALOR E PIN CODE: 560010, STD CODE: NA , TEL
NO: 23121302, FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

1183

S G RAGHU NO 50/1 SELCO TOWERS


3RD MAIN

1ST CROSS UNITEX APPAREL PVT LTD MANASA N AGAR NAGARBHAV POST NAGARBHAV
BANGALORE PIN CODE: 560072, STD CODE: NA , TEL NO: 23213212, FAX NO: NA, E-MAIL :
N.A.

2002

101 - 500

1184

SNEHA CREATIONS GARMENTS

RAMBNCOLEEGE NEAR ROBD M GBD M N R J K MAKSHEPA BA GALORE PIN CODE:


560079, STD CODE: 9580, TEL NO: 23289925, FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1185

INDUS TEXTILES

INDUS TEXTILES DIVYA PLAZA PAGHAVENDRA LA YOUT YESHAVATAPUR BANGALORE PIN


CODE: 560022, STD CODE: NA , TEL NO: 22973433, FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1186

SUNETHRA GARMENTS

951 3 MALAGALU MAIN ROAD 24TH CROSS NAGARABHAV 2ND STAGE BANGALORE PIN
CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1187

SPAN GLOBAL PRIVATE LIMITED

#97-98 8MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

1174

INDUS GARMEN P LTD

INDUS GARMEN P LTD SUNDAR MANSTION RAGHA VENDRA LAYOU YESHAVANTPUR


BANGALORE PIN CODE: 560022, STD CODE: 080, TEL NO: 23571181, FAX NO: NA, E-MAIL :
N.A.

1175

KUMAR DATR CREATION GORMEN 4


MAIN ROAD

1176

PIN CODE: 560010, STD CODE: NA ,

89

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1188

JAGADEESH H BHOIWANI

NO 7 5TH CROSS SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
56519403, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1189

CORENCO

CORENCO 3 CROSS RAGAVENDRA LAYOU YESHAVA NTPUR BANGALORE PIN CODE: 560022,
STD CODE: 080, TEL NO: 25355967, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1190

RAJAN

MADHURA GARMENTS NO 110 5TH BLOCK 4TH CROSS KORAMANGALA BANGALORE 95 PIN
CODE: 111111, STD CODE: NA , TEL NO: 11111111, FAX NO: 111, E-MAIL : N.A.

2004

101 - 500

1191

S L V APPARELS

N169 H M LAYOU NELLAGADARANAHALLI ROAD NAGASANDRA POS BANGALORE PIN


CODE: 560073, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1192

GARDEN CITY FASION PRIVATE LIMITED

GSIZB MAHALAKSHMIPURUM NDUSTRIAL SUBURB YESHWANTHPUR BANGALORE SGOOZZ


PIN CODE: 560022, STD CODE: NA , TEL NO: 51232527, FAX NO: NA, E-MAIL : N.A.

2005

101 - 500

1193

VLNI EXPORIS

SG A CROSS N N BLOCK RAJPJINAGAR BANGALOR ,


TEL NO: 23121452, FAX NO: NA, E-MAIL : N.A.

2005

101 - 500

1194

MR BALU GARMENTS

NO 42/2I NDUSTRIAL SUBRUB YESWANTHPUR BANGALORE ZZ PIN CODE: NA , STD CODE: NA


, TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1195

MR MANJUUA KARLE EXPORTS


GARMENTSI

AOVARDHAN THEATRE INDUSTRIAL SUBRUB YESWANTHPUR BANGALOREI PIN CODE: 560022,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1196

MR ABDULKADHIRSAM APPREALS
GARMENTS

NOAQINDUSTRIAL SUBRUB MEC ROAD YESWANTHPUR BANGALORE 22 PIN CODE: 560022,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1197

MANAGER

UNIKRIYESHANS GARMENTS NOG OUSTRIALARIA 4TMAIN Y P R BANGALORE PIN CODE:


500022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1198

MANAGER

MUKAMBIKA TEXTILS NO51C 5CRDSS STSTAGE PEENYAINUSTRIALAREA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1199

GARMENTS FACTORY

N0I335 11 CROSS 7TH MAIN 2ND STAGE WESTO FCHORDROAD MAHALAKSHMIPURAM


BANGALORE PIN CODE: 560086, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1200

PARAMODH R KAMATH POOJA V KAMATH

I2I0/I0 12 MAIN ROAD PAKASHNAGAR BANGALORE PIN CODE: 560021, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1201

WEAR WEL

5-BANGALORE CO-OP INDUSTRIAL ESTATE OKALIPURAM BANGALORE PIN CODE: 560021,


STD CODE: 23120, TEL NO: 698, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

PIN CODE: 560010, STD CODE: NA ,

90

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(2)

(3)

(4)

Employment
Class

(5)

1202

JAYATHEERTH

NO138 N S PALYA BANNERGHATTAROAD BANGALOR E 76 PIN CODE: 560076, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1203

INDIAN DESIGN GARMENTS

KADUGONDANAHALLI BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

101 - 500

1204

RADHAKBISHNA

#7 SM ROAD JALAHALLI WES BANGALORE ,


51172771, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1205

***

NA

101 - 500

1206

ANURAGAGARWAL NO63/3

ANNAPURNESWESHRAVA BUILOINNG 6THCROSS MAIN GARVEBAVEPLAYABANGALORE 68


PIN CODE: NA , STD CODE: NA , TEL NO: 26736753, FAX NO: 25730450, E-MAIL : N.A.

NA

101 - 500

1207

JASK EXPORTS KUNDHALAHALL MAIN


ROAD

DODDANEKUNDI NDUSTRIAL AREA MAHADEVAPURA POS BANGALORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1208

HANUMBN HOUSE

10B IPHASE PEENYA INDUSTRIBL AREA PEENYA BBNGALORE PIN CODE: 560058, STD CODE:
080, TEL NO: 51366600, FAX NO: NA, E-MAIL : N.A.

1975

> 500

1209

BALAJIFJNISHINGHOUSE

NO6OFIRSTMAINLNDUSTRIALSUBRUBTUMKURROAD BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1983

> 500

1210

GAYATHRIY S

GOKALDASIMAGES PVTLTD 78I2INDUSTRIALSUBUB


2NDSTAGEYESHWANIHPURIUMKARROADBANGALORE PIN CODE: 560022, STD CODE: 9180,
TEL NO: 3377059, FAX NO: 3377066, E-MAIL : N.A.

1990

> 500

1211

INDUSTRIAL SUBURB

I8I33 TUMUKUR ROAD YESHWANTHPUR BANGALORE PIN CODE: 560022, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

> 500

1212

GOKULDAS

BHUVANESHWAR NAGAR, RTNAGAR BANGALORE 32 PIN CODE: 560032, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

> 500

1213

GOYANKA C S INDIA LTD GARMENTS

NOII/1 14 CROSS BANGALORE-TQ PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1998

> 500

1214

CHANDRAKUMAR

NO I823 PEENYA PHASS NDUSTRIAL AREA BANGALORE


STD CODE: 080, TEL NO: 28398625, FAX NO: NA, E-MAIL : N.A.

2001

> 500

1215

SPAN GLOBAL PRIVATE LIMITED

HGT/6 SPAN GCOBAL PRIVATE LIMITED VINAY MANSION INDUSTRIAL SUBURB BANGACORE-22
PIN CODE: 560022, STD CODE: NA , TEL NO: 51283126, FAX NO: NA, E-MAIL : N.A.

2003

> 500

PIN CODE: 560058, STD CODE: 080, TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

91

U PIN CODE: 560058,

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

1216

MR RAV K NENON GARMENTS

1217

***

1218

# 78 BEHIND LIDKAR QUATERS

(3)

(4)

NO AG INDUSTRIAL SUBRUB YESWANTHPUR BANGALORE ZZ PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

Year of start of
Operation

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

K G HALL HIDAYATH NAGAR KOHINOOR GARMEN BANGALORE PIN CODE: 560045, STD CODE:
00080, TEL NO: 25473651, FAX NO: 25473650, E-MAIL : N.A.

Employment
Class

(5)

NA

> 500

NA

> 500

NA

> 500

NIC 2004 : 1820-Dressing and dyeing of fur; manufacture of articles of fur


1219

NAZERAHAMAD

SCOTTSGARMENTSPLIMITED PEENYA2STAGE HEGGA NAHALLIMAINROAD BANGALORE PIN


CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

1220

CHANARA SHAKARA

G B 5 GARAMENTS 6THCROSS 5 MA1N ROAD BOMMANHALLJ BANGALORE PIN CODE: NA ,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

1221

GOKALDAS WEIL PV LTD

NOIZS ROOPENAAGRAHARA MADIWALA BANGALORE PIN CODE: 560068, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1222

BOMBAY RAYAN FASHON

NO ZBS 1 S CJOSS 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 51273020, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1223

FABCARAGARAMENTS EASTFILED
SECURETEY

NO 29 ROPENA AGAHARA NGR LAYOU MADIVALA POS PIN CODE: NA , STD CODE: NA , TEL
NO: 5735973, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1224

ARYN CLATHING FACTORY

HESARAGA A MAIN ROAD NO 27/2 DASARAHALL BNAGALORE 57 PIN CODE: 560057, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1225

SYSTEMATICEXPORT NO7
NAGASANDRAPOS

TUMKUR ROAD BANGALORE ,


NO: NA, E-MAIL : N.A.

PIN CODE: 560073, STD CODE: NA , TEL NO: 28377765, FAX

1992

10 - 50

1226

UNNIKRISHNA

209/43FLOOR SC ROAD SESHADARIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

1227

SHAH EXPORTS HOUSE

2NDMAIN RAJIVGANDHINAGAR HOSUR MAIN ROAD BOMMANAHALLI BANGALORE PIN CODE:


560068, STD CODE: NA , TEL NO: 25729968, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

1228

SANTHOSH KEYAINTERNATIONAL
BEGURHOBL

SINGASANDRA FABRITEXEXPORT PVT LTD BANGALORE PIN CODE: 560068, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

92

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1997

(5)
10 - 50

S M TNTERNATIONAL 283 A M INDUSTRIAL AREA KUDUU GATE HOSUR ROAD


BANGALORE56OO68 PIN CODE: 560068, STD CODE: NA , TEL NO: 51315564, FAX NO: NA,
E-MAIL : N.A.

1997

10 - 50

BALAKRISHNAN

RAVIKA CREATIONS62/4BEGUR ROAD BOMMANAHAL LI BANGALORE 5GOO68 PIN CODE: NA ,


STD CODE: NA , TEL NO: 25732903, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1232

VANU KUMARA BMP GARAMENTS

N M R LAYOUT ROPANA AGARA BOMMANHALL BANGALORE 65 PIN CODE: 65, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1233

SOAS APPARELS PRIVATE LIMITED


MAIN HOSU

R ROAD MUNISWAMY NDUSTRIAL LAYOUT HONGAS ANDRA VILLAGE BEGUR HOBL


BANGALORE 58 PIN CODE: 560068, STD CODE: NA , TEL NO: 25737032, FAX NO: 51115669,
E-MAIL : N.A.

1998

10 - 50

1234

COTTON BOX MANFACTURER


GHARUEBHAVIPALYA

HOSUR ROAD BANGALORE-68 ,


E-MAIL : N.A.

1999

10 - 50

1235

BALAJI GARMENTS

IO CROSS HONGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1236

ARUNODAYA BOOKS MANUFACTURE


YELLAKUNTE OL

D MANGAMMAPALYA ROAD BOMNANAHALL BANGALO RE 68 PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1237

KALEEM

SHREE MANUFACTHURING BEGUR CROSS ROAD BOMMHNHHALLI BANGALORE PIN CODE:


560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1238

SHWETHA GRAVURES

NO23O4/3O85 KO IGEPALYA BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1239

AMEERPRADHAN SIMPLICITY
CLOTHIERS TO HE

WORLD PLOT NO 223 SINGASANDRA HOSUR MAIN ROAD BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: 25730323, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1240

DHARSHAN NC

3 CROSS RCROAD RAJIVGAND NAGAR BOMMANAHALLI BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1241

MANUFACTURES OF EXPORT
READYMADE GARMENTS

224 2NDFLOOR CANARA BANK BUILDING ARAKERE GATE BANNERGHA A ROAD BANGALORE
PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1229

MAHENDRA DYE CHEM

KH RANGANATH COLONY DG HALLI MYSORE RUAD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1230

MUNISN GUPTA

1231

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

93

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2002

(5)
10 - 50

RAMASWAMYREDDY NEW COMPLEX 1 FLOOR BEGUR MAINROAD BOMMANAHALL


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 22721288, FAX NO: NA, E-MAIL :
N.A.

2002

10 - 50

SWEBROS NO G

BEGUR ROAD BOMMANAHALLL BANGALORE GZ PIN CODE: NA , STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1245

K MOHHN

ANDCOMPANY PRIVATE LIMITED B1 G2SBEGURRH D P CROSS BOMMBNAHALLI PIN CODE: NA ,


STD CODE: 1, TEL NO: 21573600, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1246

GURURAJ NOI2A
ALANKARENTERPRISES EXPOR

GARMENTS PROCESSORS BELMARESTATE NAGASAND RA POS BANGALORE PIN CODE:


560073, STD CODE: NA , TEL NO: 23729043, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1247

EVERGREEN GARMENTS GOPALREDDY


BUILDING

OPPGOVERNMENTPRIMARYSCHOOL SOMASUNDRAPALY A AGARAPOS BANGALORE 560O34


PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1248

PRAKASH JAIN

APRIL GARMENTS GARVEBHAVI PALYA HOSUR ROAD BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1249

GOPAL REDDY NEAR BUS STOP

GARVEBHAVIPALYA HOSUR MAIN ROAD BAGA BANGALORE PIN CODE: 560008, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1250

MR CHOUDHARI

VEENAFIRMEN14 5BEGURROADBOMMANAHALLI BANGALORE68 PIN CODE: 560068, STD CODE:


25732, TEL NO: 703, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1251

D SVFAN SHAA E COMPANY

NOTNOS7/37CROSS KRISHNAPPA REDDY LAYOU BOMMANAHALLI BANGALORE PIN CODE:


560068, STD CODE: 56969, TEL NO: 944, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1252

C RAGU

SRI MANJUNATHA APARELLS BEGURROADCROSS VIRATNAGAR BOMMANAHALLI PIN CODE:


NA , STD CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

2004

10 - 50

1253

GARMENTS FACTORY NOI647 7CROSS


RASHADNAGA

R BANGAIORE 45 C BIOCK C ,
NA, E-MAIL : N.A.

PIN CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO:

2004

10 - 50

1254

ARVIND MILLS LIMITED

SURVEY 26/2 27/2 KENCHANAHALLI PO MYSORE ROAD BANGALORE 560098 NDIA PIN CODE:
560098, STD CODE: NA , TEL NO: NA , FAX NO: 28602618, E-MAIL : N.A.

2004

10 - 50

1255

PUROHZTH

SHRRE GBRMRNTS BEGUR ROAO BOMMANAHALLI BANGALORE 56OO68 PIN CODE: NA , STD
CODE: NA , TEL NO: 57719033, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1242

BOX MANPACTURER
GHAZUEBHAVIPALYA HOSUR

ROAD BANGALORE 68 ,
N.A.

1243

S KRISHNAPPAIAH

1244

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

94

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2005

10 - 50

1256

RAMAMURTHI NEW BUILDING PU


ANAHALLI ROAD

KAMAKSHAMMA LAY OU YELAHANKA BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28460958, FAX NO: NA, E-MAIL : N.A.

1257

MAASAI B39\1

MRRILOMPLEX24MAINHSRLAYOUTSECTOR BANGALDRE PIN CODE: 560034, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

S K QARMENES HJSURMAATU ROAD GARVE6HAV PALYA BANGALORE PIN CODE: 560068,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1258

BALAJE SHARMA

1259

SREE GANESH PRACTECT APPERALS


NO 40 SREE

NAND BUILDING GARVBAVIPALYA HOSUR MAIN ROAD BANGALORE PIN CODE: 560068, STD
CODE: 080, TEL NO: 51315545, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1260

WEL CRAF NO 3I2/26 MAIN ROAD


BEGUR

VIRA NAGAR BOMMANAHALLI BANGALORE GR PIN CODE: NA , STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1261

AMAY CREATIONS

D NO 56/1 PU ENAHALLI J P NAGAR POST BANGALORE PIN CODE: 560078, STD CODE: 080,
TEL NO: 26654222, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1262

ANEX GARMENTS

N 1524 SA SAHAKARANAGAR POST BANGALORE PIN CODE: 560092, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1263

SRI C A RADHAKRISHNA NO 112/44

FAILLANE FASHION PVT LTD 3RD CROSS 7TH MAIN BHUVANESHWARINAGAR BANGALORE PIN
CODE: 560057, STD CODE: 00080, TEL NO: 57707449, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1264

NISHA DESIGNNS NO 485 S 4 PHASE

PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28363119, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1265

GARDEN CITY FASHIONS

NO 356 9 CROSS 4 MAIN PEENYA NDUSTRIAL ARE BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 51535785, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1266

GREXS EXIMIND477 B 4PHASE PEENYA


NDUSTR

AL AREA BANGGLORE PIN CODE: 560058, STD CODE: NA , TEL NO: 51179126, FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

1267

TEXPOR INDUSTRIES LIMITED

NO 477 D 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1268

FIBERS AND FABRICS NTERNATIONALS

48S 2 PHASE 13 CROSS PEENXA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1269

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

95

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

1270

***

1271

PRADEEPBANSALI

1272

DISTRICT : Bangalore

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

JOBWORK GARMEN MAGADI MAIN ROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

SALEEMAHMED

SALEEMFASION MAGADIMAINROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA


, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1273

PRAKASHA

PANTHARAPALYA NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE: 560039, STD


CODE: NA , TEL NO: 28604648, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1274

LAXM SWTERPRISE

NO 12 CHUNCHAGHA ROAD YALACHEWAHALIF JIP NAGAR BANGALORE PIN CODE: 560078,


STD CODE: NA , TEL NO: 26651845, FAX NO: NA, E-MAIL : N.A.

1915

51 - 100

1275

MYSORE APPAQEL COMPANY

NO 296 297 PEENYA INDUSTRIAL QQAAN AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 51512068, FAX NO: 51512068, E-MAIL : N.A.

1995

51 - 100

1276

GOWTHAM CHAND MAHALAKSHM INC


NO 8

NO B YELLAKUNTE OLD MANGAMANAPALYA ROAD BOMMANAHALLI B 68 PIN CODE: 560068,


STD CODE: NA , TEL NO: 25736170, FAX NO: 25736174, E-MAIL : N.A.

1996

51 - 100

1277

RAY CHEMICALS P V L D

NO 20 K H B KSSIDC Y N K NEWTOWN BANGALORE PIN CODE: 560054, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

1278

JEETHUSINGH WASHING GARMETS


PRESSING

MYSORE RDAD ,

2001

51 - 100

1279

A C POOR

SACHIKTEXTILESPVTLTDNOI9BEGURROAD BOMMANAHALLIINDUSTRIESAREABANGMLORE68
PIN CODE: 560068, STD CODE: 57324, TEL NO: 85, FAX NO: 810, E-MAIL : N.A.

2002

51 - 100

1280

SRI SATHYA PRASAD

INSTXLEGARMENTSEXPORTS22 4 MAINBEGURROAD BOMMANAHALLI BANGALORE 68 PIN


CODE: 560068, STD CODE: 25732, TEL NO: 096, FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

1281

R MADURAMANDLU

MANUFACTUREDFREADYMADEGARMENTS 240AI0GISTCROSSNGRLAYOUIROOPENAAGRAHARA
PIN CODE: 560068, STD CODE: 57358, TEL NO: 25, FAX NO: 16, E-MAIL : N.A.

NA

51 - 100

1282

***

NA

51 - 100

1283

SREE SAI NTERNATIONALS

NO 392 1 4 PHASE 1D CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 51272806, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1284

TEXPOR RARMENTS

NO 46O 4 PHASE PEENYATNDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

96

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1285

PARMESH N

P N GARMENTS VISWANEEDAM POS SUNKADAKATTE BANGALORE PIN CODE: 560091, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1286

GOPAL BENGER DENIMO WORKSHOP


INDIA PRAVE

LEMITED APPOSITE SRINIVASA KALAYAAMANT AP 2 MAIN ROAD BEGUR MAIN ROAD


HONGASANDR PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

1287

FASHION MATRIX OVERSEAS

284 PEENYA INDUSTRIAL AREA BANGALORE 56OO58 PIN CODE: 560058, STD CODE: NA , TEL
NO: 51177798, FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

1288

RAMESH KUMARA

INSWIMGER NO46 ROPENA AUAHERE MADIVAL BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

101 - 500

1289

ANIL EXPORTS NC

NO77 78 ANJANAYALU PLAZA OLD MANGAMMAPALY A ROAD BOMMANAHALL BANGALORE


68 PIN CODE: NA , STD CODE: NA , TEL NO: 25731962, FAX NO: 25735547, E-MAIL : N.A.

1994

101 - 500

1290

SHAH EXPORT HOUSE

NO38 4-B 38/4HUNGASANDRA VILLAGE BEGUR HOBL HOSUR MAIN ROAD PIN CODE: 560068,
STD CODE: NA , TEL NO: 25731572, FAX NO: 25730319, E-MAIL : N.A.

1994

101 - 500

1291

PRO ASIA EXPORTS

NO23I/I12I MG PALYA MAIN ROAD BOMMANAHALL OPP BOMMANAHALLI POS OFFICE


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 25635678, FAX NO: NA, E-MAIL :
N.A.

1995

101 - 500

1292

SAIBABA GARMENTS

NO 28 29 2 CROSS MUNISWAMAPPA LAYOUT HOSU R ROAD OPPOSITE HTMT HOUSE


BOMMANAHALL B PIN CODE: 560068, STD CODE: NA , TEL NO: 25736110, FAX NO: 2 573726,
E-MAIL : N.A.

1996

101 - 500

1293

ALPHA GARMENTS PRIVATE LIMITED

NO1O/1 BYATARAYANAPURA BELLARY.ROAD YELAHANKA HOBL BANGALORE PIN CODE:


560092, STD CODE: NA , TEL NO: 23636858, FAX NO: 23636858, E-MAIL : N.A.

1996

101 - 500

1294

GOODWILL FABRIC PRIVATE LIMIIED

ZM MAJNROAD AGARA BANGALORE BH PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1998

101 - 500

1295

READYMADE GARMENTS

TEXWORLD SB 44 RINGROAD SARJAPURAROAD PIN CODE: NA , STD CODE: NA , TEL NO: NA ,


FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

1296

BUREAU EXPOR PRIVATE LIMITED

2H MAINROAD AGARA BANGALORE PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1999

101 - 500

1297

***

SONAAL GARMENTS 16 H CROSS DHODDANNA INDUSTRIES PIN CODE: 560091, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

97

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2000

(5)
101 - 500

28O 3&4 CROSS CHINNAPPANAHALLI MAIN ROAD MARATHAHALLI POS BANGALORE PIN
CODE: 560037, STD CODE: NA , TEL NO: 28524889, FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

INDURO KISHANKUMAR
NO93SINGASANDRAPOST

HOSURHIGHWAY BANGALORE ,
FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

1301

HARISHKUMAR
RIGHTWAYSCLOTHINGCOMOANY NOI2

NAGASANDRAPOST BELMARESTATE BANGALORE B ,


TEL NO: 28376633, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560073, STD CODE: NA ,

2001

101 - 500

1302

SRI VISHWAS

KIDSCONNECTIONSPAPPAMMACOMPLEXHOSURMAIN
ROADBEGURROADBOMMANAHALLIBANGALORE 68 PIN CODE: 560068, STD CODE: 51316, TEL
NO: 165, FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

1303

GOODWILLFABRICS
RAJENDRABHAHERIA

CHANDRODAYACOMPILXISINGZSANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL


NO: 56694759, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1304

N N PRAKASH

COMPUTECH STICHES & FASHION 284/11 GARWEBHVIPALYA HOSUR MAIN ROAD BANGLORE
PIN CODE: 560038, STD CODE: NA , TEL NO: 25731541, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1305

***

2004

101 - 500

1306

SANJAYDHALAMIA

N1/2BEGURROADBOMMANAHALL INDUSTRIESAREA BANGALORE 68 PIN CODE: 560068, STD


CODE: 51316, TEL NO: 032, FAX NO: NA, E-MAIL : N.A.

2008

101 - 500

1307

GOODWILL

ICROSS 24MAIN AGARA BANGALORE PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

101 - 500

1308

***

SHAH EXPORTS HOUSE NO62 4BEGUR ROAD BOMM ANAHALLI BANGLORE 68 PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1309

***

NA

101 - 500

1310

ZODIAC CLOTHING COMPANY LIMITED

NEAR BAGALUR CROSS, IAF POST, YELAHANKA BANGALORE PIN CODE: 560063, STD CODE:
NA , TEL NO: 28462073, FAX NO: 28460236, E-MAIL : N.A.

1992

> 500

1311

RAJVMETHAN K MOHAN COMPANY


EXPORT PVT

LTD S L V INDUSTRIAL SINGASANDRA HOSURMAINROAD BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 25733337, FAX NO: NA, E-MAIL : N.A.

1996

> 500

1298

HARAVIND PRODUCT PRIVE LIMITED

N35914CROSS MAGADI MAIN ROAD SUNKADAKATTE BANGALORE PIN CODE: 560091, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1299

LAKSHMISH APPARELS

1300

PIN CODE: 560068, STD CODE: NA , TEL NO: 51119970,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

98

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2002

(5)
> 500

2004

> 500

PEENYA NDUBTRSAL AREP BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
51171639, FAX NO: NA, E-MAIL : N.A.

NA

> 500

24TH CROSS, K R ROAD, BSK 1S STAGE BANGALORE PIN CODE: 560070, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1312

M K FASHIONS

# 25/6 YELACHANAHALLY KP MAIN ROAD BANGALORE PIN CODE: 560078, STD CODE: NA ,
TEL NO: 30905239, FAX NO: 26662508, E-MAIL : N.A.

1313

INTIMATECLOTHING SHARADAMALAN

16/2 SRIVINAYAKA NDUSTRIALESTATE SINGASANDRA BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 51100441, FAX NO: NA, E-MAIL : N.A.

1314

EOLAL JNDIA NO 485 IS CROSS A


PHZSE

NIC 2004 : 1911-Tanning and dressing of leather


1315

SUPREME OVERSEAS EXPORTS NDIA


LTD.,

NIC 2004 : 1912-Manufacture of luggage, handbags, and the like, saddlery and harness
1316

ABDUL WAHAAB KHAN

NO63 NOORBUILDING JCROAD BANGALORE PIN CODE: 5 6002, STD CODE: NA , TEL NO:
26904210, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

1317

MALLIKARSUN

NZDHISZTTLNGS NO63 14THCROSS A D HALL BANGALDREI PIN CODE: 560079, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1318

SUBBAIH

N134 2ND CROSS BAKSH GARDEN BANGALORE PIN CODE: 560053, STD CODE: 00080, TEL
NO: 26800229, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1319

PALANI VELU

1O5 2ND CROSS BAKSHIGARDEN BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1320

MEDICON LATHER PVT LTD

BOMMANAHALLI RAJIVGANDHINAGAR HOSUR ROAD BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 51109122, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1321

CHRYSAALIS MATHSINDIA LTD

NO S CROSS JPNAGA PHASE BANGALORE PIN CODE: 560078, STD CODE: NA , TEL NO:
26494956, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1322

NOUSHAD LADIES BAG FACTORY

NO 20 6TH CROSS CHALUVAD PALYA D N C M ROYAN ROAD BANGALORE PIN CODE:


560053, STD CODE: 080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1323

ZAKIR AHMED PLASTIC BAGS FACTORY

NO 21/1 6THCROSS DR TCM ROYAN ROAD CROSS CHALUVAD PALYA BANGALORE PIN CODE:
560053, STD CODE: 080, TEL NO: 26700292, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

99

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 1920-Manufacture of footwear.

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1324

BULK PQCKCGING LINERS PRTVATE


LIMITED

NO 289 4 PHASE 4 MAIN PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 51179188, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1325

VK BALLA

Y K EXPORTS 62/4 BEGUR ROAD BOMMANAMALL BANGLORE-68 PIN CODE: NA , STD CODE:
NA , TEL NO: 25732481, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1326

RAFIYATH JABBAR HAL

ITTH CROSS GOVINDAPURA ARABTC COLLEGE POS BANGALORE PIN CODE: 560045, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1327

LEENA EZZUS LEATHERWARE PV LTD

SINGASANDRA HOSURROAD BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1328

THIMMARAYAPPA S/ O MUNIYAPPA

PUMP HOUSE A EBELLE ROAD ANEKAL ,


7840636, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 562106, STD CODE: 78406, TEL NO:

2002

10 - 50

1329

***

SWITCH NDIACLOTHING COMPANY 4CROSS N S P ALYA BANNERGHA AROAD BANGALORE


PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1330

ADITYA ENGEENEERING

52/2 BILEKAHALLI BANNERGATTA ROAD BANGALORE PIN CODE: 560076, STD CODE: 26580,
TEL NO: 658, FAX NO: 11, E-MAIL : N.A.

1990

51 - 100

1331

CHAMUNDJ CREATIONS

NO 432 2 4 PHASE PEENVA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51170237, FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

1332

VIJAYMALLYA

NAMASTHEFACTORY AREKERE BANNERUGATTA ROAD BANGALORE PIN CODE: 560076, STD


CODE: NA , TEL NO: 51215444, FAX NO: NA, E-MAIL : N.A.

1993

101 - 500

1333

SUNSAN KRAFSS NO 41O 1

1O CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 51170115, FAX NO: NA, E-MAIL : N.A.

2000

> 500

1995

10 - 50

2000

10 - 50

PIN CODE: 560068, STD CODE: NA , TEL NO:

NIC 2004 : 2010-Saw milling and planing of wood


1334

FEVEEN HARIOMTIMBERS
SINGASANDRA

HOSURMAINROAD BANGALORE ,
NO: NA, E-MAIL : N.A.

1335

C.C_LAMINATES PRIVATE LIMITED

NEXT O VIDYANIKETAN SCHOOL HEBBAL KEMPAPURA BANGALORE PIN CODE: 560024, STD
CODE: NA , TEL NO: 23335125, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX

100

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2000

(5)
10 - 50

NA

10 - 50

NA

10 - 50

NO 4/10HOSUR MAIN ROAD BOMMANAHALL BANGALORE 68 PIN CODE: 560068, STD CODE:
080, TEL NO: 25732123, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

SREEKRISHNAWOODINDUSTRIES NOI8
WARDNOZ

STHMAIN JYOTHICOMPLEXROAD KAMMAGONDANAHALL BANGALORE PIN CODE: 500015,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1341

SUJATHA WOOD NDUSTRIES

NEAR HMT NDUSTAIAL ESTATE KAMMAGONDNAHAL JALAHLLRI WES BANGALORE PIN CODE:
560015, STD CODE: NA , TEL NO: 94486181, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1342

SHRI VEERABADRA SWAMY MATA


PRIMARY

AND HIGH SCHOOL, VIBHUTHIPURA MARATHAHALLI POST, BANGALORE PIN CODE: 560037,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1336

UNITED IMBER BOARD

N76/B HENNUR BANDE KALYANNAGAR POS BANGALORE PIN CODE: 560043, STD CODE: NA ,
TEL NO: 25442622, FAX NO: NA, E-MAIL : N.A.

1337

MANAGER

VARDHAMAN BASIC WOOD NO3O2/CPEENYA NDUS RIAL ESTATEBANGALORE 56OO58 PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1338

***

1339

SHANTILAL VIJAYA LAKSHMI IMBER


DEPT

1340

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2021-Manufacture of veneer sheets; manufacture of plywood, laminboard, particle board and other panels and boards
1343

HI POWER CONTROLS

NO 39_I_3 KALYANS GARDEN NR COLONY BANASHANKARI STAGE BANGALORE_50 PIN


CODE: 560050, STD CODE: 1, TEL NO: 26769670, FAX NO: 67669000, E-MAIL : N.A.

1976

10 - 50

1344

E S ELECTRONICS INDIA PRIVATE


LIMITED

NO S KALYANT GARDEN ASHOFNAGAR BSK J STAG BANGALORE PIN CODE: 560050, STD
CODE: NA , TEL NO: 28969799, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1345

***

NA

10 - 50

1346

V V CIRCUITS PRIVATE LIMITED

NA

10 - 50

1347

***

NA

10 - 50

1348

STUMP SCHUELE AND SOMAPPA


PRIVATE LIMI D

NA

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

59 A CROSS 4 N BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA , TEL
NO: 23126074, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

POST BOX 9O5 OFF BULL EMPLE ROAD OFF BU LL TEMPLE ROAD BASAVANGUDI BANGALORE
PIN CODE: 560019, STD CODE: NA , TEL NO: 26610074, FAX NO: 26609189, E-MAIL : N.A.

NIC 2004 : 2022-Manufacture of builders carpentry and joinery

101

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1349

SHEKAR FIRE WOOD DEPO

KH RANGANATHA JAYOUT MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

1350

NAVEEN

SHYAM PLYWODS SUPPLIES NO82 SHIVANAGAR MAINROAD WESFOFCORDROAD


RAJAJINAGAR PIN CODE: 560044, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1351

***

48/49PACK WELL OPP MEI UMKUR ROAD YESHAV ATPUR BANGALORE PIN CODE: 560022,
STD CODE: 080, TEL NO: 23477888, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1352

PRABHAKAR

SEEIHARAMAIAH INDL ESTATE M E S ROAD JALA HALLY BANGALDRE PIN CODE: 560013, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1353

WOOD WORKS

#34 8/3407KEMPPBGOWD NOISTRIAL ESTATE MA GADS MAIV ROAO KAMAKSIPBLYA


BQNGALORE PIN CODE: 560079, STD CODE: 9580, TEL NO: 23584022, FAX NO: NA, E-MAIL :
N.A.

2003

10 - 50

2000

10 - 50

2001

10 - 50

NIC 2004 : 2023-Manufacturing of wooden containers


1354

CHIRAG CARD CONTAINERIS

KAMAKSHI PALYA MAGAD ROAD BANGALORE ,


NO: 23487675, FAX NO: NA, E-MAIL : N.A.

1355

MARK PRODUCTS

53 5 E MAIN ROAD KOTTIGEPALYA BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560079, STD CODE: NA , TEL

NIC 2004 : 2029-Manufacture of other products of wood, manufacture of articles of cork, straw and plaiting materials
1356

SADARAN METEL AND CORK


INDUSTRIES NO.5/B

J P NAGAR 3RD PHASE IS MAIN SARAKKI INDUSTRIAL LAYOU BANGALORE PIN CODE:
560078, STD CODE: NA , TEL NO: 6587107, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1357

RRWOOD NDUSTRIES SRINIUASAIAH


NO 42

JPNASAR INDUSTRIAL LAYOUT3RD PHASE IST MAIN BANAGALORE PIN CODE: 560078, STD
CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1358

APPU WOOB WORK

MANJUNTH NAGAR MAIN PIN CODE: NA , STD CODE: NA , TEL NO: 23409750, FAX NO: NA,
E-MAIL : N.A.

2001

10 - 50

1359

***

VALUEDESIGNSTUDIOND BINDUSTRIALSUBRUBSECO NDSTAGETUMKURROADBANGALORE PIN


CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1360

JANHKAJKUMAR

MANJUNATHA NAGAR ETYEASE 1MAIN PIN CODE: 560010, STD CODE: NA , TEL NO:
23409300, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

102

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 2101-Manufacture of pulp, paper and paper board


1361

HYDRAULIC EQUIPMENTS KANAKAPURA


MAIN ROAD

28/2 15 CROSS JAYANAGAR 8TH BLOCK BANGALORE PIN CODE: 560082, STD CODE: NA ,
TEL NO: 42952615, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1362

SHASHIKALA

#1372 KULLEGOWDA ESTATE MAGAOI MAIN ROAD KAMAKSHIPALYA BANGALORE PIN CODE:
560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1363

***

NA

10 - 50

1364

SUPREME INDUSTRIES NOUBG ISTH


CROSS

KANAKAPURA MAIN ROAD JAYANAGARA BXM BLOCK BANGALORE PIN CODE: 560082, STD
CODE: NA , TEL NO: 26015406, FAX NO: NA, E-MAIL : N.A.

1990

51 - 100

1365

MARJB AR

CROS K MPA OW ND STRSBL ESTASE K M KSCPALYA ANG LORE PIN CODE: 560079, STD
CODE: 458 0, TEL NO: 57606411, FAX NO: NA, E-MAIL : N.A.

2004

51 - 100

1366

***

NA

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2102-Manufacture of corrugated paper and paperboard and of containers of paper and paperboard
1367

HIGHTEMPFURNACESLIMITED

N 1CSECONDPHASEPEENYAINDUSTRIAL POSTBOXNO5809 BANGALOR PIN CODE: 560058, STD


CODE: 080, TEL NO: 28395917, FAX NO: 28392661, E-MAIL : N.A.

1978

10 - 50

1368

YADU ENTERPRISES

AG-I A BLOCK EAS JAYANAGAR BANGALORE PIN CODE: 560069, STD CODE: NA , TEL NO:
51808660, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

1369

UNITED PACRAGING ENDUSTRIES

PETECHANNAPPA INDUSTRRAL AREA KAMAKSAIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 23080, TEL NO: 2348 798, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1370

VINAYA

SANTHOSH CONTINER CARPORATION MSIRAMAIAH NDUSTRIAL ESTATE BANGALDRE PIN


CODE: 560054, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1371

CIMTRIXSYSTEMS PVT L

NO-1-A1PEENYA INDUSTRIALAREA PHASE SECOUN D BANGALORE PIN CODE: 560058, STD


CODE: 080, TEL NO: 28370141, FAX NO: 28370142, E-MAIL : N.A.

2003

51 - 100

1372

KROMO FACTORY, IS MAIN, CHIKKA


ADUGODI

THAVAREKERE MAIN ROAD BANGALORE SOUTH ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560029, STD CODE: NA , TEL

NIC 2004 : 2109-Manufacture of other articles of paper and paperboard

103

NA

> 500

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1373

H C OARA

NO Z 8MAIN KN EXTENTION YESHAVANTHAPURA BANGALORE PIN CODE: 560022, STD CODE:


080, TEL NO: 23378681, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

1374

H RAMESHCHUGH

NO48 2CROSS AGRAHARA DASARAHALLI BANGALORE 79 PIN CODE: 560079, STD CODE: NA
, TEL NO: 2355679, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1375

COMPUTER SHEET PRODUCT PIPE


LINEICIRCLE

SUNKADAKATTE VISHWANEEDAM POST BANGALORE PIN CODE: 560091, STD CODE: NA , TEL
NO: 56988555, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1376

N.S KRISHNAPPA MANO PALKERS

NO JOG HTH MAINROAD KAVERIPURA BAAGALORE PIN CODE: 560079, STD CODE: NA , TEL
NO: 23284815, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1377

MR SRIDHAR COS CRAF PV LTD

NOA9 NDUSTRIAL SUBRUB YESWANTHPUR BANQALORE ZZ PIN CODE: 560022, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1378

VISHWA KUTUM PVT LTD MANOJ JAIN

N0 132 PALACE CROSS ROAD BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO:
23344079, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1379

***

NA

10 - 50

1380

INDIA PAPER PRODUCTS SUDHIR


PAPER LTD

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1974

101 - 500

#IOZ8 THMAINROADINEARBPL HOSUR ROAD BOMMANAHALL BHNGALORE PIN CODE:


560068, STD CODE: NA , TEL NO: 26662006, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

174/1 B G ROAD BILEKAHALLI BANGALORE PIN CODE: 560076, STD CODE: 26580, TEL NO:
593, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

4506 HIGH POIN IV 45 PALACE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 2264868, FAX NO: 2258500, E-MAIL : N.A.

NIC 2004 : 2211-Publishing of books, brochures, musical books and other publications.
1381

GUNDANVA

1382

MEU ENGINEERING PRIVATE LIMITED

1383

SOUXHERN CASTANGS

NO 3O8 PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 540058, STD CODE: NA , TEL NO:
28362221, FAX NO: 28362221, E-MAIL : N.A.

1980

10 - 50

1384

STEER ENGINEERING PRIVATE


LIMITETED

NO 291 4 CROOS 4 PHASE PEENYA 1 BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: 28391374, E-MAIL : N.A.

1980

10 - 50

1385

EXEL PROCESSJ BANGALORE PVT LTD

NO 278 PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28394977, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

104

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1982

(5)
10 - 50

NO 33G 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360954, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

KANGOV ELECTRONICS PV LTD NO


377

IO CROSS 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360564, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1389

KALPA ENGINEERINGS

NO 326 4 PHASE 9 CROSS PEENYA NDUSTRIAL AREA DANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 27362657, FAX NO: 28362667, E-MAIL : N.A.

1988

10 - 50

1390

RADIKA ASSOCIATES

#ZAA BIZ 3RDCROSS RC ROAD BSMMANAHALLI BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: 5724071, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1391

MERRIDIAN TANNERIES PRIVATE


LIMITED

NO 47/1 BILEKAHALLI BANNERGATTA ROAD BANGALORE PIN CODE: 560076, STD CODE:
26580, TEL NO: 824, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1392

NAND TARPAULIN INDUSTRIES

NOZO PUTTENAHALL EXTENSION IPHASE JPNAGAR BANGALORE SGOOTB PIN CODE: 560078,
STD CODE: NA , TEL NO: 26594913, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1393

DKNSINGH

PROJEC CONSULTENTS NOI6O 3PHASE INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1394

RAMACHANDRA

HERO GLASS #48392 SARVABOMA NAGAR BILEKAHALL BANNERUGATTA ROAD BANGALORE


PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1395

DELH PRESS PATR PRAKASHNSA


PRIIVATILTD

2 I1VSICOURT CUNNINGHSM ROAI


RI BANGALORE PIN CODE: 560052, STD CODE: 11111, TEL
NO: 22268091, FAX NO: 11111111, E-MAIL : N.A.

1993

10 - 50

1396

AUTO BLIZ TNDIA PV LIMITED

FLOT NO99 8MAIN 3PHASE PEENYA INDUSTRLAL AREA BANGALORESB PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1397

CRISMO NDUSTRIES ENGINEERING

KRISHNA REDDY ESTATE OPPOSITE K FCI DOORVANINAGAR BANGALORE PIN CODE: 560016,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1398

GOLUKN NAPAL

IO3 DIVISION HONGASANDRA PIN CODE: 560068, STD CODE: NA , TEL NO: 25732642, FAX
NO: 25732642, E-MAIL : N.A.

1995

10 - 50

1399

VIJAYMALYA

U B INTERNATIONAL TRADING COMPANY NO 62 6CROSS N S PALYA BANGALORE-76 PIN


CODE: NA , STD CODE: 01311, TEL NO: 153, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1386

SYNTHETIC PACKERS PV LTD

NO 262-263 4PHASE 2 STAGE PEENYA INDUSR ALIAREA BANGALORE-560058 PIN CODE:


560058, STD CODE: 280, TEL NO: 28398651, FAX NO: NA, E-MAIL : N.A.

1387

C E CHEM PHARMACIUTICACS DVT LTD

1388

105

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

I77/2A BILEKAHALLI B G ROAD BANGALORE PIN CODE: 500076, STD CODE: NA , TEL NO:
26491220, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

177/5B BILEKAHALLT B G ROAD BANGALORE PIN CODE: 560076, STD CODE: 26583, TEL NO:
184, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1400

TOYO PAINTS PV LIMITED

1401

PROLINE NDIA PVT LIMITED

1402

SUDHARSHAN
GANGAKAVERIWATERSTORAGFTANK

CHIKKABIGURGATE HOSURROAD BANGALORE 68 PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1403

CRIUSHMARCHAUTOMATIONPVTLTD

BHARTHINDUSTRIALAREA BANNERGHATTARDADBANGALORE PIN CODE: 560076, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1404

TECHNO RUBBER PRODUCTS

NO 3G7 1O CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28362712, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1405

TULSIYN N EEC LIMITED

NO SF3 PEENYA INDUSTRIAL AREA RANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
51272701, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1406

KAVIRAJ INCORDORATION

FLOTNO9G 8MAIN ROAD 3PHASE PEENXA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1407

K S MURALI MOHAN NO B KBC COMPLEX

BESIDE BHARATH THEATRE DASARA HALLI BANGALORE PIN CODE: 560057, STD CODE: NA ,
TEL NO: 28390056, FAX NO: 28390057, E-MAIL : N.A.

1997

10 - 50

1408

POLY CORE PRODUCTS

NO 276 PEENYA NDUSTRTAL AREA 4 PHASE BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28395785, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1409

NAVATHA ROAD RANSPORT COMPANY

KOTASHWAR RAO THRIMALAPPA NAGAR ATTUR AND STAGE PIN CODE: 560064, STD CODE:
NA , TEL NO: 28566144, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1410

REGALIA WATCH FACTORY 27TH CROSS

NEELAKANTESHWARA LAYOU MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 25720255, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1411

WIPRO LIMITED CUSTOMER SUPPORT

NO 60 HYLAND NDUSTRIAL ESTATE NH 7 HOSUR ROAD SURVEY NO 38 BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 25736323, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1412

SANJEEVKAPOOR

NO SB COUNTRYCLUBROAD SINGHSANDRA BHNGALORE PIN CODE: 560068, STD CODE: NA ,


TEL NO: 22212143, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1413

PCI ENGINEERS DINESHHEGDE NO9/1

SINGASANDRA HOSURMAINROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
25731453, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

4 CROSS

106

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1414

SUHEL

#286\3 NEX TO BPL HOSUR ROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1415

K R M ERNATIONAL LIMITED

NO.36O-361 PEENYA INDUSTRIAL AREA 4 PHASE BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 57272023, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1416

QQT SYSTEM KRISHNA REDDY ESTATE

OPPOSITE TK FCI ROAD DOORVANINAGAR BANGALORE PIN CODE: 560016, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1417

ADS SOLUTION MEDICAL


RANSCRIPTION AND

ITES COMPANY BENNIGANA HALLI OLD MADRAS ROAD NEAR MADURA COATS
DOORVANINAGAR BLOR PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1998

10 - 50

1418

N ANANTH

NO I8 NEAR RAMKUMAR MILL RAJAJINAGAR BANG ALORE PIN CODE: 560010, STD CODE: 080,
TEL NO: 23350737, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1419

RAGHU

IDEAL INDUSTRIES ALAAALLY BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560016, STD CODE: NA , TEL NO:

1999

10 - 50

I77/28 BILEKAHALLI BANNERGATTA ROAD BANGALORE PIN CODE: 560076, STD CODE: 26490,
TEL NO: 972, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1999

10 - 50

1420

NDIA METERS/AMREX ENTERPRISES

1421

USHA AMAR N O 2 KANNKAPURA MAIN


ROAD

JARAGANAHALL BANGALORE ,
NA, E-MAIL : N.A.

1422

MICROTIC MECHINE LIMITED


DICEMANFACTURING

NOI6 B8KAMALBABU AMRUTHANAGAR SAHAKARNAGAR POS BANGALORE NORTH PIN


CODE: 560092, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1423

LRENIERPRISES P LIMITED

C-J KSSTDC KHB GELOHONKANESTOWN BANGLORE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1424

MULT LAB P V L D Y N K NEWTOWN

NO C 11 K H B KSSIDC BANGALORE PIN CODE: 560084, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1999

10 - 50

1425

CEMENT BRICKS FACTORY

GOWR SHANKAR HARISHA HOLLOW BRICKS THRIMALAPPA NAGAR, 2ND STAGE PIN CODE:
NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1426

ASHOK HOYSALA FABRICATION M E S


ROAD

BAHUBALINAGAR BANGALORE ,
NA, E-MAIL : N.A.

2000

10 - 50

1427

SARIN DIABUDIMONDTOOLS PVT LTD

COUNTRYCLUBROAD SINGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL


NO: 25731256, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560078, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: 560013, STD CODE: NA , TEL NO: NA , FAX NO:

107

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1428

RAJAN ICHINOTEK PRECISION TOOLS


PV LTD

BEGURHOBLI HOSURROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560068, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1429

NEWTIK QOWDER COAT


MANUPACTURER GHARVEBHA

VIPALYA HOSUR ROAD BANGALORETGB ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1430

AIR BREEZA SYSTEMS

HBGOGAPPALAYOU MEREESCHIRCH CROSSROAD NEAR RAILWEGATEACPOS BANGALORE


PIN CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1431

SHILPA LATEU P PLD

KSIIDC KHB YELAHANKANEWTOWN OANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

NO C-5 K H B KSSIDC YELAHANKA NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1432

C U CO

1433

R L FENE SCHEM 2 N D

NO C12 K H B KSSIDC YNK NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1434

NO5TEROGON CHEM P N J L D

ND C 19K H BKSSIDC BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

2000

10 - 50

1435

S M C E PVT LTD

NO 387 4 PHASE 10 CROSS PEENYAINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28361050, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1436

MANOHAR

GLOBAL ECH 5 A CROSS KASTURI BADAVANE RAJAGOPALANAGAR PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1437

BASAVESHWARA RANSFORMER
MANUFACTURING CO

SWATHANTHRANAGAR VIRGONAGAR POST BANGALORE PIN CODE: 560049, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1438

AKIHLA HITEC GRAFIX PRIVATE LIMITED

KRISHNA REDDY ESTATE OPPOSITE K FCI ROAD DOORVANINAGAR BANGALORE PIN CODE:
560016, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1439

RVPA & COMPANY

B6 NEW 66 SHANKARAPURA RANGARAO ROAD BANGALORE PIN CODE: 560004, STD CODE:
NA , TEL NO: 26679128, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1440

SRI ANGALESHWARI ENGG WORKS

NO 49/3A 9MAIN HONGASANDRA BEGUR ROAD BOMMANAHALLI BANGALORE PIN CODE:


560068, STD CODE: NA , TEL NO: 25734020, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1441

RAJESH

NO 1159 TH1RD CROSS S M ROAD DASARAHALL KALASTRINAGAR BANGALORE 57 PIN


CODE: 560057, STD CODE: NA , TEL NO: 22839985, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

108

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1442

GOVT NDUSTRIAL ENG WORKS

NO-75 16TH CROSS MARATHALLY POST BANGALORE PIN CODE: 560017, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1443

M S CHITRA

CAUVERY INDUSTRIES M E S ROAD MATHIKERE BANGALORE PIN CODE: 560013, STD CODE:
080, TEL NO: 28381221, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1444

GIRISH RENYTISSUS PVT LTD


SINGASANDRA

HOSURMAINROAD BANGALORE ,
NO: NA, E-MAIL : N.A.

2002

10 - 50

1445

CMT CREA VE MACHINE OOLS

#IO27 TH MAIN HOSUR ROAD NEAR BPL FACTORY BOMMANAHALLI BANGALORE PIN CODE:
560068, STD CODE: NA , TEL NO: 25635637, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1446

TETRAGON CHEMIC PRIVATE LTD

C_2 KSSIDC KARNATAKA HOUSING BOARD YELAHANKA NEW TOWN BANGALORE PIN CODE:
560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1447

PRAKASH ALUBLACKS

PRAKACH ALUBLACKS BALAJILAYOUT PIN CODE: 560092, STD CODE: 23515, TEL NO: 045,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1448

ASHAR

K AND G PACKING PV LTD #139/1 BILEKAHALL BANNERUGATTA ROAD BANGALORE PIN


CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1449

FLUTEPALKIALOKMARDA NO96/2

SINGASANDRA HOSUR MAIN ROADI BANGALOREI PIN CODE: 560068, STD CODE: NA , TEL NO:
51115743, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1450

BHAGAVATHI WEAVING LOOMS FACTDRY


GHARVEBH

AVIPALYA HOSUR ROAD BANGALORE 68 ,


FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1451

SANTOSH

SANJOI CREATION BILLAKAHALLI DEVARACHIKKANAHALL MAIN ROAD BANGALORE PIN


CODE: 560076, STD CODE: NA , TEL NO: 51107968, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1452

BASAPPA

DEEPAK APPARALS PV LID NO 62 6CROSS N S PALYA BANGALORE-76 PIN CODE: NA , STD


CODE: 26787, TEL NO: 702, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1453

ANANDINDUSTRIES NO93/H
KALIKAMBACOMPLEX

SINGASANDRAPOS NEARKUDULUGATE HOSURROAD BANGALORE PIN CODE: 560068, STD


CODE: 2, TEL NO: 25734347, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1454

GAHRAV

SPRING LEAF RETAIL PVT LTD A/I RANKA COLONY ROAD 8 G ROAD BANGALORE-76 PIN CODE:
NA , STD CODE: 93425, TEL NO: 4564315, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1455

TAGADISH R CEM PV LTD

ICEMSOLUTION PVT LTD HOSURROAD BEGURHOBL BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

109

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1456

VINAYAKA PACKHARD LAKSHMIKANTH

NO 278 NEAR BUS STAND DEVARACHIKKANAHALL BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1457

SHIFAN

NEARSHAMIKMASTURLAL PV LTD BANNRUGHATTA ROAD ARAKERE BANGALORE 76 PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1458

***

NA

10 - 50

1459

***

CROSS MA EKAR STREE ARABIC COLLEGE POST BANGALORE PIN CODE: 560045, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1460

***

NO 113O MA EKAR STREE ARABIC COLLEGE POST BANGALORE PIN CODE: 560045, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1461

***

NA

10 - 50

1462

BABU REDDY MANGALASHREE


ENTERPRISES

BOTTLE WASHING UNI 2ND CROSS OUTER RING ROAD HEBBALA BANGALORE PIN CODE:
560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1463

JAYASIMHA INGINIYARING

NO75 76 ICMAIN 2ND PHAE PEENYA NOLAREA BANGALORE 560058 PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1464

ALLMINROLK NDSAR FABRICKS N017JZ


N

JNDPHASE PEENYA IND AREA BANGALORE560058 ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1465

BASROOR UNIKARSAL GASKAT PLTD I9


A

2NDPHASE RND MAIN AEENY BANGALORE SGOO5B ,


TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1466

SPANET MANUFACTURERS ND 4O5

4 PHASE 10 CROSS PEENYAINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360412, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1467

PASUMA NDUSTRIES NO 4IO B

ID CROSS F PAASE PEEHYA INDUSTRIAL AREA RANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28362147, FAX NO: 8361022, E-MAIL : N.A.

NA

10 - 50

1468

UNIQUE NSTRUMEN AND


MANUFACTORES PVTLTD

NO 423 4 DHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28371225, FAX NO: 28371225, E-MAIL : N.A.

NA

10 - 50

1469

PRESS MRCU PRTVATE LIMITED

NO 32O 4PHASE PENNYA INDUSTRTAL AREA BANGALDRE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51179582, FAX NO: 51179582, E-MAIL : N.A.

NA

10 - 50

PINCRAFI

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560058, STD CODE: NA ,

PIN CODE: 560058, STD CODE: NA ,

110

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

(1)

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NO 399 4 PHASE 1O CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

AMARANDINDUSTRIES

ND 472 B 1 4 PHASE 11 CROSS PEENYA NDUSTRTAL AREA PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1473

WARMEN TERNATLONAL INDIA PV LTD

NO 47I 4 PHASE PEENYA NDUSTRTAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51372777, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1474

NASH NDUSTRIALI

NO 393 4 PHASE 1O CROSS PEENYA NDUSTRIAL AREA PIN CODE: 560058, STD CODE: NA ,
TEL NO: 51179250, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO 447 12 CROSS PEENYA TNDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28360398, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1470

CONTROL INFOTECH LID

NO 426 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28362527, FAX NO: 28361050, E-MAIL : N.A.

1471

BIO PHARMA DRUGS AND


PHARMACEUTICALS

1472

1475

P A FLOWMATJCS PVT LTD

1476

J S TRANSMISSIONS PV LTD

NO 43O 431 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560008, STD CODE:
NA , TEL NO: 22974040, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1477

JOY INDUSTRIES NO 391

U PHASF 1O CROSS PEENUA NDUSTRTAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362531, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1478

SPECLAL INSULATORS MFG COMPANY

NO472 4 PHASE PEENYA NDUSTRTAL AREA BANGALOKE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28361005, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1479

ASH COAT NO 477 C 4PHASE

PEFNYA NDUSTRIAL AREA BANGALORE ,


28364267, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1480

UNIQUE PUNCH SYSTEMS PVT LTD

NO 485 7 4 PHASE 14 CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 57704720, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1481

VACUUM ECHNIQUES PV LTD

NO 433 G PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360606, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1482

GEM PAINTS PVT LTD

NO 49OH 4 PHASE 14 CROSS PEENYA INDUSTRIA AREA PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28361106, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1483

SATURES INDIA PV LTD

NO 472 D 4 PHASE 12 CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 51272102, FAX NO: 51171056, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560058, STD CODE: NA , TEL NO:

111

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NO 488 E_D PEENYA INDUSTRTAL AREA A PHASE BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362251, FAX NO: 28361427, E-MAIL : N.A.

NA

10 - 50

INDIA RUBBER PVT LTD

NO 473 B.I 4 PHASE


CROSS PEENYA NDUSTRTAZ AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1487

TRUE PACK PVT LTD

NO 48S 4 PHASE PEENYA INDUSTRIA AREA BANGALORE PIN CODE: NA , STD CODE: NA , TEL
NO: 28363377, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1488

SURFA COATS BANGALORE PV LTD

NO 48G A PAASE IU CROSS PEENYA INDUSTRLA L AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28363619, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1489

DHANRAJ SOUTH INDIA WIRE PRODUCT


PVT LTD

PLOT 34 I2TH CROSS ATHPHASE PEENYA NDUS RIAL AREA BANGALORE SB PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1490

RAJESH SUPER AX LABLES PV LTD


PLOT NO

FB8 DIEPHASE ATHCROSS PEENYA INDUSTRIAL AREA BANGALORE SB PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1491

A PUSHPA KRITHA ENGINEERING PV


LTD

43O HJ IZCROSS 4TH PHASE PEENYA INDUSTRIAL AREA BANGALORE SB PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1492

BHAIRA GOWDA J S RANSMISSION PV


LTD NO

43O I2TH CROSS 2PHASE PEENYA NDUSTRIES AREA 58 BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1493

SARDAR VACCUM TECHOQUES PV LTD


ABZIZ ATH

MAIN ZTH CROSS ATHPHASE PEENYA INDUSTRIA L AREA BANGALORE SB PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1494

VEERBHADARAIAH KAYYANA U
HERBALS AND

AROMATICS PV LTD 470 H PHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE:
560058, STD CODE: 1, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1495

NANJESH GIVI MISURE PV LTD EXPORT


BHAVAN

PLOT NO 488 14TH CROSS PEEYA NDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1496

SRINIVAS PARAS POWER ENGINEERING


PVT LTD

MFRS OF INSTRUMENT RANSFORMER PLO NO434 12TH CROSS PEENYA INDUSTRIAL


BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1497

INC INDUSTRIES

DEVASANDRA NDUSTRIAL AREA MADEVAPURA POS SINGHYANAPALYA PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1484

ESCON GENSETS PV LTD

NO485 6 14 CROSS 4 PHASE PEENYA NDUSTRIAL AREA PIN CODE: NA , STD CODE: NA , TEL
NO: 28363582, FAX NO: NA, E-MAIL : N.A.

1485

SUPER LABELS PUT LTD

1486

112

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1498

MYSORE UDOYOG

DEVASANDRA NDUSTRIAL AREA MAHADEVAPURA POST SINGHYANAPALYA BANGALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1499

AISH PRODUCY

MAHADEVAPURA POS DEVASANDRA NDUSTRIAL AREA STNGHYANAPALYA BANGALORF


PIN CODE: 560049, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1500

MAAKS TNDUSTRIES

DEVASANDRA JNDUSYRTAL AREA MAMADEVAPURA POST STNGHYANAPALYA BANGALORE


48 PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1501

KARNATAKA TUFF REDDLNG MANGING

DEVASANDRA NDUSTRIALESTATE SJNGHYANAPALY BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1502

SUBHEGHER INDUSTRIES

DEVASANDRA NDUSTRIAL ESTATE, MAHADEVAPURA POST, SINGHYANA PALYA PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1503

MS L J FOAM PRODUC

DEVASANDRA NDUSTRIAL ESTATE MAHADEVAPURA POSI SINGHYANAPALYA BANUALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1504

SHADAR METAL

DEVASANDRA NDUSTAIAL ESTATE SINGHYANAPAL YA MAHEDEVAPURA POST PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1505

VST TILLERS AND TRACTOR


DEVASANDRA NDUS

RIAL ESTATE MAHADEVAPURA SINGHYANAPALYA BANGALORE PIN CODE: 560046, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1506

JAI BHARAT NDUSTRZES

DEVASENDRA NDUSTRIAL AREA SINGMYANAPALYA BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1507

BAB INSTRUMENT NDIA

DEVASANDRA ND-STRIAL ESTATE SINU YANAPAL YAIYAHE9EJAPURA POST BANGALORE PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1508

SPYING PRIVATE LIMITED

DEVASANDRA NDUSTRIAL ESTATE MAHEDEVAPURA POST SINGHYANAPALYA BANGALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1509

IETCPRESS PRODUC PV LTD

DEVASENDRA NDUSTRIAL ESTATE MAHADEVAPURA POST SINGHYANAPALYA BANGALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1510

NAVEEN ENIERPRISES DEVASANDRA


INDUSIRIAL

ESTATF SZNGHYANAPALYA MAHADEVAPURA POS BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1511

AJITHA NDUSTRIES DEVASANDRA


NDUSTRIAL

ESTATE MAHADEVAPURA POST SINGHYANAPALYA BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

113

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

1512

MLS INDUSTRIES

1513

***

1514

***

1515

***

1516

AVONCASIING PVTLTD

1517

***

1518

***

1519

***

1520

SATISH METAL WORKS

1521

***

1522

PRESICION RAKS LIMITED

1523

***

1524

***

1525

***

1526

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

DYVASANDRA NDUSTRIAL AREA SINGAYANAPALYA WHITEFIELD ROAD BANGALORE PIN


CODE: 560058, STD CODE: 5600, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1527

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1528

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1529

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

DEVASANDRA NDUSTRIAL ESTATE, MAHADEVAPURA POST, SINGHYANA PALYA PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

DAVESANDRA LNDUSTRIAL MREA SINGAYANAPALYA MAHADIUAPURA POS BANGALORE 48


PIN CODE: 560058, STD CODE: 5600, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

DEVASANDRA AREA SINGAYANAPALYA WHITEFIELD MADEVAPURAPOST BANGALORE 48 PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

114

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NA

10 - 50

NA

10 - 50

DOORVANINAGAR POST BANGALORE PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1950

51 - 100

JAYRAJ R M C REDIMIX NDIA P.R.V. L. D

VENKATALA YELAHANKA POST BANGALORE NORTH TALUK BANGALORE NORTH DISTRIC PIN
CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1960

51 - 100

1535

SHAMIKMASTURLAL PV LTD

NEARBPL BANNRUGHATTA ROAD ARAKERE BANGALORE 76 PIN CODE: NA , STD CODE: NA ,


TEL NO: 26581756, FAX NO: NA, E-MAIL : N.A.

1971

51 - 100

1536

THOMAS MATHA KUNAL

BANGALORE CERAMICS 1ST MAIN MARUTHINAGAR YELAHANKA BANGALORE PIN CODE:


560064, STD CODE: 00080, TEL NO: 28460180, FAX NO: 28460417, E-MAIL : N.A.

1984

51 - 100

1537

AR UDUPA NAVAKARANATAKA
PUBLICATIONS

EMBASSY CENTER CRESCEN ROAD KP EAST BANGALORE PIN CODE: 560001, STD CODE: NA ,
TEL NO: 2203580, FAX NO: 2203582, E-MAIL : N.A.

1987

51 - 100

1538

SRUSIL FORMASUTICALS PVT LIMITED

NO154 10MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

51 - 100

1539

HONEY HILLS ENARGY SYSTEMS

NO 365 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28361282, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

1540

SPY REDDY PAYAM CEMENTS


MINERALINDUSTRIE

ENGGDIVISION BOMMANAHALL BANGALORE ,


273, FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: 25732, TEL NO:

2000

51 - 100

1541

A B B CO ST

NO C ZY A B B CD ST YNM NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

1542

A BIBICO 2ND

NO 23IK H B Y N K NEWTOWN RANGALORE PIN CODE: 560014, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

1543

SHIUAMINDUSTRIES AMITHPARSURAM
NO962

SINGASANDR HDSURROAD RANGALORK PIN CODE: 560068, STD CODE: NA , TEL NO:
51119675, FAX NO: NA, E-MAIL : N.A.

2002

51 - 100

1530

KAUITHA INDUSTRIAL

MAHADIUAPURA POS DIUASANDRA INDUSTRIAL ARIA BANGALORE 48 PIN CODE: 560048, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1531

MAGARI ELECTRONICS PVT LTD

DBVASANDRA NDUSTRIAL AREA MAHADFVAPURA POSIIBANGALORE 48 PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1532

***

1533

INDIAN IN NDUSTRIES OLD MADRAS


ROAD

1534

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

115

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2002

(5)
51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

NO 435 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 51170983, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

TULSIYAN NEC LTD

NO 477 E 4 PHASE13SCROSS PEENYA INDUSTRIA L AREA


BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: 22200816, E-MAIL : N.A.

NA

51 - 100

1549

NAPTHA AND RESINS CHEMICALS PV


LTD

NO 491 PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28361716, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1550

SPILE OILS PUT LTD

NO K9O 4 PHASE E4 CROSS SEENYA INDUSTCCA L AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28362916, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1551

E TA ECHNOLOGIES PV LTD

N0 484 A 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: 51171481, E-MAIL : N.A.

NA

51 - 100

1552

ELASTREX POLYMERS PV LTD

NO 398 4 PHASE 10CROSS PEEYA INDSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: 11, TEL NO: 28362231, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1553

***

NA

51 - 100

1554

SHARMA NDUSTRIES

DEVASANDRA NDUSTRIAL ESTATE YAHKDEVAPURA POST SINGHYANAPALYA BANGALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1555

YK PANDEY

ITI FACTORY DOORVANINAZAR BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1556

GEM PAINTS PVT LTD

PLOT NO 281 PEENYA ,


28395238, E-MAIL : N.A.

1984

101 - 500

1557

MANJEEL INDUSTRIAL

NO 279 PEENYA INDUSTRIAL AREA 4 PHASE BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: 28395999, FAX NO: NA, E-MAIL : N.A.

1985

101 - 500

1558

263 3 RATHAN MAN INDUSTRSES

263 3 PENYA NDUSTRIEL AREA 4 PHASE BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 3720497, FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

1544

SHIBACONTAINERS PV LTD

1545

***

1546

***

1547

SOUTH INDIA WIRE PRODUCTS

1548

KSSIDC KHB YELAHANKANEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560016, STD CODE: NA , TEL NO:

PIN CODE: 560058, STD CODE: NA , TEL NO: 8395238, FAX NO:

116

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1559

S G EXPORIS AND INDUSTRIES

N3 RD CROSS VIDYANAGARA DASARAHALL BANGALORE PIN CODE: 560057, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

101 - 500

1560

CHHAPERTA ELECTRO COMPONENTS


PVT LTD

NO 270 PEENYA INDUSTRLCL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1561

FAROOKAHAMADSHARIF
WATCHFACTORY SINGASADR

SINGASANDRA COUNTRYCLUBROAD BANGALORE ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

1562

PRAPULLA NTERNATIONAL

BANGALORE H S R AGARA PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1998

101 - 500

1563

RAMESHUPADHYAYA

ROLEXLOGISTICS PVT LTD HOBURMAINROAD SINGASANDRA BEGURHOBLI BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 90206897, FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1564

VERTS CAPE NFORMATION


ECHNOLOGY

RENNIGANA HALL OLD MAARAS ROAO DOORVANINAGAR RANGALORK PIN CODE: 560016,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

1565

MR HARDEEPSINGH QUALITY LEATHER


GARMENTS

INDUSTRIAL AREA BEGUR ROAD BOMMANAHALL BANGALORE 68 PIN CODE: 560068, STD
CODE: 25732, TEL NO: 157, FAX NO: 157, E-MAIL : N.A.

2003

101 - 500

1566

HARISH

AEC OF SHORETRADEING PVT LTD I72/ 3 SRINIVAS NDUSTRIAL ESTATE B G ROADBLORE PIN
CODE: 560076, STD CODE: 91805, TEL NO: 1202260, FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

1567

JAHANGIR NEST MAGNETICS PVT LTD

N018 BLOCKS GARVEBHAV PALYA MUNIYAPPA LAYOUT HOSUR MAIN ROAD BANGALORE 68
L PIN CODE: 560068, STD CODE: 080, TEL NO: 51115451, FAX NO: 5115452, E-MAIL : N.A.

NA

101 - 500

1568

***

NA

101 - 500

1569

SAMI LAB PLTD NOI9/12NDPHASE

PEENYA NDLARIA BANGALORE 56OO58 ,


FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1570

SHAKTHIHITEKIPALIMARS PLTD NOI8/A

2NDPHASE PEENYA INDALARIA BANGALORE 58 ,


NO: 28395078, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560058, STD CODE: NA , TEL

NA

101 - 500

1571

GLASTRONIKS PART NO2IE2 2NDPHASE

PEENYA NDLAREA BANGALORE 56O058 ,


, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560058, STD CODE: NA , TEL NO: NA

NA

101 - 500

1572

J C R DRIL WORK PLTD NO 2OB 2PHASE

PEENYA NDLAREA RANGALORE 56OO58 ,


, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560058, STD CODE: NA , TEL NO: NA

NA

101 - 500

PIN CODE: 560068, STD CODE: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560058, STD CODE: NA , TEL NO: NA ,

117

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1573

ESKAY INDUSTRIES

NO 445-444 4 PHASE PEENYA INDSTRIALAREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362243, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1574

STANDARD SCREWS NDUSTRIES

NO 471 4TH PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28360515, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1575

BENTLEY AND RENINGION PV LTD

NO 473 C 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51272086, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1576

ACCUTECH ENTERPRISES

NO 45O 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28363690, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1577

ATALANTA PUMPS PVT LTD

NO 487 D1 D2 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28360564, FAX NO: 28360569, E-MAIL : N.A.

NA

101 - 500

1578

STAR LINE PACKERS PV LTD

NO 49DE 4 PHASE 14 CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28366822, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1579

BHARATSTEELWIREPRODUCTS
FRANCLINJOSE

8MILEROAD HOSURMAINROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
25731763, FAX NO: NA, E-MAIL : N.A.

1972

> 500

1580

VEERANARAYAN GATY LTD


SINGASANDRA

ACER NDIA PVT LTD BANGALORE ,


NO: NA, E-MAIL : N.A.

1995

> 500

1581

SHABEENABANU

SHANTHIPALIPACKSLIMITED 7MAIN ARAKEREVILLAGE BGROAD BANGALORE PIN CODE:


560076, STD CODE: NA , TEL NO: 57668094, FAX NO: NA, E-MAIL : N.A.

1997

> 500

1582

K MOHAN & COMPANY EXPORTS PVT


LTD

NO A 52 & 6 BEGUR HOBLI HOGASANDRA HOSUR ROAD BANGALORE 68 PIN CODE: 560068,
STD CODE: NA , TEL NO: 25722138, FAX NO: NA, E-MAIL : N.A.

1998

> 500

1583

PRAGAT AUTOMOTION PVT LTD NO 4I3


414

4 PHASE IO CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28361543, FAX NO: NA, E-MAIL : N.A.

1998

> 500

1584

MRHARISHKOUJIYA

NO63/INDUSTRIALESTATEKODICHIKKANAHALLI BOMMANAHAL BANGALORE PIN CODE:


560068, STD CODE: 91080, TEL NO: 25732063, FAX NO: 5732269, E-MAIL : N.A.

2001

> 500

1585

SANDEEP AUTO HETECH PRIVATED


LIMITED

NO-96 DODDAM DEVASTANA HULIMAVU B G ROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

> 500

1586

R.MOHAN HTM LTD NO.614


VAJPAYENAAGAR

BOMMANAHALLI HOSUR MAIN ROAD BANGALORE 68 ,


TEL NO: 25732520, FAX NO: 25731592, E-MAIL : N.A.

NA

> 500

PIN CODE: 560006, STD CODE: NA , TEL NO: NA , FAX

118

PIN CODE: 560068, STD CODE: 080,

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1587

SRI LAKSHM FROFILE

NO 47I D 2 4 PHASE PEENVA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362451, FAX NO: NA, E-MAIL : N.A.

NA

> 500

1588

MICROLOGIX ND 453 B 4 PHASE

PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
57127218, FAX NO: NA, E-MAIL : N.A.

NA

> 500

1980

10 - 50

NIC 2004 : 2212-Publishing of newspapers, journals and periodicals


1589

NO250 3RD MAIN ROAD PAMPAMAHAKAV


ROAD CH

AMARAJAPET BANGALORE 18 ,
NA, E-MAIL : N.A.

1590

BALACHENDRA

RAJAHANHS ENTERPRESE 4MAINROADAINDASTRIAL TOWN RAJAJINAGAR BANGALORE PIN


CODE: 560044, STD CODE: 080, TEL NO: 23357070, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

1591

***

JAYANTHI DOMESTC PRODUCTS PRAVEA LIMFTED 9THCROSS DHODDANNA NDUSTRIES


ESTATESNEAR PIN CODE: 560091, STD CODE: 83639, TEL NO: 26, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1592

ABHIMANI PABLICATION

SG A CROSS W N BLOCK KRISHNAMURTHY GARDEN RAJAJINAGAR BANGALORE PIN CODE:


560010, STD CODE: NA , TEL NO: 56909619, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1593

CHELUVARAJ NADIN BADAVANE


BANGALORE

NA

10 - 50

1594

DAILY NEWS PAPER PUBLICATIONS

LAVRLEE ROHD QICWMONOCIRCLE BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1595

KERALA KAUHUDI MALAYALAM DAILY

43O9 HIGH POIN IV 45 PALACE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 2261518, FAX NO: 2288640, E-MAIL : N.A.

NA

10 - 50

1596

VIJAYAKUMAR

9UNITEDNEWSOFINDIATHIMMAIAHROADMILLERTAN BANGALORE52 PIN CODE: 560052, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1597

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1598

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1599

TIMES OF NDIA PRINTING PRESS

NA

10 - 50

1600

***

NA

51 - 100

PIN CODE: 560018, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

IPHASE PEENYA ENDUSTRIAL AREA BANGALORE ,


NO: 28371036, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: 560058, STD CODE: 080, TEL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

119

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
1601

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
IU BINDU MEW PAPER BHAYWAN
MOHAVEGR

(3)
IMFANTRY ROAD BANGALORE ,
FAX NO: 22864052, E-MAIL : N.A.

PIN CODE: 560001, STD CODE: NA , TEL NO: 22804240,

Year of start of
Operation

Employment
Class

(4)

(5)

1800

101 - 500

NIC 2004 : 2213-Publishing of recorded media


1602

MR SRINIVAS

AU IOCD INDUSTRIAL SUBRUB YESWANTHPUR BANGALORE PIN CODE: NA , STD CODE: NA ,


TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1603

LAKSHM TOOLS AND COMPONENTS

DEVASANDRA NDVSTALALESTATE SINGNYANAPALY A BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 2219-Other publishing


1604

EAST WES BOOKS MADRAS PRIVATE


LIMITED

58/2FIRS FLOOR SRAJA BHAVAN BULL TEMPLE ROAD BASAVANAGUD BANGALBRE PIN
CODE: 560019, STD CODE: NA , TEL NO: 26606048, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1605

JAYPEE BROTHERS MEDICAL


PUBLISHERS LTD

NO 2O2 BATAVIA CHAMBERS KUMARA PARK EAST 8 KUMARA KRUPA ROAD BANGALORE PIN
CODE: 560001, STD CODE: NA , TEL NO: 22285971, FAX NO: 22281761, E-MAIL : N.A.

1993

10 - 50

1606

HIMALAYA PUBLISHING HOUSE NO


10/1FLOOR

NEXT O HOTEL HIGH LANDS MADHAVA NAGAR RACE COURSE RAAD B-1 PIN CODE: 560001,
STD CODE: NA , TEL NO: 22281541, FAX NO: 22286611, E-MAIL : N.A.

2003

51 - 100

NIC 2004 : 2221-Printing


1607

PRITHV FABRICATIONS

189/I 2CROSS11MAIN 3PHASE PE3NYA INDUSTR IAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28394952, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

1608

HARISH PRINTING DORES

9 HAMAKSHI EMPLE DORES COTTONPE BANGALORE PIN CODE: 560053, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

1609

M/S R P NASRAT AKSHARA PRINTERS

54/4 POLICE STATION ROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA ,
TEL NO: 26524897, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

1610

PARTHA SARTHY R

NO-I2 INDUSTRIALESTATE RAJAJINAGAR BANGALORE 44 PIN CODE: 560044, STD CODE: NA ,


TEL NO: 23305246, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1611

H C VISHWANATHH BABU

NO64 RAJAKUMAR ROAD N BLOCK RAJAJINAGAR BANGALORE 1O PIN CODE: 560010, STD
CODE: NA , TEL NO: 57623399, FAX NO: 23320275, E-MAIL : N.A.

1989

10 - 50

120

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1612

MAHALAKSHM PRINTERS

# 3/3, 72 CROSS, 18TH MAIN, 5TH BLOCK, JEDAHALLI, RAJAJINAGAR BANGALORE PIN CODE:
560010, STD CODE: NA , TEL NO: 23110117, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1613

COMMERCIAL AND ENGINEERING


RADING

COMPANY, NO 32 KALYANI GARDEN N R COLONY BANGALORE PIN CODE: 560050, STD CODE:
NA , TEL NO: 26769770, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1614

NO3/10MKAROFSETPRINTERSISTMAINR
OADNEWTARA

GAPETCHAMARAJAPETBANGALOREI8 ,
FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1615

ADHITHYA PRINTERS

H RAMANJANEYA ROAD HANUMANTHNAGAR BANGALORE PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1616

***

NATIONAL PRINTING PRESS NO 580 KR GARDEN KORAMANGALA BANGALORE PIN CODE:


560095, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1617

HARIPRASAD

PADMAMBHA ENTERPRISES COMPUTER FORMS NO2/31 8THMAINROAD SHIVANAGAR


BANGALORE PIN CODE: 560010, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1618

LOTUS

LOTUS32 25 2NDMAINROAPINDSTRIALTOWN RAJAJINAGARA BANGALORE 56OO44 PIN CODE:


560044, STD CODE: NA , TEL NO: 32099090, FAX NO: 23387378, E-MAIL : N.A.

1991

10 - 50

1619

S SURFSH

NO 3 NGR LAYOUT RUPENAAGRAHARA MADIVALA POST HOSUR ROAD BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 57626806, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1620

NAVAKARNATAKA PRINTERS

6B XMAIN3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28397426, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1621

HM SWAMY

DORESANIPALYA BGROAD BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1622

NOI52, 2O MAIN JAI BHIMANAGAR BTM


LAY OU

OID MADIWALA BANGALORE PIN CODE: 560029, STD CODE: NA , TEL NO: 26680913, FAX NO:
NA, E-MAIL : N.A.

1993

10 - 50

1623

SHREE DOMENIC MUDRANA


KARYACHARANE

KANAKADASA LAYOU (MAIN ROAD) GOPALASWAMY TEMPLE ROAD BANGALORE 560084 PIN
CODE: 560084, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

1624

RUPPAK K 2NDCROSS 2ND MAIN

RAMAMOHAN PURAM BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO: 98450577,
FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1625

RAMESH

11/64 MAIN 5CROSS NDUSTRIAL TOWN BANGALORE PIN CODE: 560044, STD CODE: 080, TEL
NO: 23305720, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

PIN CODE: 560018, STD CODE: NA , TEL NO: NA ,

121

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1995

10 - 50

1626

PRINCE WORTH

NOG ZND CROSS LALAHAGH ROAD BANGALORE ,


NO: 56984355, FAX NO: NA, E-MAIL : N.A.

1627

RAJA PRINTIN PRK

Z O K S G R EN LA BAGH ROA BANGAL RE PIN CODE: 560027, STD CODE: NA , TEL NO:
22234066, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1628

SRINICE PACKIMIRAMBIKAIPRINTING
PRESS

AUROBINDO COMPLEX JP NAGAR 1STPHASE 31ST MAIN 9TH CROSS BANGALORE PIN CODE:
560078, STD CODE: NA , TEL NO: 26655766, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1629

SAINIVASA ENTARPRISES

NB1 ICROSS PILLAMMA BLOCK SRIRAMAPURA BANGALORE ZI PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1630

FUT3RA DIGITA COLOUR PRESS

K N SHIVAKUMAR 4_4 3RD MAIN ROAD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL
NO: 26764467, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1631

PRINTING PRESS G S L V COMPLEX LINK


ROAD

SHESHADRIPURAUH BANGALURE 20 ,
NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: 1, TEL NO: 23347526, FAX

1996

10 - 50

1632

WINTEK FLEXO PRINTS

B_02A BRIGADE M M K R ROAD YEDIYUR BANGALORE PIN CODE: 560082, STD CODE: 09180,
TEL NO: 26764415, FAX NO: 26761037, E-MAIL : N.A.

1996

10 - 50

1633

PAWAN MARU SAROJA PRINTERS NO43


6TH CROSS

AYYAPPA TEMPLE STREE SUDHAMA NAGAR BANGALORE PIN CODE: 560027, STD CODE: NA
, TEL NO: 22278915, FAX NO: 22210085, E-MAIL : N.A.

1997

10 - 50

1634

EXECUTIVE PRIN GROUP HV SANTOSH


SRJNJVAS

ND Z SRD CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22293452, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1635

EXECUTIVE PRIN GROUP H V SANTOSH


SRINIVA

WO12 3RD CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL
NO: 22122533, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1636

SHARADHA PRASAD GANESHA MARUTH


PRINTERS

NO. 76, 7TH H MAIN, 3RD BLOCK, THYAGARAJANAGAR, BANGALORE PIN CODE: 560028, STD
CODE: NA , TEL NO: 26766340, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1637

UNNIKRISHNAN
HRUPTITEXTILEPRINTERS

COUNTRYCLUBROAD SINGASANDRA HOSURROAD BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 25731135, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1638

VIDYANANDA

SUSHEEL ENTERPRISES NO 42 VIRA NAGAR BOMMANAHALLI BANGALORE PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1639

ELLORA PRINTERS PRIVATE LIMITED

177/4A BILEKAHALLI BG ROAD DOLLERS COLONY BANNERAGHA A ROAD BANGALORE PIN


CODE: 560076, STD CODE: 00080, TEL NO: 26584542, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL

122

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)
,

Year of start of
Operation

Employment
Class

(4)

(5)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1640

***

1641

MAA PRINTERS

NO 3 5 HMAIN SAMPIGELAYOU PATTEGARAPALLYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: 23286128, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1642

NAGASUNDARA GEETHANJAL GRAFICS

NAGASUNDARA GEETHANJAL GRAFICS GOKULA EXTENSION BANGALORE MSRSNDSTREEYAL


PIN CODE: 560054, STD CODE: NA , TEL NO: 23601407, FAX NO: 23607430, E-MAIL : N.A.

2000

10 - 50

1643

AV SHOBHAPRENTECH

ZT02NEARBHANUNURSZNGHOME BOMMANAHALLIBANGALORE PIN CODE: 560068, STD CODE:


19180, TEL NO: 25732266, FAX NO: 266, E-MAIL : N.A.

2001

10 - 50

1644

S V K PRIN FAX PRIVATE LIMITED

#148 B CORPORATION SITE NO 25/5INDUSTRIAL SUBURB YASHWANTHPURIBANGALORE 22


PIN CODE: 560022, STD CODE: NA , TEL NO: 23477362, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1645

DIGITAL WORLD

55 RAILWAY PARALLEL ROAD KUMARAPARK WEST BANGALORE 20 PIN CODE: 560020, STD
CODE: NA , TEL NO: 23566644, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1646

KALPANA PRINTERS

NOGI 1CROSS JAKKASANDRA INDUSTRIAL LAYOU KORMANGALA BANGALORE PIN CODE:


560034, STD CODE: NA , TEL NO: 25524375, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1647

CTHENIC COLLECTIONS 4I 8 CROSS

MUNIREDDY LAYOUT MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN CODE: 560060,


STD CODE: NA , TEL NO: 25734745, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1648

MURULI PRINTING FABRIC WORKS


BELMARESTATE

NAGASANDRAPOST BANGALORE ,
FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1649

SATISH KALA PRINTERS

7THCROSS SHIVANAGAR MAIN ROAD BHOVICOLONY BANGALORE PIN CODE: 560010, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1650

PRASAD PRINTERS MAHADEVAPPA

H CROSS SHIVANAGAR BOVICOLONV PIN CODE: 560010, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

10 - 50

1651

ASHORA RADING

2OI ANNIYAPPA GALL COTTONPE RANGACERE PIN CODE: 560053, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1652

R AAIYU

SHIVGAMI BINDING WORKS 7/2 CHALVADIPALYA GOOD SHED ROAD BANGALORE PIN CODE:
560053, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1653

KRISHNAPPA

NO 1/1 B MADALANE 3RD CROSS DR TCM RAYAN ROAD BANGALORE PIN CODE: 560053,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1654

***

NA

10 - 50

PIN CODE: 560073, STD CODE: NA , TEL NO: 56903752,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

123

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1655

BASKAR PRINTING PRESS

NO99 1FLOOR BA MAINROAD NRCOLONY MURUGESHPALYA BLORE PIN CODE: NA , STD CODE:
NA , TEL NO: 57628290, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1656

SAMYUKTA KARNTTAKA

KARIYAPPA ROAD BANGALORE ,


NO: NA, E-MAIL : N.A.

NA

10 - 50

1657

ST JOSEPHS PRESS STORES

RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

1658

***

NA

10 - 50

1659

PRESS TRUS OF NDIA

NO G QUEENS ROAD BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 22266716,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1660

JYOTHI KANAL PRINTERS

#19 3 CROSS 17 E CROSS ROAD INDIRANAGAR BANGALORE PIN CODE: 560038, STD CODE:
NA , TEL NO: 25259891, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1661

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1662

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1663

SHARAFF PUBLISHER & DISTRIBUTOR

NO 7 SHARADA COLONY 8 MILE BASAVESWARANAG ARA BANGALORE PIN CODE: 560079,


STD CODE: 080, TEL NO: 51287392, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO4 PLATFORM ROAD SESHADRIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA , TEL
NO: 23443797, FAX NO: 23363959, E-MAIL : N.A.

NA

10 - 50

1664

A NATARAJ MANAGING DIRECTOR

PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1665

SHARTH LEAD PRINTERS NO12


CAUVERY LAY OU

HOSUR MAIN ROAD BANGALORE PIN CODE: 560029, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

1666

HANUMANTHAPPA SHASHIKIRAN PRIN


AND PACK

HINDUSTAM LTD MAGAOIIMADN ROAD V N POST SUNKADAKA E BANGALOREGQI PIN CODE:


060091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1667

G K PRESS COMPONENTS

DEVASANDRA NDUSTRIAL AREA SINGHYANAPALYA BANGALORE 48 PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1668

CHIEFLIBRAIAN
BAAGALOREUNIUESITYCOMPLEP

JGNGABHARATH BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: 22961037, FAX
NO: NA, E-MAIL : N.A.

NA

10 - 50

1669

VIJAYASANKESHWARA

PANTHARAPALYA NAYANDAHALL MYSORE ROAD BANGALORE PIN CODE: 560039, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

124

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1670

RASTROTHANA SAHITHYA

KESHAVA SHILPA KEMPEGOWDANAGAR ROAD BANGALORE I9 PIN CODE: 560019, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1965

51 - 100

1671

EXEL METAL ENGINEERING PVT LTD

NO 34O 4 PHASE PEENVA TNDUSTRSAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360216, FAX NO: NA, E-MAIL : N.A.

1969

51 - 100

1672

SAIRSECURITY PRINTEES LTD

FLOT 2S6 4 PHASE 8 CROSS PEENYA NDUSTRTAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1970

51 - 100

1673

MOHAN SALIYANA

MANGALA OFF SE PRINTERS PRIVATD LIMITED NO344/1 6CROSS N S PALYA BANGALORE-76


PIN CODE: NA , STD CODE: 26685, TEL NO: 101, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

1674

SHEELA J MIRJI

BENAKA PRINTING PRESS #42/33SARVAGOMANAGA BILEKAHALL BANNERUGATTA ROAD


BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

1675

SUDHINDRA PRIN NG PRESS

B CROSS MALLESHWARAM RANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO:
23441247, FAX NO: NA, E-MAIL : N.A.

1984

101 - 500

1676

DIRECTOR BANGALORE SUB MARIN


PRESS RVPOS

MYSORE ROAD BANGALORE ,


NA, E-MAIL : N.A.

1988

101 - 500

1677

PRAKASH

NO IGB PEENYA IPHASS NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: 080,
TEL NO: 28396227, FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

1678

KOHINOOR PRINTERS P LTD

KOAINOOR PRINTERS P LTD 3 CROSS RAGANENDR A LAYOUT Y PR BANGALORE PIN CODE:


560022, STD CODE: 080, TEL NO: 23379483, FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

1679

MACMILLAN INDIA LIMITED

SALARPURIA CITADEL, 3 HOSUR ROAD ADUGOD BANGALORE-SGOO3O PIN CODE: 560030,


STD CODE: NA , TEL NO: 56909993, FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

1680

ALDHA PRINTS

H41 FLOWER GARDEN BHEL OPPOSITE MYSORE ROAD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

1681

MANAGER

GOVTPRINTIGINDUSTRIS A419 PEENYAIDUSTRIAL ARIA BANGALORE PIN CODE: 560058, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1682

MANUKULA PRINTERS AND


PUBLISHERS PRIVATE

LIMITED NO 874 DR M C ROAD WCROAD MAHALAKSHMIPURAM BANGALORE PIN CODE:


560086, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1683

GOVT CENTRAL PRESS

#6A KIADB BUILDING PEENYA IPHASE BANGALOR E PIN CODE: 560058, STD CODE: 080, TEL
NO: 23721044, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO:

125

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
1684

STATE : KARNATAKA

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(2)

(3)

NO 2 ANAND PRINTING FACTARY IS


MAIN

(4)

CHIKKA ADUGODI HAVAREKERE MAIN ROAD BANGALORE PIN CODE: 560029, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

Employment
Class

(5)
101 - 500

NIC 2004 : 2222-Service activities related to printing


1685

KHAILASHPODDAR KARTOPRINTS PVT


LTD NO1936

CARTOPRINTS PV LTD NO193/6 N S PALYA BANNERGHATTAROAD BANGALORE PIN CODE:


560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

1686

GIRISH GINDIVG WORKS

22 KAMAESH TEMPLE STREE IND CROSS COTTONPE BANGALORE PIN CODE: 560053, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

1687

PURUSHOTTAM BINDING WORKS

KAMAKSHI EMPLE STREET COTTONPE BANGALORE PIN CODE: 560053, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

1688

SRINIVAS BINDING

29 KAMAKSH TEMPLE STREE 2ND CROSS CO ONPE BANGALORE PIN CODE: 560053, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1689

PAWAN MARU DZG AL COLOUR


PRSNTLNG

NO 4O ANNIPVRA MAIN ROAD SVDHAMAKAGAR BANGALORE PIN CODE: 560027, STD CODE:
NA , TEL NO: 51245931, FAX NO: 22215085, E-MAIL : N.A.

1995

10 - 50

1690

CHANDRU OFFSET PRINTS

#1326/8 KAMAKSHIPALYA CAUVERY NAGAR MAGADI MAIN ROAD BANGALORE PIN CODE:
560079, STD CODE: NA , TEL NO: 23482452, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1691

THOLAS PRINTS NDIA PVT LTD

NO 4 PLATFORM ROAD SESHADRIPURAM BANGALORE PIN CODE: 560020, STD CODE: 00080,
TEL NO: 3443797, FAX NO: 3363959, E-MAIL : N.A.

1995

10 - 50

1692

VLNKATESH ROOA BENDING WORKS

COTTONPE MAIN ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1997

10 - 50

1693

RAJESWAR BINDING WORKS

2O RAMAESH TEMPLE STREE CO ONPE RANGALORE PIN CODE: 560053, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1694

CHANDRASHEKARA NO SC
ENTERTPRISEPRINTIN

G ANDI PAKENG WORKETS MS RAMIAM SNDUSTRI AL ESTATE GO KULTA BANGALT


CODE: 560054, STD CODE: NA , TEL NO: 23608442, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1695

KRISHNNA

INNOUD PRINTINGAND PACKING 4017 2NDMAIN ROAD RAJAJINAGARA INDUSTRIALTOWN BLORE


44 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1696

BHARATHI PRINTERS

NOKG41 3THMAINRDAD BB LAKFHMINARBYANAPUR A OANGALORE PIN CODE: 560021, STD


CODE: NA , TEL NO: 98808480, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

126

OT PIN

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1697

UTTAAA RANINM AND SOFTUERE

NO IS 59TH CYOSS HTH BLOCK RAJATINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA
, TEL NO: 23108822, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1698

MURULI

MURULIINDSTIRISNO4CRDSS4MATNROAD NDASTIR IL TOWN RATAJINAGAR BANGALORE PIN


CODE: 560044, STD CODE: 080, TEL NO: 23110419, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1699

GB PATEEL PRINTING PRESS

1496 3CROSS MARIYAPPANA PALYA BANGALORE 560021 PIN CODE: 560021, STD CODE: NA
, TEL NO: 56990916, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1700

CHAITANYA GRAPHICS

NO29/I HANUMANTHA NAGAR MAIN ROA HANUMANTHA NAGAR BANGALORE G PIN CODE:
560019, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1701

***

NA

10 - 50

1702

MANAGER

NARASIMHA GRAPHICS NCC305PEENYAINDUSTRIAL ESTATE BANGALORE 560058 PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1703

SRI VARANA PRINTERS

NO IGA STH MAIN CHAMRAJPET BANGALORE PIN CODE: 560018, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1704

RITECH PERIPHERALS

GS STH CROSS MALCESWARAM BANGACORE PIN CODE: 560003, STD CODE: NA , TEL NO:
51281355, FAX NO: 51281359, E-MAIL : N.A.

1996

51 - 100

1705

SADANANDSINGH

NO41,42,N S PALYA 2MAINROAD BANNERGHATTA ROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1998

10 - 50

NA

51 - 100

1970

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2230-Reproduction of recorded media


1706

DAYANANDA

KODEX LTD CO 3RDCROSS RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: 080,
TEL NO: 23115303, FAX NO: NA, E-MAIL : N.A.

1707

RNNGANATH

NO I 9 MAIN R M V FXTENTION SADHASHIVAAA GAR BANGALORE C2 CROSS1 PIN CODE:


560080, STD CODE: 080, TEL NO: 51137839, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2320-Manufacture of refined petroleum products


1708

SRESHANKRASERVICESTATION

AUTHORIZEDEALERS BHARATHPETROLIEMCORPORA IONLTD8THMAINROADMALLESHWARAM


BANGALORE PIN CODE: 560055, STD CODE: NA , TEL NO: 23341216, FAX NO: NA, E-MAIL :
N.A.

127

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
(3)
NIC 2004 : 2411-Manufacture of basic chemicals except fertilizers and nitrogen compounds

Year of start of
Operation

Employment
Class

(4)

(5)

1709

AHAMED KOYAS

MS PALYA BANGALORE PIN CODE: 560097, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1990

10 - 50

1710

C MURUGAN DYEING

NO7 ANKALLAPPA MUTH ROAD CHICKPET BANGALORE PIN CODE: 560002, STD CODE: 00080,
TEL NO: 22273777, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1711

SAIN JOHN

6TH CROSS TAVAREKERE BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560029, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1712

PRAKASH SAREES PROCESSING 2ND


CROSS

CHIKKA ADUGODI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

1713

RAMU COLUR FACTORY

SINGASANDRA BANGALORE ,
NA, E-MAIL : N.A.

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO:

2002

10 - 50

1714

RAMLAKSHMAN COLURFACTORY
SINGASANDRA

HOSURROAD BANGALORE ,
E-MAIL : N.A.

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,

2003

10 - 50

1715

SRINTVASA

STH CROSS TAVAREKERE BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1716

***

NA

10 - 50

1717

DR G P SHE Y

1996

51 - 100

PIN CODE: 560029, STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

KARNATAKA AGRO CHEMICALS MANASA NAGARA NAGARABHAV NAGARABHAV POST


BANGALORE PIN CODE: 560072, STD CODE: NA , TEL NO: 23212438, FAX NO: NA, E-MAIL :
N.A.

NIC 2004 : 2412-Manufacture of fertilizers and nitrogen compounds


1718

MADRAS FERTILIZERS LIMITED

878/A 9MAIN 4TH BLOCK JAYANAGAR BANGALORE-11 PIN CODE: 560011, STD CODE: NA ,
TEL NO: 26554370, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

1719

KPKWCOMPANY CHARTERED
ACCOUNTANTS

VVROAD BASAVANAGUD BANGALORE_O4 ,


2660687, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO:

NIC 2004 : 2413-Manufacture of plastics in primary forms and of synthetic rubber.


1720

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

128

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 2421-Manufacture of pesticides and other agro chemical products


1721

GONAPAIHIBAXIR

NOIODODOANNAINDIESTATE PEENYA2STAGE BANGA LORE PIN CODE: 560091, STD CODE:


28361, TEL NO: 782, FAX NO: NA, E-MAIL : N.A.

1960

10 - 50

1722

ONWARD ENGINEERS

AOI HM INDUSTRIAL ESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28385834, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1723

KANTHARAJU NAPTHA CHEMICAL PVT


LTD NO 482

4PHASE PEENYA INDUSTRIAL AREA BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1724

***

NA

51 - 100

PIN CODE: 580056, STD CODE: NA , TEL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2422-Manufacture of paints, varnishes and similar coatings, printing ink and mastics
1725

BOHRA FABRICATORS

MUTACHAR INDUSTRIAL ESTATE NAYNDAHALLI MYSORE ROAD BANGALORE PIN CODE:


560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1726

S S INDUSTRIES

NO 4 FIRST CROSS LIDKAR COLONY KADUGONDANAHALLI BANGALORE 560045 PIN CODE:


560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1727

B N GUPTA

ANIA GUNDUTHOOP BDMMANAHALL BANGALORE PIN CODE: 560068, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1728

MANAGER

CITYCOTS NO3IB PEENYA INDASTRIAL ESTAT BANGALORE SGOOSB PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1729

***

NA

10 - 50

1730

SHIVANATE GOWDA

DO NO 15 ANJANEYA TEMPLE STREE BANGALORE PIN CODE: 556002, STD CODE: NA , TEL
NO: 51327404, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1731

VINPLA PLATING PVT LTD

NO4 2 MAIN VASUNDARA COMPOUND HOSUR ROAD RAJIVGANDHINAGAR BOMMANAHALL


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 25721248, FAX NO: NA, E-MAIL :
N.A.

1988

> 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2423-Manufacture of pharmaceuticals, medicinal chemicals and botanical products

129

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1969

(5)
10 - 50

MAGADI MAIN ROAD KOTTIGEPALYA BANGALORE PIN CODE: 560091, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

GOVT AYURVEDA MEDICAL INSTITUTE

NO29 DANVANTRIROAD GANDINAGAR BANGALORE PIN CODE: 560009, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1735

PURANDARREDDY

PURANDARREDDY PHARMSUTICALS A MAIN RAJAJ NAGAR INDUSTRIAL OWN BANGALORE


PIN CODE: 560044, STD CODE: 080, TEL NO: 23308210, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1736

JYOTHI CHEMICAL INDUSTRIES

486 11 CROSS 8 MAIN 2 PHASE J P NAGAR BANGALORE PIN CODE: 560078, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1737

MR SUBASH PRAHALYA MEDICAL

52I3 NDUSTRIAL SUBRWB YESNANTPUR BANGALORE Z PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1738

JOINCO NKS CHEMICALS DEVASANDRA


NDUSTR

ALESTATE MAHADEVAPURAPOS SINGHYANAPALYA BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1739

SHASHI DISTILLRIES 50/A4 9MILE STONE

BANNERGHATTA ROAD BANGALORE ,


PIN CODE: 560076, STD CODE: 080, TEL NO:
26585072, FAX NO: 26581545, E-MAIL : N.A.

1993

51 - 100

1740

BANGALORE PHARMACEUTICAL
LABORATORY

NO 45-2 9 BLOCK JAYANAGAR EAST BANGALORE PIN CODE: 560069, STD CODE: NA , TEL
NO: 26585207, FAX NO: NA, E-MAIL : N.A.

1978

101 - 500

1741

MKYER HKALTH CARE P LIMITED

NO IOD PEENYA 2 PHASE BANGALORK-58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1996

101 - 500

1742

***

STRIDES ARCOLAL LIMITED DORESANIPALYA BG ROAD BANGALORE PIN CODE: 570076, STD
CODE: NA , TEL NO: 56580521, FAX NO: NA, E-MAIL : N.A.

1990

> 500

1732

MAHENDRA LAB PV LTD

NO 272_371 PEENYA INDUSTRIAL AREA4 PHASE BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362164, FAX NO: 83621641, E-MAIL : N.A.

1733

EMBIOTIC LABORATARILS PRIVATE


LIMITED

1734

NIC 2004 : 2424-Manufacture of soap and detergents, cleaning and polishing preparations, perfumes and toilet preparations
1743

KARNATAKA SOAPS AND DETERGENTS


CDMPANY

P B NO553I YFSHWANTHPUR TUMKUR ROAD BANGACORE SS PIN CODE: 560055, STD CODE:
NA , TEL NO: 23371103, FAX NO: 23370498, E-MAIL : N.A.

1918

10 - 50

1744

KALPANA PERFUMERY WORKS

NO 62 2 MAIN ROAD CHAMARAJPE BANGALORE PIN CODE: 560018, STD CODE: NA , TEL NO:
26604395, FAX NO: NA, E-MAIL : N.A.

1943

10 - 50

130

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1954

10 - 50

1745

R RAJESH PADMA PARFUMARY WORKS

I47 2 MAIN CHAMARAJPET BANGALORE


, TEL NO: 26609454, FAX NO: 26602424, E-MAIL : N.A.

1746

EUROSE PHARMA

#67 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28379197, FAX NO: NA, E-MAIL : N.A.

1967

10 - 50

1747

RAM MOHAN

TRINETRA FROGANS AGARBATTI FACTORY 3RDCRO SS 9THMAIN RAJAJINAGAR 3RDSTAGE


BANGALORE PIN CODE: 560021, STD CODE: 080, TEL NO: 23326576, FAX NO: NA, E-MAIL :
N.A.

1969

10 - 50

1748

SHANKAR PEREUMERY WORKS

NO IO2 ALAKADU SUBBRAO GRLL COTTONPE BANGALORE PIN CODE: 560053, STD CODE:
NA , TEL NO: 22203138, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

1749

SV PRODUCTS MANUFACTURE AND


SUPPLY OF CHA

NDRIKA SOAP NO 332 KACHARKANAHALLI BANGALORE PIN CODE: 560084, STD CODE: NA ,
TEL NO: 25471309, FAX NO: 25475014, E-MAIL : N.A.

1971

10 - 50

1750

CHARU VEAFUMERY HOUSE

ZI CO ONPF MAIN ROAD RANGACORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1975

10 - 50

1751

B R RAGHUNATH

SANKRANTHI AGARABATH CO P B NO T075 I8 Z SUBRAMANYAPURA MAIN ROAD BANGALORE


PIN CODE: 560070, STD CODE: NA , TEL NO: 26661919, FAX NO: 26668746, E-MAIL : N.A.

1975

10 - 50

1752

PATIL PARIMALA WORKS

NO 82 IS MAIN ROAO CHAMARAJ PET BANGALORE PIN CODE: 560018, STD CODE: NA , TEL
NO: 26522479, FAX NO: 26603713, E-MAIL : N.A.

1980

10 - 50

1753

S SAGAR BATH WORKS

14/8 13TH A CROSS PADARAYANAPURA BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

1754

UASANTHASOAPNETWORKS

OPPOSITEKGHALLIPOLICESTATJONKADUGONDANAHA LLIBANGALOREMS PIN CODE: NA , STD


CODE: 54710, TEL NO: 34, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

1755

SUDAKARAGUPTHA N0 204
BLOCK

RAJAJI NAGAR BANGALORE 560010 ,


FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

1756

PARIMALA MANDIR

NO I44 4TH MAIN ROAD 8TH CROSS BANGALORE PIN CODE: 560018, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

1757

CHINNAVARAGARBATHI INDUSTRIES

NO16/111THCROSS PADARAYANAPURA BANGALORE 26 PIN CODE: 560026, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1758

MAHAMAD FASHA RIDDU INDUSTRIES


AGARABA

# 101, IMBER LAYOUT, BANGALORE ,


NO: NA, E-MAIL : N.A.

1989

10 - 50

MAIN 4

5 PIN CODE: 560018, STD CODE: NA

PIN CODE: NA , STD CODE: NA , TEL NO: 23385017,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX

131

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1759

MR REEIAS

AMEERJHON STREET RAMATEMPLE ANEKAL Q BANGALORE SOUTH PIN CODE: 562106, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1760

KAS IVISHNA ATH

ANA THA ARB THIC ROSS SIDD IH OADBAN ALORR PIN CODE: 560027, STD CODE: 22210, TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1761

AMARNARAVANA URINOING
INDUSTREGS

NOISA 1MAIN JPHASF PEENYA INOUSTREAL AREA AANGALORE58 PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1762

CHARU AGARBATH FACTORY

NO.52, 69 CROSS 9TH BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1763

SONYA AGARABATTI KENDRA

KARNATAKA GOVT RAMAKRISHNASEVANAGARA SRIRAMAPURA BANGALORE PIN CODE: NA


, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1764

SRI SUJATHA SUGANDHALAYA

NO IOO 5TH MAIN ROAD 8TH CROSS ROAD CHAMARAJPE BANGALORE PIN CODE: 560018,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1765

RAJ FRAGARENCE

NO I CHAMARAJPET 2ND MAIN ROAD BANGALORE PIN CODE: 560018, STD CODE: NA , TEL
NO: 26613256, FAX NO: 26613758, E-MAIL : N.A.

1995

10 - 50

1766

UMASHANKAR AGARBBTHIS

RAMACHANDRAPURA BANGALORE PIN CODE: 7, STD CODE: NA , TEL NO: 7777, FAX NO: NA,
E-MAIL : N.A.

1996

10 - 50

1767

KRISHNAPPA AGARBATHIS

RAMACHANDRAPURA BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1997

10 - 50

1768

R KHADER

NO 40/26 IOTHMAINROAD BHUVANESHWARINAGARBANGALORE PIN CODE: 560085, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1769

HARISITHAGARABATHINOZOBIZTHCROS
S

BALESE YCOMPOUNDZNDMAINROAD BANGALORE SGOOZG PIN CODE: 560026, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1770

SRRENIVA SUGANDHALAYA 11-12

9TH CROSS NEXT O REHANANIA MASIDI ROAD PADARAYANAPURA BANGALORE PIN CODE:
560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1771

TOPSIPRODUCTS

IO/19THCROSO OPPMAST DEREHMANITE #MROADPADRMYANAPURA PIN CODE: 560026, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1772

AGARBATH FACTORY

LIT 10 CROSS MUDDAPPA GARDEN BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

132

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1773

SRI BHAVAN PARFUMERS

NO I35 8TH CROSS 3 RD MAIN ROAD CHAMARAJA PE BANGALORE PIN CODE: 560018, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1774

SRINTVAS SUGANDHALAYA

9/1 8CROSS MAGADIROAD BANGALORE-23 PIN CODE: 560023, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1775

SUBHAENTERPRISES

NO417THCROSSHOSAHALLIMAINROAD PADARAYANAPURA BANGALORE 26 PIN CODE:


560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1776

M/S GANGA SEMA AGARBATTI WORKS

NO36 GANGAPPA GARDAN 1CROSS KP AGRAHARA


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

BANGALORE PIN CODE: 560023, STD

2000

10 - 50

1777

HABEEB MANZIL 3RDMAIN ROAD


1STCROSS

SHAMANNA NAGAR BANGALORE 26 ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560026, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1778

RAJALAKSHM PERFUMERY WORKS

N 247 3RD MAIN ROAD PB NO 1834 CHAMARAJ PET BANGALORE PIN CODE: 560018, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1779

SETU

NO I2I PIPELINE MAIN ROAD J C NAGAR KURAB ARAHALLI BANGALORE PIN CODE: 560086, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1780

SRI KRISHNA TILES

NO 56 1A MAIN ROAD BANAGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

2002

10 - 50

1781

SATYAMURTI

MANJUNATH NAGAR 4TH MAIN 8 CROSS BANGALORE PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1782

KUMAR

AGARABATTIWORKS 4MAINROAD INDUSTRIALTOWN RAJAJINAGAR BANGALORE PIN CODE:


560044, STD CODE: 080, TEL NO: 23566227, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1783

MATHRUSHREE GRAPHICS

NAGARAJU SIXTH MAIN BAIRAVESHWARA NAGARA NAGARABHAV MAIN ROAD BANGALORE


PIN CODE: 560072, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1784

SATHLSHA

NO IOI 5 MAIN BUVANESHWRINAGARA MAGADIROAD BANGALORE PIN CODE: 560023, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1785

ANANTHAGARBATHICONOI644THMAINR
OAD7THCRDSS

CHAMARAJPETBANGALORE18 ,
NA, E-MAIL : N.A.

2003

10 - 50

1786

PEPADA PRINTS PV LTD

NO8ERIAHNAPALYASRIGANDHADAKAVALVISWANIDUM POST NEAR PAPAREDDYPALYA


BANGALORE PIN CODE: 560091, STD CODE: 56680, TEL NO: 56680497, FAX NO: NA, E-MAIL :
N.A.

2004

10 - 50

PIN CODE: 560018, STD CODE: NA , TEL NO: NA , FAX NO:

133

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

1787

MANAGER

1788

***

1789

HARI OM PRAGRANCE

1790

HARI OM AGARBA

1791

***

1792

GODALRAT

1793

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

NA

10 - 50

NO ZS GTH CROSS 9TH MATN SRIRAMPURA BANGALORE PIN CODE: 560021, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO 26 6TH CROSS SRIRAMPURA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

COTTGNIF MAIN ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

10 - 50

GOPALAKRISHNA

I7 ANNAPPAGALL 3RD CROSS BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1794

SHRI RAMAIAH AGARBATTI FACTORY

NO 1912 6THCROSS CHALUVADI PALYA D TCM ROYAN ROAD BANGALORE PIN CODE:
560053, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1795

ABDUL KHALEEM

VINAYAKANAGAR 3RD CS OLD GUDDADAHALL BANGALORE PIN CODE: 560026, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1796

AGARBATH PRODUCTION FACTORY


MAMU

NOIGG BHAYANINAGAR NEAR MASJIDEQUBA BSK2STAGE BANGALORE TO PIN CODE:


560070, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1797

FOREST PROGRANCE KONANDHERE

NO 3, 9TH MAIN ROAD, KAVERINAGAR- MAIN ROAD, BSK 2ND STAGE, BANGALORE PIN CODE:
560070, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1798

DEVATHA INDASTEES

#2CROSS WILLSONGARDEN BANGALORE ,


22234638, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1799

SHRI AGARABATH MANUFACTURING


AND SALES

AREKEMPENAHALL HOSUR ROAD, BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1800

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1801

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PREM SOAPIFACTARY NO2IA INDUSTRIALARIA U MKUR ROAD BANGALORE PIN CODE:


560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

FACTORY

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO:

134

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

1802

PUSHPANJAL AGARBA

1803

DISTRICT : Bangalore

(3)
KENDRA

Year of start of
Operation

(4)

Employment
Class

(5)

N13 2CROSS PILLAMMA BLOCK SRIRAMAPURA BANGALORE PIN CODE: 560021, STD CODE:
NA , TEL NO: 57667288, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PRTAP

POONAMANSON N86 ICROSS PILLAMMA BLOCK SRIRAMAPURA BANGALORE 2I PIN CODE:


560021, STD CODE: NA , TEL NO: 2253709, FAX NO: 3120612, E-MAIL : N.A.

NA

10 - 50

1804

RAVISE Y

NO 8 5 MAINROAD BUVANESHWARINAGARA MAGADIROAD BANG LORE PIN CODE: 560023,


STD CODE: 1, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1805

***

NA

10 - 50

1806

BABU AGAR BATHI FACTRY

NA

10 - 50

1807

***

NA

10 - 50

1808

KEERTH PARIMALA WORKS

,13/1 IS MAIN ROAD KALAPPA BLOCK RAMACHANDRAPURAM BANGALORE PIN CODE:


560021, STD CODE: NA , TEL NO: 23121061, FAX NO: NA, E-MAIL : N.A.

1975

51 - 100

1809

PADMIN PERFUMED CONES

K KAMARAJ ROAD NO 157 BANGALORE PADMINI@BLR.VSNL.NET.IN PIN CODE: 560042, STD


CODE: NA , TEL NO: 25543480, FAX NO: 25560894, E-MAIL : N.A.

1980

51 - 100

1810

B V ASHWATHIAH AND BROTHERS


AGARBA

NO 36 MAIN ROAD RAMACHANDRAPURA BANGALORE PIN CODE: 560021, STD CODE: 23120,
TEL NO: 769, FAX NO: NA, E-MAIL : N.A.

1983

51 - 100

1811

DARSHAN INTER NATIONAL

NO 125 2ND MAIN CHAMARAJPE BANGALDRE PIN CODE: 560018, STD CODE: NA , TEL NO:
26606771, FAX NO: 26500003, E-MAIL : N.A.

1987

51 - 100

1812

HARI OM FRAGRENCY AGARBATHY


FACTORY

K R HARI OM GUPTHA NO28 9THMAIN ROAD SRIRAMPURAM BANGALORE 21 PIN CODE:


560021, STD CODE: NA , TEL NO: 23125930, FAX NO: 3125634, E-MAIL : N.A.

1994

51 - 100

1813

SARATH PERFUMERY WORKS J P


NAGAR1STPHASE

SARAKK BANGALORE ,
E-MAIL : N.A.

1998

51 - 100

1814

BHARATA AGARBATH FACTORY

NO341/35 CROSS DAYANANDANAGAR SRIRAMPURAM BANGALORE PIN CODE: 560021, STD


CODE: NA , TEL NO: 23128433, FAX NO: 23121620, E-MAIL : N.A.

1965

101 - 500

1815

SATHYANARAYAN

ONAM AGARBATHI PVT LTD NO3536/707INEARBAL AMURIGANESHATEMPLE NSPALYA


BGROADBANGALOR PIN CODE: 560076, STD CODE: 26, TEL NO: 26783958, FAX NO: NA,
E-MAIL : N.A.

1970

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NO 365/22 VENKET SWAMY LAY OUT KORAMANGALA BANGALORE PIN CODE: 560047, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560078, STD CODE: NA , TEL NO: NA , FAX NO: NA,

135

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1816

VINODSHAM SHALIMAR AGARBATTI


FACTORY

NO 32/33 3RD CROSS SRIRAMAPURA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1976

101 - 500

1817

B V ASWATHIAH AND BROS

NAND HOUSE #29 1S CROSS SRIRAMPURAM BANGALORE BVANG@BLR.VSNL.NET. PIN


CODE: 560021, STD CODE: 00080, TEL NO: 23324703, FAX NO: 03325410, E-MAIL : N.A.

1985

101 - 500

1818

P R BALAJI

NO 13/2, I2TH CROSS, BSK 2ND STAGE KADIRENAHALLI, BANGALORE PIN CODE: 560070,
STD CODE: NA , TEL NO: 26663468, FAX NO: 26666468, E-MAIL : N.A.

1997

101 - 500

NIC 2004 : 2429-Manufacture of other chemical product n.e.c.


1819

MANAUAL RAMANNA

KHODAY LIQUIOR NDUSTRIAL SHESHADRIRDAD BANGALORE PIN CODE: 560009, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1948

10 - 50

1820

FINE CHEMICALS LABORATORIES

FINE CHEMICALS KABORHTORIES NO 7 1MAIN ROAD YESHWANTHAPUR BANGALORE 22 PIN


CODE: 560022, STD CODE: NA , TEL NO: 23371511, FAX NO: 23371511, E-MAIL : N.A.

1955

10 - 50

1821

BALAJIINDUSTRY

NO690/J I4MAIN JPNAGAR 2PHASE BANGALORE TARAK_VORA@YAHOO.CO.IN PIN CODE:


560078, STD CODE: NA , TEL NO: 26590451, FAX NO: 26591489, E-MAIL : N.A.

1989

10 - 50

1822

***

NO 29/ 3 MAINROAD STAGE 2NDPHASE GOKULA BANGALORE PIN CODE: 560054, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1823

BLOU MOULDERS TNDTA

NOB MSR INDUSTRTAL EBTATF MATHIKERE BANGALORE PIN CODE: 560054, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1824

MRE LAHBRJ

SHIVBFORM NI35 MAGAD MAIN ROAD KAMAKSHI PALYA BANGALORE PIN CODE: 560079, STD
CODE: 9580, TEL NO: 23489849, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1825

ARIK NTERNATIONAL

A GOWRISHANKAR NO 2/2PATALAMMA STREE ARMUGUMCIRCLE BASAVANAGUDI


BANGALORE PIN CODE: 560004, STD CODE: 080, TEL NO: 26576455, FAX NO: 26571703,
E-MAIL : N.A.

1992

10 - 50

1826

SHASHIDHAR SHE Y

CHEMICALSINDUSTRIES 6OFT ROAD JC NAGAR BO NGALORE PIN CODE: 560086, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1827

KNV AGARABATTI

CORPORATION BUILDING 5 MAIN SRIRAMAPURA BANGALORE PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1828

MANAGER

BANGALORE ACID CAMICALS 11 CROSS PEENYA INDSTRIALARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28374173, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

136

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1829

MANAGER

S CARBONITRATES NO A 145 3CROSS ISTAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1830

MANAGER

JAYANIH CAMICALS NOBJS 2 CROSS STSTAGE PEENYA NDASTRIAL TOWN BANGALORE


SGOO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1831

MANAGER

VINAYAKA MASKITOCAYIL ABGO PEENYAIDOSTRIA L ESTE BANGALORE PIN CODE: 560058,


STD CODE: NA , TEL NO: 28894546, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1832

MANAGER

MYSORE VINAL NDUSTRIES NOC2O1 ST STAGE PCENYA NDASTRIAL TOWN BANGALORE


SGOOS8 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

2000

10 - 50

NA

10 - 50

NA

10 - 50

NA

10 - 50

NIC 2004 : 2430-Manufacture of man-made fibers


1833

GANGADHAR WEAVING LOOMS

1834

***

1835

AJITH

KOTTIGEPALYA MAIN RDAD MAGADI MAIN ROAR BANGALORE PIN CODE: 560091, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

OMDEVSHAKTIPOLYMERS NO57KO IGEPALYA BANGALORE PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2511-Manufacture of rubber tyres and tubes: retreading and rebuilding of rubber tyres
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1836

***

1837

MAHESHWERRAODIRECTOR

DFFICEOFTHECENTRALEXCISEINDDIVISSON KORMANGALAKENORIVASADANBANGALORE PIN


CODE: 560034, STD CODE: 25538, TEL NO: 191, FAX NO: 291, E-MAIL : N.A.

NA

10 - 50

1838

MRRKTHATHUSENTERARCHITCC

SENIORARCHITECT$ 3CENTRALPUBLICWORKSDEPAR TMEN FWING3OFLOORKENRL PIN CODE:


560034, STD CODE: 25506, TEL NO: 334, FAX NO: 355, E-MAIL : N.A.

NA

10 - 50

1839

C MALLINE TOOL PV LTD

NO 485 4 PHASE 13 CROSS PEENYANYA INDUSTR IAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28364000, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1840

VSDENTALCALLEGEANDHOSPITAL

LALBAUGHFORTROADBANGALORE ,
06625793, FAX NO: NA, E-MAIL : N.A.

1841

B.W.S.S.B

NO3.NATIONAL HIGH SCHOOL ROAD,BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560004, STD CODE: NA , TEL NO:

PIN CODE: 560004, STD CODE: NA , TEL

137

1986

101 - 500

NA

101 - 500

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

1842

MADINOWA HOSPATAIL

INFANTRY ROAD BANGALORE-56001 PIN CODE: NA , STD CODE: NA , TEL NO: 22864741, FAX
NO: NA, E-MAIL : N.A.

NA

101 - 500

1843

SUNDHYAKRLSHNAMURTHY
JOINTDIRECTOR REGION

NATTONALSAMPLESURVEYORGANISATLON FIELD
OPERATIONSDIVISIONREGIOWALOFFLCEBANGALORE PIN CODE: 560034, STD CODE: 25538,
TEL NO: 767, FAX NO: 167, E-MAIL : N.A.

NA

101 - 500

1844

BANGALOREMETROPOLITANTRANSPOR
T

#IOOFEET RING ROAD KATRIGUPPE BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1994

> 500

NIC 2004 : 2520-Manufacture of plastic products


1845

SHASHI ELECTRIC COMPANY

B-3 JA BHARATH INDUSTRIES UMKUR ROAD YASHWANTHPUR BANGALORE 22 PIN CODE:


560022, STD CODE: NA , TEL NO: 23373718, FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

1846

DEEPAKSHA NO

SHAPALIMARS MSR SNDUSTRIAL ESTATE GOKULA BANGALORE PIN CODE: 560054, STD
CODE: NA , TEL NO: 23608924, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

1847

BHARATH INDUSTRIAL PRODUCTS

NO 203 4 CROSS LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

1848

FIBRO PLASTIC PV LIMLTED

SG A CROSS 4 N BLOCK RAJAJINAGAR BANGALOR ,


TEL NO: 23125157, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560010, STD CODE: NA ,

1985

10 - 50

1849

PLASTRAWICS

B I8 BEL INDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23452869, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

1850

NO47 3RDMAIN ROAD MYSOREROAD

BANGALORE ,

1987

10 - 50

1851

ASHWAK

PLASTIC INDUSTRY RAILWAY STATION ROAD BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1852

SHELLAYA PLASTICS AND INDUSTRIES


LIMITED

MSR PV INDUSTRIAL ESTATE GOKULA BANGALORE PIN CODE: 560054, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1853

RAM PAL

ROOPA PLASTICK NDUSTRY NAYANDAHALLI RAILNAY STATION ROAA BANGAL RE PIN CODE:
NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

1854

NILKAMAL

2 FLOORMANANDAARCADECOMPLEXSCROAD BANGALORE PIN CODE: 560020, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

138

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1855

HI TECH MOULDERS NDO PACK


PRIVATE LTD

#2 MUIACHARI NDUSTRIALIESTATE NAYANDHAL POST MYSORE ROAD BANGALORE PIN CODE:


560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1856

BALAJI PROCESSORS

PETECHANNAPPA INDUSTRIAL AREA KAAAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1857

RAMA CHANDAA

SK PASTICK NAYNPANAHALL RAILWAY STATION ROAD BANGALORE PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1858

SHIVAPPA

RAILWAY STATION ROAD NAYANDAHALL BANMALORE PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1859

RR PLASTIC 4CROSS
HOSAHALLIMAINROAD

PADARAYANAPUAA BANGALORE 2G ,
FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560026, STD CODE: NA , TEL NO: NA ,

1995

10 - 50

1860

MEERA PLASTICS

G95 KAMAXIPALYA MEENANXNAGAR ,


23488268, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560079, STD CODE: NA , TEL NO:

1995

10 - 50

1861

SWARNA PLASTIC NDUSTRIES N0 17


LINK ROAD

SHESHADRIPURAM BANGALORE ,
NO: NA, E-MAIL : N.A.

1995

10 - 50

1862

VEENUS PLASTICS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 28488907, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1863

M PEE PLASTICS NO 44/1 BEHIND GOVT


SCHOOL

SARAKK JP NAGAR ST PHASE BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560078, STD CODE: NA , TEL NO:

1997

10 - 50

1864

BENAKA PLASTIC NDUSTRIES

NAYANDAHALLI MYSORE RDAD BANGALORE PIN CODE: 560039, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

1865

POLYNATEPOVELS PRIVATE LIMITED

PETECHANNAPPO CNDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23489097, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1866

ROYALPOYPACA

IETECANAPIA NOVSTRIAL AREA KAMAKSHIPALYA BANGIALORI PIN CODE: 560079, STD


CODE: 00080, TEL NO: 2348014, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1867

JUGAL KISHOR

PALSTCK INPUSTRY NAYANDANAHALL RAILWAY STATION ROAD BANMALORE PIN CODE: NA


, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1868

KRISHNA PRECISION PLASTICS PRIVATE


LIMITE

O JPNAGAR 3RD PHASE IS MAIN BANGALORE ,


NO: 6635490, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: 23443247, FAX

PIN CODE: 560078, STD CODE: NA , TEL

139

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Year of start of
Operation

Address / Telephone / Fax / E-mail

(2)

(3)

Employment
Class

(4)

(5)

1869

PLASTIC WORKS NO 12/1 3RDMAIN


ROAD

#1ST CROSS SHAMANNA NAGAR BANGALORE 26 PIN CODE: 560026, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1870

PROPREITOR S VIJAYAN NO 72

P&T COLONY CHOLURPALYA MAIN ROAD BANGALORE PIN CODE: 560023, STD CODE: NA ,
TEL NO: 23502698, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1871

S B ENTERPRISES

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23485756, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1872

MARUTH PLASTIC INDUSTRIE

N053 AZIZSAI INDUSTRIES OWN NAYANDAHALLI MYSORE ROAD BANGLORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1873

MAHESH PLASTIC FACTORY

NOI46 AZIXSAIT NDUSTRIAL TOWN NAYNDAHALL MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1874

ADARSHA PLASTIC

19 SECONDCROSSPRIYADARSHINILAYOOTNAGARABA
VIMAINROAOMOOOALAPALYABANGALORE72 PIN CODE: 560072, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1875

PLAS TNDIA

MUTHACHARI NDVSTRIALIESTATE MYSORE ROAD BANUALORK PIN CODE: 560039, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1876

OSWAL PE INDUSTRIES

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 1080, TEL NO: 23480439, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1877

OSWAL HIGHTECH PRIVATE LIMITED

PETECHANNAPPA INDUSTRIALBAREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 21080, TEL NO: 23480439, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1878

AVONPLAS PVC PV LTD

NO 7/1 4TH CROSS PADARAYANAPURA MYSORE ROAD CROSS BANGALORE PIN CODE:
560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1879

MUZEERSHABUABOULGAF 22 A

FINE PLASTIC NDUSTRIES SLAUGHTER HOUSE SHIVAJINAGAR BANGALORE PIN CODE:


560001, STD CODE: NA , TEL NO: 25573047, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1880

SHFVBOARSHIN

SHIVAFORM #13S MAGAD MAIN ROBD KAMAKSHI GBLYA BANGBLORE


560079, STD CODE: 9580, TEL NO: 23303039, FAX NO: NA, E-MAIL : N.A.

F PIN CODE:

2001

10 - 50

1881

KASTUR POLYMERIS

377/384 KAMAKSHI PALYA BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,

2001

10 - 50

1882

J M C INDUSTRIES

MUTACHAR INDUSTRIAL ESTAIE NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE:


560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

140

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1883

RAMESH PLASTIC FACTORY 2ND CROSS

CHIKKA ADIGUOI BANGALORE PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2001

10 - 50

1884

MAHESH MACSONTFBRE AND PLASTIC


4TH CROSS

CHIKKA ADUGUDI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2001

10 - 50

1885

RAJESH UNIVERSAL PASPAROUS

KOTTIGEPALYA MAIN ROAD BANGALORE PIN CODE: 560009, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1886

LAKSHM PRODUCTS FOR PACKING

MOTTIGEPALYA MAGADI MAIN ROAD BANGALORE PIN CODE: 560091, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1887

PLSCO PALIMAER NDUCTRIES

AO94 METRO LAYOU NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE: 560039, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1888

RUDRESH

NO A 3 CROSS KAMAKSH ALYA MAGAD ROAD BA NGALDRE PIN CODE: 560079, STD CODE:
1, TEL NO: 23481740, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1889

MANJUNATH HM PLASIIC SNDUSTRIES


4TH CROSS

GHIKKA ADIGUDI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2003

10 - 50

1890

VARDHAMAN POLYPACK

PETECHANNAPPA INDUSRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1891

SURYA POLYMERS

PETECHANNAPPA INDUSTRIAL ARIA RAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1892

BLOWTECH PLASTICS

86D ANURADHA ND ESTATE YN ANNIAH ROAD YELECHENAHALL BANGLORE PIN CODE: NA ,


STD CODE: NA , TEL NO: 94487074, FAX NO: NA, E-MAIL : N.A.

2403

10 - 50

1893

***

NA

10 - 50

1894

MANAGER

ENOVA PALIPAK PV LTD GK PEENYAIDUSTRIZ ARIA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28395124, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1895

MANAGER

SIGMA PAIP PARAMS NO300 PEENYA NDUSTRIAL ESTATE BANGALORE 560058 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1896

MANAGER

ARJUNPLASTCS PLATGBIO PEENYAINDUUTRIALAR EA PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28395912, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

141

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

INDUSTRIAL RABBAR PRODAC NOZSS PEENYAIND USTRIALARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 51170893, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MANAGER VISHAL POLYMERS

NO 96 2 CROSS 1STAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1900

MANAGER

KAPILA RUBBERS NO202 4THCROSS1 STAGE PEENYA NDUSTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1901

RANGANATH SRINIVAS TEXTILES

,64/2 KAVERIPURA RAMAMANDIRA ROAD KAVERIPURA BANGALORE PIN CODE: 560079, STD
CODE: NA , TEL NO: 30918912, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1902

M VENKATESH

GOLPSHINE PLASTIC MOLDING MS RAMAIAH INDUSTRIAL ESTATE BANGALORE PIN CODE:


560054, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1903

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1904

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1905

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1906

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1907

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1908

PLASTICK MOLING FACTRY 1ST MAIN


CHIKKAA

ADUGOD THAVAREKERE MAIN ROAD BANGALORE ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1909

RAJESHCHAPPEYA

NO-9 NDUSTRIALESTATE RAJAJINAGAR BANGALORE 44 PIN CODE: 560044, STD CODE: NA ,


TEL NO: 23200468, FAX NO: NA, E-MAIL : N.A.

1963

51 - 100

1910

G R GANESH

NO1,1 PHASE PEENYA NDUSTRIAL AREA BANGA LORE PIN CODE: 560058, STD CODE: 080,
TEL NO: 28398117, FAX NO: NA, E-MAIL : N.A.

1974

51 - 100

1911

RAJENDRAN

SHIVASAKTH EMGINEERING CO S M ROAD JALAH ALLY WES BANGALORE PIN CODE: 560058,
STD CODE: 10080, TEL NO: 28394980, FAX NO: NA, E-MAIL : N.A.

1978

51 - 100

1912

S H SALIYANA NDUSTRIAL RUBBER

WORKES MSR NNDUSTRIALESTATE GOKULA BANGALORE GGOOGU PIN CODE: 560054, STD
CODE: NA , TEL NO: 23604132, FAX NO: NA, E-MAIL : N.A.

1985

51 - 100

1897

MANAGER

SINTETICS RIGERANS PRODACTS A363 1STSTAGE PEENYAIDUSTRTALAREA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: 28395659, FAX NO: NA, E-MAIL : N.A.

1898

MANAGER

1899

PIN CODE: 560029, STD CODE: NA ,

142

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1913

KASTUR PALIMAR

377/384 ANDANAPPA BUILDING KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE:
NA , TEL NO: 23488104, FAX NO: NA, E-MAIL : N.A.

1992

51 - 100

1914

AVONPLASTICINDUSTRIESPRIVATELIMIT
ED

NO98INDUSTRIALSUBRUBSECONDSTAGETUMKURROAD BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

51 - 100

1915

PLASTO BAG NDUSTRIES

NO-BIG NAYANOALLY BANGALORE J9 PIN CODE: 560039, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

51 - 100

1916

MANAGER

BILT MET PIBARS PV LTO NO18/ PEENYAIDUS RILARIA BANGALORE PIN CODE: 500058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

NIC 2004 : 2610-Manufacture of glass and glass products


1917

VINODHKUMAR

NO87 PANORAMMASOLUTIONS CHIKKABEGURGATE BANGALORE 68 PIN CODE: 560068, STD


CODE: 20, TEL NO: 25731724, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1918

SHASHIDHAR SWARNAGOWRI
LAMTNATORS

28 IA CROSS CHOLARA PALVA MAGADIROAD BANGALORE PIN CODE: 560023, STD CODE: NA
, TEL NO: 23303296, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1919

MANAGER

KONICA MIRER NDUSTRIES NOAI43 ST STAGE PEENYA NDUSTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: 28395608, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

NIC 2004 : 2692-Manufacture of refractory ceramic products


1920

PARIJATHA TILES Z6IG PARIJATHA


OWERSI

ZND FIOOR RAJAJINAGAR BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1921

RAMESH

BR MBCHINE JOOLSIPREVBDE LIMITED HISBPWAS E 2CROSS PEENYB INDUSTRIAL BREB


GANGBLORE PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560055, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

1944

51 - 100

NIC 2004 : 2693-Manufacture of structural non-refractory clay and ceramic products


1922

HYDRO BUILDING SYSTEMS PRIVATE


LIMITED

736 HULIMAVU GATE BANNERAGHA A ROAD BANGALORE PIN CODE: 560076, STD CODE:
00080, TEL NO: 26589851, FAX NO: 26589850, E-MAIL : N.A.

1996

10 - 50

1923

MOWBRICKSWORKS
MARKOODARAOBRIKS

SHANIMAHATMATEMPL OPPSIT BANERUGATTA ROAD ANEKAL BANGAQLORE DISTRICT PIN


CODE: 562106, STD CODE: 40117, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

143

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2000

10 - 50

1924

SHANKAR A COBALTINDUSTRIES
SINGASANDRA

HOSURROAD BANGALORE ,
NO: NA, E-MAIL : N.A.

1925

RAGHURAMAREDDY BRICKSWORKS
NARAYANAPUR A

NEKALTONN ANEKAL BANGALORE DISTRIC A PIN CODE: 560106, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1926

KRISHNAPPA ALUMINIUM CONTAINER


NO

NEAR BUSSTAND MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN CODE: 560068,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1927

***

NA

10 - 50

1928

AKKOOR DY KASTRAS NOIGI2ND PHASE

PEENYA NDL ARIA BANQALORE SB ,


FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1929

WALACHANDHTRACHANDMARG HE
NDIA HOME

PIPE CO L D VENKATALA YELAHANKA POST BANGALORE NORTH TQ BANGALORE NORTH D


PIN CODE: 560064, STD CODE: NA , TEL NO: 23567394, FAX NO: NA, E-MAIL : N.A.

1968

51 - 100

1930

SAPTHAGIRI BRICKS WORKS

NARAYANAPURA ANEKALTOWN ANEKAL BNAGALORE DISTRICT PIN CODE: 561016, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

1931

SIMCO SPECIAL INSULATOR


MANUFACTURING

#48 3 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

101 - 500

1998

10 - 50

NA

10 - 50

1999

51 - 100

1996

10 - 50

PIN CODE: 560068, STD CODE: NA , TEL NO: 25734829, FAX

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560058, STD CODE: NA , TEL NO: NA ,

NIC 2004 : 2694-Manufacture of cement, lime and plaster


1932

PRAKASHA

ALLO BRICKS KOGILU JAKKUR POST BANGALORE PIN CODE: 560064, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1933

UNITED FORGINGS PV LTD

NO 465 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28360609, FAX NO: NA, E-MAIL : N.A.

1934

RAMESHA

5 CROSS H M MAIN ROAD JALAHALL BANGALORE PIN CODE: 560079, STD CODE: 00080, TEL
NO: 6975266, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2695-Manufacture of articles of concrete, cement and plaster


1935

BK CONCRETTE AND ILES NO 1727

SONAPPA BLOCK THIRD CROSS PILLANNAGARDEN KACHARKANAHALL BANGALORE PIN


CODE: 560045, STD CODE: NA , TEL NO: 25463721, FAX NO: NA, E-MAIL : N.A.

144

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1936

RAMAPPA LAKSHM ENTERPRISES

NO-6 PARIMALANAGARA STUDIO MAIN ROAD BANGALORE PIN CODE: 560096, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1937

B K CONCRETE BLOCKS AND TILES

NO 1727 SONNAPPA BLOCK 3RD STAGE PILLANNA GARDEN BANGALORE 45 PIN CODE:
560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1938

MANAGER

KARULAL RAGGU VYAPARY NOK PEENYA NDASTR AL ESTAT BANGALORE 56OO58 PIN
CODE: 560058, STD CODE: 5600, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 2696-Cutting, shaping and finishing of stone


1939

JYOTHY ILES

JYOTHY ILES GIDDENAHALLY BELLARY ROAD RMV STAGE BANGALORE PIN CODE: 560024,
STD CODE: 080, TEL NO: 23410205, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

1940

ARIHAN CERAMICS NO 59/2 LRBONDA


ROAD

KAVALBYRASANDRA BANGALORE 560032 PIN CODE: 560032, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

1941

TECHNO SPARK GRANITES NO 1341

KAVAL BYRASANDRA R NAGAR POS BANGALORE PIN CODE: 560032, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

1942

MODREN JAILS & MORBLE FBCTORY

#11 PEENYA 1PHASE IWDUSTRIAL AREA BBNGLOR RE PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

NIC 2004 : 2699-Manufacture of other non-metallic mineral products n.e.c.


1943

C KRISHNAREDDY V B FACTORY
OWNER

NO 9 V B LAYOU SEVENTH MILE BANNERUGHA A ROAD BANGALORE PIN CODE: 560076,


STD CODE: NA , TEL NO: 26581250, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

1944

M P P TECHNOLOGIES PVT LTD

NO 487 C 4 PHASE 14 CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28361567, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

1945

B N BRICKS COMPANY
SEETHARAMPALYA

MAHADEVAPURA CMC BANGALORE PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1988

10 - 50

1946

R B G BRICKS CONSTRUCTION

KOGILU LAYOU AGRAHARA LAYOU YELAHANKA BELLAHALLY ROAD BANGALORE NORTH


PIN CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

1947

BRIKSMAKINGFACTORY

MAINROADITPL RAJAPALYAMAHADEVAPURA POS BANGALORE SOUTH DISRIC PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

145

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1948

CHITRA GRANITE WORK

CHINNA CANON JPHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

1949

DEEPIKAPOWDERCOATERS RRAJ
NO97/1

SINGASANDRA HOSURROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
57319994, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1950

SUBRAMAN B B BRICKS COMPANY

FIRS MAIN KODIGEHALLY KADUGODI POS BANGALORE PIN CODE: 560067, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

1951

ENGINEERING STEEL FABRICATORS

16I8 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

1952

A B CONCRETE BLOCKS

NOIO/4 BYATARAYANAPURA JAKKUR CROSS NEAR RANKA BRICKS BANGALORE PIN CODE:
560092, STD CODE: NA , TEL NO: 23636646, FAX NO: 1, E-MAIL : N.A.

1996

10 - 50

1953

GIRIJA GRANITECH NO 77
BYRAVESHWARA INDUS

TRIES PEENY 1S STAGE BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: 28864732,
FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

1954

NBTBLOCK

OMKARNAGAR BANNERGHATTAROAD BANGALORE PIN CODE: 560076, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1955

VARADAPPA BRICKS FACTORY


(PREPARE)

SINGAPUR LAYOU SINGAPUR VIDYARANYAPUR POST BANGALORE 97 PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1956

NAGARJHNATABLEBRIKS

24 THIRHMENAHALLIROAD AGRAHARALAYOUT JAKKHR POS YELAHANKA BANRALORE PIN


CODE: 560064, STD CODE: 93, TEL NO: 41463777, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

1957

SWAROOPHALOBLOCK

SHANTHARAJ DORESANIPALYA BANNERGA AROAD BANGALORE PIN CODE: 560076, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1958

SRINIVASA J

JAYARAM ESTATE SMALL SCALE INDUSTRIES REGD JAKKUR PIN CODE: 560064, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1959

CEMENT BRICKS WORK

22ND MAIN 4 CROSS AGARA BANGALORE PIN CODE: 560034, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1960

RAVINDRA NATH

6 NAIL NAZIR SAB LAYOU HOSUR RDAD BOMMANAHALL BANGALORE PIN CODE: 560068,
STD CODE: NA , TEL NO: 25721189, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1961

SYAM ECHNOLOGIES

# I9BIA 2CROSS 3MAIN 3PHASE PEENYA NDUS RIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 23723183, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

146

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1962

KAALABHIRAWESHWARA METAL WORKS

NO3 SANJEEVAPPA LANE NEAR CUBBONPE CHICKPET BANGALORE PIN CODE: 560009, STD
CODE: NA , TEL NO: 22292044, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1963

S&C SRINIVASA BRICKS COMPANY MAIN


ROAD

SADARA MANGALA KADUGOD POST SADARA MANGALA BANGALORE PIN CODE: 560067,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1964

MANOJHALOBLOCKS

ZE THIRHMENAHALLIROAD AGRAHARALAYOHT JAKKUR POS YELAHANKA BANRALORE PIN


CODE: 560064, STD CODE: 93414, TEL NO: 08139, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

1965

SHIVANANJEGOWDA S L N
CONCRETEBLOCKS

SINGASANDRA HOSURMAINROAD BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1966

S H BLOCKS

SRI SWAROOPKUMAR HAVELI SHRUNGERI LAYOU NYANAPPANAHALL BEGUR POS


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

1967

S.R.HOLLOW BLOCKS

I.MAIN NEAR ANJANEYA EMPLE HEBBAL KEMPAPURA BANGALORE PIN CODE: 560024, STD
CODE: NA , TEL NO: 22725149, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

1968

SRI RAGHAVENDRA BRICKS AND ILES

STH CROSS SHAMBHAVINAGAR LAGGERE PEENYA ND STAGE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28366049, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

1969

GANESH CONCRETE HOLLO BLOCKS

OFF NO-6 PUTTENAHALL MAIN ROAD J P NAGAR BANGALORE-78 PIN CODE: NA , STD CODE:
NA , TEL NO: 26596539, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1970

ACE TECHNO FABS NO17 6TH MAIN


KGHALL

BANGALORE ,
: N.A.

NA

10 - 50

1971

ANIL HOLOW BRTCKS L D

NO 26 PEENYAINDUSTRIAL ESTATE 2 PHASE BANGALORE NORTH PIN CODE: 560058, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1972

BULKMON INGINEERINGS PVT LTD

NO 482 A-2 PEENYA NDUSTRIAL ARFA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28345636, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1973

MARUTH MACHTNE TOOLS PV LTD

NO 46O A 4 PHASE PEENYA NDUSTRTALAREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28361386, FAX NO: 8361386, E-MAIL : N.A.

NA

10 - 50

1974

FAB MACAINES PVT LTD

MO 4O3 U PHAIE IO CROSS PEENYZINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28361650, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1975

SIGMA PUNCH PV LTD N0462

4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28362709, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560068, STD CODE: NA , TEL

PIN CODE: 560015, STD CODE: NA , TEL NO: 93417855, FAX NO: NA, E-MAIL

147

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1976

SURESH HM SREERAMAHALOBLOCKS

SURVEY NO 9I 58 2 HULIMAVU BANNERGHATTA MAINROAD BANGALORE PIN CODE: 560076,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1973

51 - 100

1977

KASH FABRAR PV LTD

NO 376 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28364167, FAX NO: 83644167, E-MAIL : N.A.

1987

51 - 100

1978

MQDHURA FARMAC TCALS

NO 292 A PHASE 2 CROSS PEENYA NDUSTR AL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28394504, FAX NO: NA, E-MAIL : N.A.

1987

51 - 100

1979

VINOD HEAVY FABRICATORS PV LTD

NO 421 0 CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

1980

***

NA

> 500

1981

IERRO FORM FABRZCATIONS


SEETHAPATH

NOIS VINAYAKA ESTAIE HEGGANAHALLICROSS BANGALORE PIN CODE: 500091, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

PIN CODE: NA , STD CODE: NA , TEL NO: 51317830, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2711-Manufacture of ferro alloys.


1982

MANAGER

SHARAVANA ALAYIS NO22\A 2STAGE NDUSTRIAL ARIA Y P R BANGALORE PIN CODE:


560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1983

MNNAGER

JAIN PERO ALAYS N0 94 R MAIN INPUSTRIAL SVB Y P R BANGALORE PIN CODE: 560022, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1984

MANAGER

MYSORE ENGENLGRING ENTERPRISES NOI09 ST STAGPEENYA NDUSTRIAL ARIA BANGALORE


PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1985

MANAGER

ESWAR ENTAR PRINCES NO1O9 STAGE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1986

MANAGER

LEN ENTERPRISES 4CROSS N0 AI8I STAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1987

MANAGER

FINEESH ALAYS INGINEERING NOB95A 1 STAGE PEENYA NDUSTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1988

STAT WEIGH NDIA PVT LTD

NO 449 4PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: 1,
TEL NO: 28363423, FAX NO: 8360041, E-MAIL : N.A.

NA

101 - 500

148

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
1989

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
MANAGER

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
> 500

NOI3 STH CROSS SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22220381, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

IRON FACTORYJOTHY NAGAR MYSORE ROAD BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: 24680912, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

VATTAKATTA NDUSTRIES NO718 7TH MILE CHIKKABEGUR ATE PIN CODE: 560068, STD CODE:
NA , TEL NO: 2573145, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

1973

10 - 50

OSVAL ALAYS NO 8A MAIN NDUSTRIALARIA Y P R BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2712-Manufacture of Direct Reduced Iron (DRI)/ Sponge Iron and other spongy ferrous products.
1990

M K GIRI ELECTRO OPERATERS

NIC 2004 : 2713-Manufacture of Pig Iron (hot metal).


1991

***

1992

JANE

NIC 2004 : 2715-Manufacture of non-flat steel products (bars, rods, structurals, rails)
1993

OXWELL NDIA P LTD

OXWELL NDIA P LTD H M NDL ESTATE ZRNG ALORC PIN CODE: 560031, STD CODE: 080, TEL
NO: 28389582, FAX NO: NA, E-MAIL : N.A.

1994

MANAGER

GAYATHRI STEEL DUSTRIS GAPLAYARS NOV4 PEENYAIDUSTRIYALARZYA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1995

MANAGER

CYASIRAN BYRK GEN SB PEENYAINDUSTRIAL A BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28394211, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1996

MANAGER

PRESSFIT NDTA NO B I4J JCROSS JSTAGE PEENYA NDVSTRIAL ESTATE BANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1997

MANAGER

U KYAN NDAILIMITEDB8O CROSS ISTSTAGE PEENYA LNDASTRIAL TOWN BANGALORE


S6OOS8 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1998

MANAGER

TRINIT ENGINEERING WORKSNOBGBTSSTAGG PEENYA NDASTRIAL TOWN BANGALORE


SGOOSS PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1999

STEEL GRADE INDIA P LTD

B-6&7 JAIBHARATH NDIA ESTATE YASHWANTHPUR BAGALORE-22 PIN CODE: 560022, STD
CODE: NA , TEL NO: 23370661, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

149

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
2000

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
MANAGER

(3)
ALUTAP NOA146/AISTSTAGE PEENYA NDUSTRIAL TOWN BANGALORE SGOOSB PIN CODE:
560058, STD CODE: NA , TEL NO: 28392774, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)
NA

(5)
51 - 100

NIC 2004 : 2716-Manufacture of flat steel products not coated


2001

MANAGER

E E INGNEERINGS NOB94INDCROSS TS STAG PEENYA NDASTRIAL TOWN BANGALORE S6OOS8


PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2002

MANAGER

STEEL ENGENFERINGS N VCROSS ISTAGE PEENYA NDUSTRIA ESTATE BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2003

MANAGER

SHAM ENGENEERING N0C207 4CROSS PEENYA NDUSTRIAL ESTATE BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1991

10 - 50

NA

10 - 50

1985

10 - 50

NIC 2004 : 2718-Manufacture of steel wires made in wire drawing mills


2004

M.A.KHADAR

SUNIKH PRECESION PRIVATELIMITED 4CROSS N. S.PALYA BANNERGHATTAROAD


BANGALORE-76 PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

MR J JAYA HEGDE

NO I8 INDUSTRIAL SUBRUB TUMKUR ROAD YESWANTHPUR BANQALORE ZZ PIN CODE:


560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2719-Manufacture of other basic iron and steel n.e.c.


2006

METROLOGICALSERVICECENTRE

NOI7MAGADIROAD BANGALORES6OOZB ,
, FAX NO: NA, E-MAIL : N.A.

2007

KATFER SCHOOLS PRIVATE LIMITED

2 MAIN ROAD KO IGEPALYA MAGADI MAIN ROAD BANGALORE PIN CODE: 560091, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2008

ARPUDHARAJ

N H 4MAIN BEHURROAD HDNGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA ,


TEL NO: 25733264, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2009

RAVINDRAN

285/2 NEXT UBPL HOSUR ROAD BOMMANAHALLI BANGALORE PIN CODE: 560068, STD CODE:
NA , TEL NO: 51114649, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2010

SUBRAMANYAM

3IICROSS 4MAIN HONGASANDRA BANGALORET PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

PIN CODE: 560023, STD CODE: NA , TEL NO: NA

150

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2005

(5)
10 - 50

JARRIGS PV LTD NO23 INDUSTRIAL AREA YPR BANGALORE PIN CODE: 560022, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MANAGER

GAVIRANGA INGINEERING NO1O4 IS CROSS S STAGE PEENYA NDASTRIAL TOWN


BANGALORE 58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MANAGER

BHAVANISTEEL REDARS NO3O/2PEENYAINDUSTR AL AREA IS STAGE BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2011

SADANANDA REDDY

BEGURMATNROAD AONGSANDRA BANGALORE PIN CODE: 560068, STD CODE: 9, TEL NO:
41979088, FAX NO: NA, E-MAIL : N.A.

2012

MANAGER

2013

2014

NIC 2004 : 2720-Manufacture of basic precious and non-ferrous metals


2015

KARNATAKA METAL COMPANY

NO5 AMROAD KALASIPALYAM NEW EXTENSION JCROAD BANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: 26706536, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2016

PAVVAN NDUSTRIES

SHOMESHWARA LAYOUT PILLANNA GARDEN BANGALORE PIN CODE: 560045, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2017

MANAGER

KASI PRISISHANS NO8132 3RD CROSS 1STSTAGE PEENYA NDUSIRIAL TOWN BANGALORE
560058 PIN CODE: 560058, STD CODE: NA , TEL NO: 28394912, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2018

MANAGER

ASHWIN PRISISHAN PRODACTS NOAI581STSTAGE PEENYA NDASIRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 2731-Casting of iron and steel


2019

JINALISE STEEL NDUSTRIES

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

1989

10 - 50

2020

ARECO CASTINGS

NO 39 BAYAR STREET NEELASANDRA BANGALORE PIN CODE: 560047, STD CODE: NA , TEL
NO: 25713399, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2021

MANAGER

KARNATARA CASTIG NOZI6 UMKUR ROAD NDUS RIALARIA BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: 23574435, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2732-Casting of non-ferrous metals

151

NA

101 - 500

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1989

(5)
10 - 50

OSSTAL MINARALS NO 8/ NDUSTRIALGRIA Y P R BANGALORE PIN CODE: 560022, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MANAGER

RAJDEEP ENGINEERING NO B_I2G 3CROSS ISTAGE PEENYA INDUSTRIAL OWN BANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MANAGER

SEENU INGINEERINGS NOAI845THCROSSISTSTAGE PEENYA NDUSTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560052, STD CODE: NA , TEL NO: 57648543, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2022

GRAV LART PVT LTD

B 9 JA BHARATH INDUSTRIES ESTATE YASHWANTHPUR BANGALDRE 22 PIN CODE: 560022,


STD CODE: NA , TEL NO: 23578287, FAX NO: NA, E-MAIL : N.A.

2023

MANAGER

2024

2025

NIC 2004 : 2811-Manufacture of structural metal products


2026

AMALA ENGINEER WORKS HENNUR


MAIN ROAF

LINGARAJAPURA BANGALORE PIN CODE: 560084, STD CODE: NA , TEL NO: 25477127, FAX
NO: NA, E-MAIL : N.A.

1962

10 - 50

2027

PRASAD ENTERPRISES

K M RAMPRASAD PRASAD ENTERPRISES H M IND L ESTATE BANGALORE PIN CODE: 560031,


STD CODE: 080, TEL NO: 28389816, FAX NO: NA, E-MAIL : N.A.

1967

10 - 50

2028

HARSHA NDUSTRIES

46 I NDUSTRIAL SHED COMPLEX 9 BLOCK JAYANAGAR BANGALORE PIN CODE: 560069, STD
CODE: NA , TEL NO: 26585185, FAX NO: NA, E-MAIL : N.A.

1977

10 - 50

2029

NIPPON ENTERPRISES

LAVKLLE ROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1980

10 - 50

2030

HP SOMASHEKAR DIVYA BUILDERS


DOORNUMBEN14

3CROSS KUMARASWAMY LAYOU BANGALDRE SOUFH BANGALORE PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2031

THE SUNRISE INDUSTRIES

N 2105 OKALIPURAM MAINROAD OKALIPURAM BANGALORE PIN CODE: 560021, STD CODE:
080, TEL NO: 23123523, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2032

IB6XGALLAGHEDDRIVATELIMITED

#175/54 RATNAVILAS ROAD BASAVANAGUDI ,


NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2033

ARINDUIDRILLING TECHNOLOGIES PVT


LTD

NO 347 9 MAIN 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2034

GOPAL

ZZ1 ENGINEERING WORK 7 CROSS H SIDDIAH ROAD BANGALORE 560027 PIN CODE: 560027,
STD CODE: 22275, TEL NO: 696, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

PIN CODE: 560004, STD CODE: NA , TEL NO:

152

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

Employment
Class

(4)
1990

(5)
10 - 50

A
ER DBA LORE G OZ7 PIN CODE: 560027, STD CODE: 22222, TEL NO: 774, FAX NO: NA,
E-MAIL : N.A.

1992

10 - 50

DBYANAND

7 MAIN ROAD BANDAPPA GARDON MUTHSALA NAGARA GOKULA POST BANGALORE PIN
CODE: NA , STD CODE: NA , TEL NO: 93018343, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2038

BASAVARAJU

SHIVAINDUSTRIES 14CROSS TIRUMALA KALYANA MANTAPA BACK NDUSTRIAL AREA


RAJAJINAGAR PIN CODE: 560044, STD CODE: 00080, TEL NO: 23383707, FAX NO: NA, E-MAIL :
N.A.

1995

10 - 50

2039

P S NATHAN

NO 9/1 STORE ENGINEERING SPARES PVT LTD CALLING ROAD BANGALORE PIN CODE:
560027, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2040

METALBOX MANUFACTURE UNI

EIGHTHCROSS FIRSTMAIVROAD BAPUJINAGAR BANGALORE PIN CODE: 560026, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2041

1ANSYNTHETICS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23589898, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2042

MODI

#2 2CROSS 1PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
080, TEL NO: 3729175, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2043

SRI VELMURUGAN METAL NDUSTRIES

NOI79 AZIZSAIT NDUSTRIAL TOWN NAYNDAHALLJ MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2044

TOOLFORM EKNIKS

OPPOSITE GOVERNMEN NURSERY HOSAPALYA MADIWALA POS BANGALORE PIN CODE:


560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2045

TEJASWIN INDUSTRIAL WORKS

NO56 4CROSS KOTTIGEPALYA BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2046

MANAGER

SAI DURGA TRADERS NOC/34BPEENYA INDASTRIA L ESTA BANGALORE 56OO5B PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2047

MANAGAR

SEETMETAL FYABRICS NO8 PEENYA INDASTRIAL ESTA BANGALORE S6OO58 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2048

MANAGER

ROSHIMA INGINIERING WORKS NO298A PEENYA ESTA BANGALORE 5GOO58 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2035

VIJAY PRECISION COMPONENTS

2036

***

2037

(3)

Year of start of
Operation

295/86BYVANNAIH ROAD YELACHENAHALL KANAKAPURA MAIN ROAD BANGALORE 560078


PIN CODE: 560078, STD CODE: 26662, TEL NO: 607, FAX NO: 150, E-MAIL : N.A.

153

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2049

MANAGER

KAVITHA INDUSTRIES VCROSS 1STAGE PEENYA NDVSTRIAL ESTATE BANGALORE PIN CODE:
560058, STD CODE: 28393, TEL NO: 445, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2050

MANAGER

G H INDUSTRIES NOB102 IS STAGE PEENYA INDUSTRIAL OWN BANGALORE 56OO58 PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2051

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2052

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2053

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2054

BASHA M A ENGINEERING NORKS

DOOR NO 7 3 CROSS SUSHILA ROAD L B FOR ROAD BANGLORE 2 PIN CODE: 560002, STD
CODE: 080, TEL NO: 22275851, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2055

VELAR ENGLNEARING WORKSHOPS PV


LTD

YCRDSS SIDDAIAB ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
51146952, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2056

REDDY STIL WORK VINAYAKA NAGAR

6TH CROSS, 1ST MAIN, BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2057

ABDUL KHALEEL ENGINEERING WORKS

KADUGONDANAHALLI BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

2058

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2059

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2060

SRIKARA ENGINEERING WORKS

NA

10 - 50

2061

***

NA

10 - 50

2062

QUALITY CRYSTALS

NO 39_2 G Z KALYAN GARDEN BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE:
NA , TEL NO: 22973020, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2063

REVADALE PRECISTON OOLS PVT LTD

NO484 B-C 4 PHASE 13 CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28362270, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

N0 472 B 2 PEENYA INDUSTRTAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28362005, FAX NO: 8360520, E-MAIL : N.A.

NA

10 - 50

2064

P A PV LTD

PIN CODE: 560030, STD CODE: NA , TEL NO: NA ,

KAREKALLU KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

154

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2065

LISV NDUSTRIES

NO 375 4 PHASE PEFNYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28368429, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2066

ACCURATE CIN C MACHINE OOLS NO


3BB

4 PHASE IO CROSS PEENYA NDUSTRZAL AREA BBNGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 51172448, FAX NO: 28362248, E-MAIL : N.A.

NA

10 - 50

2067

ACCUMAAC BCHINE TOOLS NO 472 4


DAASE

PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28361515, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2068

RAJU SUNMAS MACHINE TOOLS PV LTD


432/1

4TH MAIN ZTH CROSS ATHPHASE PEENYA INDUSTRIAL AREA BANGALORE SB PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2069

***

NA

10 - 50

2070

KELEX A JOHN KEN2V ENAINEERS PVT


LTD

88/1SINGASANDRA HOSURROAD BANGALORE 56OO68 PIN CODE: 560068, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

2071

SUNMAS MACHINE OOLS

NO 432 1 4 PHASE PEENXA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28361949, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2072

KEDAGETRU TOOLS PVT LTD

NO 485 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 30611616, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2073

AIR VENT PUT LTD

NO 46O 4 PHASE PEENYA NDUSTRTAL AREA RANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2812-Manufacture of tanks, reservoirs and containers of metal


2074

BASKAR

BGSKARAN NDUSTRIES NO4MAINROAD INDUSTRTA L TOWN RAJAJINAGAR RANGALORE PIN


CODE: 560044, STD CODE: 080, TEL NO: 23201657, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2075

SAMPATH

NO9CROSS4MAINROAD NDASTIRIALTOWN RAJAJ NAGAR BANGALORE PIN CODE: 560044,


STD CODE: 1080, TEL NO: 23354741, FAX NO: NA, E-MAIL : N.A.

1986

51 - 100

1998

10 - 50

NIC 2004 : 2813-Manufacture of steam generators, except central heating hot water boilers
2076

STAR FABRICATORS

7 SWANYAM PRABHA KALYANA MANTAPAROAD MAG ADIMAINROAD MEENAXINAGAR


KAMAXIPALYA PIN CODE: 560079, STD CODE: NA , TEL NO: 23482964, FAX NO: NA, E-MAIL :
N.A.

155

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

DISTRICT : Bangalore

Name of Establishment

(1)
2077

STATE : KARNATAKA

Address / Telephone / Fax / E-mail

(2)

(3)
,

***

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

NIC 2004 : 2891-Forging, pressing , stamping and roll-forming of metal; powder metallurgy
2078

HAZARA PRIVATE LIMITED

N1 MAIN ROAD RAILWAY STATION NAGARA KENGER BANGALORE 6O PIN CODE: 560060,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2079

ABU BAKAR SIDIQUE CLASSIC ELECTRO


PLATING

ANO CHRONIC S K CR SS LB FOR OAD BAN AL RE PIN CODE: 560002, STD CODE: 080, TEL
NO: 22226342, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2080

RATNA TOOLINGS

CNC TUNE URNING MOTTIGEPALYA BANGALORL PIN CODE: 560091, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2081

MANAGAR

SOUTHARAN STEEL FORGINGS NO IO8C PEENYA INDASTRIAL ESTAI BANGALORE 560058 PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2082

PRANALAL D MEHTA MAHAVEER


DECORF

DOOR NO 24 KOTA COMPLEX BANGALORE 2 PIN CODE: 560002, STD CODE: 080, TEL NO:
22225094, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1985

10 - 50

NIC 2004 : 2892-Treatment and coating of metals; general mechanical engineering on a fee or contract basis
2083

ARIF PLATNG FACTOR

TY

2084

VIJAY ASSOCIATION FOR HANDICAP

B OA B E L NDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,


TEL NO: 22195269, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2085

A G N ELECTRO COATS

B-06 B E L NDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23451061, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2086

MR SEETARAMAIAH

LAXM BANDAPPA GARDEN MUTHYALANAGARA GOKULA POS BANGALORE PIN CODE: NA ,


STD CODE: 9580, TEL NO: 23478261, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2087

STAR FURNITURE

NO 10/6 RAJGOPAL GARDEN JC ROAD BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2088

SAGAR POWDER COATING

NOGI3 ICROSS CHINNASWAMY MUDHALIAR GARDEN MTB ROAD KALASIPALYAM BANGALORE


PIN CODE: 560002, STD CODE: NA , TEL NO: 26703924, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

2089

***

NA

10 - 50

NO42 MTTB ROT


NA, E-MAIL : N.A.

AT DT ,

PIN CODE: NA , STD CODE: NA , TEL NO: 51249361, FAX NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

156

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
2090

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
GOUTHAMI ENTERPRICES

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2003

51 - 100

73 METRO BUILDING OPP BPL HOSUR ROAD BOMMANAHALLI BANGALORE PIN CODE: 560068,
STD CODE: NA , TEL NO: 30938204, FAX NO: NA, E-MAIL : N.A.

1928

10 - 50

NO27/37 MRLANE 2CROSS STORESTREE KALASIPALYAM BANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: 26703983, FAX NO: 45527493, E-MAIL : N.A.

NIC 2004 : 2893-Manufacture of cutlery, hand tools and general hardware


2091

***

2092

M K GUPTA

CHAMUNDI STEEL PVT LTD HOSUR MAIN ROAD GARWEBHAVIPALYA BANGLORE 56OO68 PIN
CODE: 560068, STD CODE: NA , TEL NO: 51100326, FAX NO: NA, E-MAIL : N.A.

1931

10 - 50

2093

VIJAYALAXSHM INDUSTRIES

HENNUR MAIN ROAD. KALYANNAGARA POS BANGALORE 560043 PIN CODE: 560043, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1953

10 - 50

2094

BOSCO REXROTH INDIA PRIVATE


LIMITED

#96 2MAIN 4PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: 11111 1, E-MAIL : N.A.

1970

10 - 50

2095

ANITA PLEXUS ALLOY SPECIALITY


PRIVATE LTD

24 5 MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51272422, FAX NO: NA, E-MAIL : N.A.

1976

10 - 50

2096

PETRO MOGAL

GOETZE NDIA LIMITED YELAHANKA BANGALORE NORTH PIN CODE: 560064, STD CODE: NA ,
TEL NO: 02840090, FAX NO: NA, E-MAIL : N.A.

1976

10 - 50

2097

MACHINEELEMENTS

NO 48 2PHASE 2MAIN PEENYAINDUSTRIALAREA BANGALORE PIN CODE: 560058, STD CODE:


080, TEL NO: 28395625, FAX NO: 28394778, E-MAIL : N.A.

1982

10 - 50

2098

UNION PRESSLNG PVT LIMITED

NO 265 PEENYA INDUSTRIAL AREA 4 PHASE BAGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 57620016, FAX NO: 51170951, E-MAIL : N.A.

1983

10 - 50

2099

BANGALORE CERAMICS

B B ROAD VENKATALA YELAHANKA, BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: 28460180, FAX NO: 28460417, E-MAIL : N.A.

1984

10 - 50

2100

TERELEK ENGINEERING PRIVATE


LIMITED

#7O-7I 6 MAIN 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28395101, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2101

MICROHATIC MACHINE OOLS PVT LTD

10/30KUMARA KRUPA ROAD BANGALORE ,


22263724, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2102

ASHOK KUMAR BHARAI METAL


CORPORATION 1ST

MAIN RD NEW TIMBER YARD LAYOUT RAGHAVA NA GAR RDRANGALORE PIN CODE: 1 1, STD
CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

1988

10 - 50

PIN CODE: 560001, STD CODE: NA , TEL NO:

157

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2103

SHANMUKHA INDUSTRIES

NO.20_4THCROSS GOKUL 1STAGE 2PHASE YESHVANTHAPURA BANGALORE PIN CODE:


560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2104

VATHSALA

APPA VATHSALA INDUSTRIES #139/2 S NAGAR BILEKAHALL BANGALORE PIN CODE: 560076,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2105

MALU POLES FACTORY

KOGILU LAYOU BELLAHALLY YELAHANKA ROAD BANGALORE NORTH BANGALORE PIN


CODE: 560064, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2106

PATTN SHETTY NDUSTRIES

NO 291 4 PHSE 4 CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28392925, FAX NO: 28376626, E-MAIL : N.A.

1992

10 - 50

2107

JAGADHISH N O 2 27/3 ANTHONY


NDUSTRIAL

ESTATE KANAKAPURA MAIN ROAD JARAGANAHALL BANGALORE PIN CODE: 560078, STD
CODE: NA , TEL NO: 26650775, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

2108

SELECTENGINEERINGWORKS
ABBIGEREMAINROAD

KAMMAGONOANAHALLYBANGALORE 15 ,
23451540, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2109

ZENITH OOLS AND COMPONENYS

#94 7MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2110

TOOLS AND COMPONENTS

#203/5 1CROSS GUNDATMOOP RAJIV GANDH NAGAR HOSUR ROAD BDMMANAHALL


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 25720497, FAX NO: NA, E-MAIL :
N.A.

1996

10 - 50

2111

SABHAPAT

TEXER FACTARY RAMACHANDRAPURA PO.JALAMALLI PIN CODE: 560013, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2112

***

YAMALOOR AT POS BANGALORE PIN CODE: 560037, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1998

10 - 50

2113

JAGADISH

WELDCONEENGG WORKS6073BEGURROAD CHICKNAHALLICROSSBANGALORJ PIN CODE:


560068, STD CODE: 25731, TEL NO: 699, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2114

RAVIKUMAR ANNAVAPPR GARDEN


JARAGANAHALLD

BANGALORE ,
: N.A.

2000

10 - 50

2115

NAYAK DISHANEXUS SINGASANDRA

HOSURROAD BANGALORE ,
E-MAIL : N.A.

2001

10 - 50

2116

REDDY FABRIRATIDNS

KUVEMPU LAYOUT EHIKKA DEVASANDRA BANGALORE PIN CODE: 560036, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

PIN CODE: 566001, STD CODE: 00080, TEL NO:

PIN CODE: 560078, STD CODE: NA , TEL NO: 57701713, FAX NO: NA, E-MAIL

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,

158

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2002

10 - 50

2004

10 - 50

2117

JAIHARHEGDE BHAVAN NDUSTRIES


UNIT NO126

12KM BANNERUGHAITAROAD ARAKERE BANGALORE ,


NO: 26589892, FAX NO: NA, E-MAIL : N.A.

2118

ANKARAJ

IRON BUSINESS NEAR O GANAPATY TEMPLE SARAGANAHALL BANGALORE PIN CODE:


560078, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2119

MANAGKR

K G N TOOLS ANA TRADERS NO NK4 PEENYA DU STRIAL ARIA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2120

MANAGER

TRIPISHAN RIVEETS 043O PEENYAINDUSTRIAL ESTE PEENYA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2121

KRISHNA MURTHY

A 24 KRISHNA MURTHY HMT INDL ESTATE BAN GALORE PIN CODE: 560031, STD CODE: 080,
TEL NO: 28382810, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2122

RAJESHBALLAL

26 12KM BANNERUGHA AROAD BANGALORE 76 ,


NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2123

***

S S U STONEWORKS KAREYANNA BADAVANE OUTER RINGROAD HEBBALA BANGALORE PIN


CODE: 560024, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2124

ELECTREX NDIA LTD

NO 21 PEENYA NDUSTRIAL ESTATE 2 PHASE NTTF MAIN ROAD BANGALORE NORTH PIN
CODE: 560058, STD CODE: 28394, TEL NO: 477, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2125

***

NA

10 - 50

2126

PRECISION ENGINEERCNG PRODUCTC

#95 5MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

51 - 100

2127

SURHENNINGPERFECTPROJECTION

NOI13 INDUSTRIALAREA PEENYA BANGALORE PIN CODE: 560058, STD CODE: 080, TEL NO:
39285510, FAX NO: NA, E-MAIL : N.A.

1980

51 - 100

2128

SO6O ECHNOLOGY

279 2 PEENVA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28379355, FAX NO: NA, E-MAIL : N.A.

1980

51 - 100

2129

***

NA

51 - 100

2130

NARASAIAH

NO I7 PEENYA PHASS NDUSTRIAL AREA BANGALORE PIN CODE: NA , STD CODE: 00080, TEL
NO: 28394518, FAX NO: NA, E-MAIL : N.A.

1989

101 - 500

2131

ORSE HYDRAULICS PV LTD

271&272 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28360134, FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

PIN CODE: NA , STD CODE: NA , TEL

PIN CODE: 1, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

159

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2132

UNICON SYSTEM

#194 3MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALOREI PIN CODE: 560058, STD CODE:
NA , TEL NO: 28390703, FAX NO: NA, E-MAIL : N.A.

1996

101 - 500

2133

ARAVANCLOTHING

IA PEENYAINDUSTRIALAREA SECONDPHASE BANGALORE PIN CODE: 560058, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

101 - 500

2134

MASTER MINING AZUPMENTS

2ND PHASE PEENYA NDKAREA BANGALORE560058 ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2135

ACEDESIGNERSLTD PLOTNO 7&8


SECONDPHASE

PEENYAINDUSTRIALAREA BANGALORE PIN CODE: 560058, STD CODE: 91 80, TEL NO:
22186700, FAX NO: NA, E-MAIL : N.A.

1978

> 500

2136

LAKSHMIDAS AND V TALDAS COMPANY

#I9O XMAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28396425, FAX NO: NA, E-MAIL : N.A.

2000

> 500

PIN CODE: 560073, STD CODE: NA ,

NIC 2004 : 2899-Manufacture of other fabricated metal products n.e.c.


2137

HINDUSTAN STEEL ALLIED NDUSTRIES

AOG HM INDUSTRIAL ESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389386, FAX NO: 28389386, E-MAIL : N.A.

1964

10 - 50

2138

RAMAKRISHNA ENGINEERS

M RAMAKRISHNA RAMAKAISHNA ENGINEERS H M INDL ESTATE BANGALORE PIN CODE:


560031, STD CODE: 080, TEL NO: 28389721, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

2139

SHARAVATHI ENGINEERINH UORLS

NO 44/1 R V ROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL
NO: 26577475, FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

2140

SYED NOOR MOHAMMED

F H ALIDE INDUSTRIES RM V STAGE HEBBAL POS BHOOPASANDRA PIN CODE: 000094, STD
CODE: NA , TEL NO: 560094, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2141

BASKAR

#3954/3769BADRAPPA NDUSTRIAL ESTATE KAMA KSHIPALYA BANGBLORE PIN CODE:


560079, STD CODE: 9580, TEL NO: 23488619, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

2142

UELAYUDHAN CUM PROCISHAN


PRADECT LTD

MSR SNDUSTRIAL ESTATE GOKULA EXTENSION ,


NO: 51275481, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

2143

SANTOSH INDUSTRY

NO 27/27 STORE STREE KALASIPALYAM BANGALORE PIN CODE: 560002, STD CODE: 00080,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2144

CHIRAG CARD CONTAINERS

KAMAKSHIPALYA MAGADI ROAD BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO:
23486277, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

PIN CODE: 560054, STD CODE: NA , TEL

160

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
2145

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
NO7 AZAD STEELS

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

BLACKSMITH LANE SLAUGHTER HOUSEROAD BANGALORE 2 PIN CODE: 560002, STD CODE:
NA , TEL NO: 22233046, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2146

SREE FABRICATORS PRIVATE LIMITED

PETECHANNAPPA INPUSTRIAL AREA RAMARSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 28984690, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2147

GEWCOMMERCIALENGINEERINGWORK
S

NOZINARASIMHAIAHROADBLOCKVENKESHPURAM BANGALORE45 PIN CODE: NA , STD CODE:


25471, TEL NO: 870, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2148

SHANMUGAM VIJAY SURGICALS ALL


TYPE OF FUR

NITURES A5/4 7CROSS 6 BLOCK DR RAJAKUMAR ROAD BANGALORE PIN CODE: 560010, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2149

OHANASHEKAR MKS #O3 4CROSS


MAGAD MAIN RO

AD KAMSKSHIPALYA BANGAL0RE ,
NO: NA, E-MAIL : N.A.

1995

10 - 50

2150

SARVANAAN

SARVANAAN INDUSTRIES 4THCROSS 4THMAINROAD INDUSTRIAL OWN RAJAJINAGAR


BANGALORE PIN CODE: 560044, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2151

BANGALORE MONOFILAMENTS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2152

V R INDUSTRIES

PETECHANNAPPA INDUSTRIAL AREA LAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23287333, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2153

X R INDUSTRIES

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23287333, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2154

SPRING PLATE RE SE ING

OPPOSITE KHALITY FACTORY JYOTH NAGAR MYSORE ROAD BANGALORE PIN CODE:
560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2155

IKBAL METAL UORKS NOS ZND


MAINAOAD

MADIVALA MARUTINAQAR BANGARORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2156

SURENDRA AGARWALA

DOMINERS NO 81/82 INDUSTRIAL AREA KORAMANGALA BANGALORE 95 PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2157

PERIKALM SUNDAR

S P M GRAPHICS P LTD NDUSTRIALTOWN RAJAJI NAGARAIBANGALDRE 56OO44 PIN CODE:


560044, STD CODE: 91 80, TEL NO: 23303147, FAX NO: 23380157, E-MAIL : N.A.

2000

10 - 50

2158

ADITHYA AUTOCOMPONENTS

PETECHANNAPPA INDUSTRIAL AREA KAMARSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23481785, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX

161

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2159

ANDHAN GOWDA

BEGUR ROAD HONGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2160

BIJAY HAMANA NDUSTRIES STH CROSS

CHIKKA ADIGUDI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2101

10 - 50

2161

MET FORM ENGINEERS

ISTH CROSS ROAD JPNAGAR 3RD PHASE ,


, FAX NO: NA, E-MAIL : N.A.

7948

10 - 50

2162

MANAGER

V M FABRICAS D397 1 STAGE PEENYAINDUSTRIA L AREA PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2163

MANAGER

RAJAINDIA LYD NOI94 YASWANTAPURA SUB UMK UR ROAD BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2164

MANAGER

PUPPARAL PAKS NO328\1 PEENYA NDASTRIAL ESTA BANGALORE 56OO58 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2165

MANAGER

A C M S FYABRICS NOC/3141PEENYA INDASTRIA L ESTA BANGALORE 56OO58 PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2166

MANAGER

FAIN PLNGES NO 295 PEENYA INDASTRIAL ESTA BANGALORE S6OOS8 PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2167

MANAGER

SREENIVASA ENGINEERINGS NO351 PEENYA IND ASTRIAL ESTA BANGALORE 56OO58 PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2168

MANGER

DETAKYAS MALSEBALS 4370 1STSTAGEPEENYAI USTRIALARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28397590, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2169

MANAGER

BALAMBIKAMETALPINISING C435 PEENYAINDUSTR IAL ARIA PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2170

MANAGER

KIRAN METAL FINISHERS NO PEENYA ISTSTAG PEENYA NDUSTRIAL ESTATE BANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2171

MANAGER

UDAYAINDUTRIS AN SO9OO1-2OOO PEENYA NDU SRIAL ARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2172

MANAGER

MOHANMETAL CRAFT NO122 1 STAGE PEENYAINDU STRIAL AREA BANGALDRE PIN CODE:
560058, STD CODE: NA , TEL NO: 25112110, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 660078, STD CODE: NA , TEL NO: NA

162

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2173

MANAGER

HANSHREE RETERS NO C-252 VCROSS STAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN
CODE: 560058, STD CODE: 28394, TEL NO: 981, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2174

MANKGER

HIMEC ENGENEERING NO B-137 3 CROSS 1ST S AGE PEENYA SNDUSTRIAL ESTATE BANGALORE
PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2175

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2176

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2177

SAMSON NDUSTRIAL COMPONENTS

NA

10 - 50

2178

***

NA

10 - 50

2179

SIDDIVINAYAKA INDUSTRIES
DEVASANDRA INDUS

TRIALI MAHADEVAPU POST SINGHYANAPALYA BANGALORE PIN CODE: 560048, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2180

BALAJI NDUSTRIES

NO 525 K R GARDEN 8TH BLOCK KORAMANGALA BANGALORE PIN CODE: 500095, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

51 - 100

2181

***

HG ZB ,

2001

51 - 100

2182

MANAGER

JAYASHREE IDASTRIS 6I6 PEENYAIDUSTRIYALAR IA PEENYABANGALORE PIN CODE: 560058,


STD CODE: NA , TEL NO: 28399558, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2183

MANAGER

SNOHET EC LANDR NO252 PEENYA NDUSTR AL ARIA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 51170888, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2184

DRAWCANS PRIVATE LIMITED NO IB J R


NABAR

JRD PHASE IS MAIN BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1978

101 - 500

2185

NAYAK M M

DURAND PROSSES PVT LTD NO8INDUSTRIAL LAYOUT KORAMANGAL BLORE 95 PIN CODE: NA
, STD CODE: NA , TEL NO: 25531225, FAX NO: NA, E-MAIL : N.A.

1980

101 - 500

2186

JP PATIL MSR SNDASTRIAL ESTATE


GOKULA EX

ENCION BANGALDRE ,
E-MAIL : N.A.

1997

101 - 500

2187

***

2002

101 - 500

KADUGONDANAHALLI BANGALORE CITY ,


FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560078, STD CODE: NA , TEL NO: 26585674,

PIN CODE: 560054, STD CODE: NA , TEL NO: 23601437, FAX NO: NA,

GK FACTORX 625 KR GARDEN KORAMANGALA BRLOCK BANGALORE PIN CODE: 500095,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

163

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2188

MANAGER

KRISHNA INDUSTRIS NO25/26 INDUSTRIAL AREA MAIN ROAD Y PR BANGALORE PIN CODE:
560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2189

MANAGRA

OEMACAL ENGENAREES NO2I4 PEENYA IDUSIRIAL ARIA BANGALORE PIN CODE: 500058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2190

MANAGER

TASTARAL ENGINERING NO226 PEENYAIDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28395416, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2191

KRISHNA FABRICATION PRIVATE


LIMITED

#6A 1STPHASE PEENYA INDUSIRIAL AREA BANGA LORE PIN CODE: 560058, STD CODE: 080,
TEL NO: 28394125, FAX NO: NA, E-MAIL : N.A.

1973

> 500

2192

CHANDRA

CHANDRA ENGINEERCNG WORKS NO_52/53/54 4 C ROOS 5 BLOCK KORAMANGALA


BANGALORE_95 PIN CODE: NA , STD CODE: NA , TEL NO: 25531174, FAX NO: NA, E-MAIL :
N.A.

1990

> 500

2193

GM

TRIDEN FABRICATION PV LTD PLOT #28 3MA IN ROAD 1PHASE PEENYA INDL AREA BLORE PIN
CODE: 560058, STD CODE: NA , TEL NO: 28395019, FAX NO: NA, E-MAIL : N.A.

1991

> 500

2194

MANAGER

BUUAL K INDOSTRIAL NO2SB2 INDUSTRIALARIA Y P R BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

2195

MANAGER

GUTOMATIC IDUSTRIS NO 23B3 NDUSTRIALGRIA Y P R BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

1982

10 - 50

NIC 2004 : 2911-Manufacture of engines and turbines, except aircraft, vehicle and cycle engines
2196

APEKSHA TOOLS

NO. 79/80 2ND CROSS NETRAVATHI EN ROAD YELACHENAHALLI KANAKAPURA ROAD


BANGALORE PIN CODE: 560078, STD CODE: NA , TEL NO: 56980380, FAX NO: NA, E-MAIL :
N.A.

NIC 2004 : 2912-Manufacture of pumps, compressors, taps and valves


2197

BEST 8 CROMPTON ENGG

PUMP FACTORY YEDIYUR M_M NDUSTRIAL ESTATE BANGALORE PIN CODE: 560082, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

2198

ALLIDE ELECTRICALS

A27 HM INDUSTRIAL ESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389744, FAX NO: 23491877, E-MAIL : N.A.

1970

10 - 50

164

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

2199

MASHAGOWEL

NO-151 NDISALESTATE RAJAJINAGAR BANGALORE 44 PIN CODE: 560044, STD CODE: NA ,


TEL NO: 23112408, FAX NO: NA, E-MAIL : N.A.

2200

GARITHA ENGINEERING WORKS

PETELHANNAPPA INDUSIRIQL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23485771, FAX NO: NA, E-MAIL : N.A.

2201

NO 79 BEHIND LIDKAR QUOTERA

HIDAYA NAGAR K G HALLI BANGALORE 560045 PIN CODE: 560045, STD CODE: NA , TEL NO:
56994925, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)
1984

(5)
10 - 50

2001

10 - 50

NA

10 - 50

NIC 2004 : 2913-Manufacture of bearings, gears, gearing and driving elements


2202

GHATGE PATIL RANSPORTS

NO 3/2ICROSS SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
23973420, FAX NO: NA, E-MAIL : N.A.

1948

10 - 50

2203

BALASI NDUSTKEES

J ASHOCK BALAS TNDUSTRIES H M INDL ESTA TE BANGALORE PIN CODE: 560031, STD
CODE: 080, TEL NO: 28389698, FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

2204

VELL CASTE STEELS LIMITED

3PHASE PEENYA INDUSTRIAL AREA BANGALORE ,


NO: 28394058, FAX NO: NA, E-MAIL : N.A.

1973

10 - 50

2205

KARNATAKA SWITCHGRARS

NO S CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22222293, FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

2206

MANAGER

ANILGERS 229/3 PEENYAINUSTRIALARTA PEENYA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28371040, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2207

NAGA SWITCHGEAR

NO A B CROSS SUDHAMANAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22227157, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2208

SHIVANDA

S CROSS H M MAIN ROAD JALAHALL BANGALORE PIN CODE: 560079, STD CODE: 080, TEL
NO: 23453822, FAX NO: NA, E-MAIL : N.A.

1994

51 - 100

PIN CODE: 560058, STD CODE: 080, TEL

NIC 2004 : 2915-Manufacture of lifting and handling equipment


2209

PRASAD ENTERPRISES

B2O HM ZNDUTRIAL ESTATE


X BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389816, FAX NO: 28389237, E-MAIL : N.A.

1965

10 - 50

2210

WIPRO RLUID POWER LTD

#9610AIPHBSE PEENYA INDUSTRIAL AREA BANGA LORE PIN CODE: 560058, STD CODE: 080,
TEL NO: 28394982, FAX NO: 28396450, E-MAIL : N.A.

1976

> 500

165

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 2919-Manufacture of other general purpose machinery

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2211

SUNIL BANGALORE

NO 73 R&R TOUCH PRIVATE LIMITED INDUSTRIALESTATE BANGALORE 44 PIN CODE: 560044,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

2212

KARNATAKA WEIGHERS & WEIGHING


PROOUCTS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE 1 PIN CODE: 560079,


STD CODE: 080, TEL NO: 23489077, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

2213

S.MALA HVAC SYSTEMS PRIVATE


LIMITED

I45 2ND MAIN ST BCROSS 1STAGE DOMLUR BANGALORE PIN CODE: 560071, STD CODE: NA ,
TEL NO: 5352410, FAX NO: 5353759, E-MAIL : N.A.

2002

10 - 50

2214

FILTERS INDIA

IG STH CROSS AVAREKERE BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

2215

SINCRON MECHINS TOOLS

SG A CROSS 4 N BLOCK RAJAJINAGAR RANGALOR ,


TEL NO: 23123655, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560029, STD CODE: NA , TEL NO: NA

PIN CODE: 560010, STD CODE: NA ,

NA

> 500

NIC 2004 : 2922-Manufacture of machine-tools


2216

***

PIN CODE: NA , STD CODE: NA , TEL NO: 23324443, FAX NO: NA, E-MAIL : N.A.

1945

10 - 50

2217

***

PIN CODE: NA , STD CODE: NA , TEL NO: 23324443, FAX NO: NA, E-MAIL : N.A.

1945

10 - 50

2218

ARUNA ENTERPRICES

AOT HM INDUSTRIAL ESTASE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389714, FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

2219

PURVSHOTTAM ENGINEERING WORKS

PURUSHOTTAM ENGINEERING WORKS H M INDL ESTATE BANGALORE PIN CODE: 560031, STD
CODE: 080, TEL NO: 28389240, FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

2220

SATHISH INDUSTRIES

A10 HM INDUSTRIAL 2 ESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28396721, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

2221

JYOTHY NDUSIAIES

B R PRASANNA JYOTH INDUSTRIES H M NDL ESTATE BANGALOAE PIN CODE: 560031, STD
CODE: 080, TEL NO: 28389691, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

2222

S LOKANATH

A 21 S LOKNATH HMT NDL ESTATE BANGALORE ,


NO: 28089396, FAX NO: NA, E-MAIL : N.A.

1967

10 - 50

2223

ANUAPD ENGINEERING

MODISH ANUARD ENGINEERINS A 0I HMT ND E TATE BANGALORE PIN CODE: 560031, STD
CODE: 080, TEL NO: 28385847, FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

PIN CODE: 560031, STD CODE: 080, TEL

166

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

E N NARAYAN FRONTLINE PAECISION LTD HM NDL ESTATE BANGALOFE PIN CODE: 560037,
STD CODE: 0180, TEL NO: 28385847, FAX NO: NA, E-MAIL : N.A.

1969

10 - 50

A OT K C VENKATESH HMT NDL ESTATE BANGAL ORE PIN CODE: 560031, STD CODE: 080, TEL
NO: 28801426, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

2224

FRDNTLINE PRECISION P LTD

2225

***

2226

AKIL ALI

A 27 AKIL AL H M INDUSTRIAL ESTATE BAN GALORE PIN CODE: 560031, STD CODE: 080, TEL
NO: 28389794, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

2227

PRECISION ENGG & CHIMING


EQUIPMENTS

BRIGADE M M K R ROAD BANGALORE ,


26764630, FAX NO: 26760690, E-MAIL : N.A.

1975

10 - 50

2228

GM

HMT MACHINE TOOLS LIMITED CNC SYSTEMS DIV ISION PEENYA NDUSTRIAL AREA BANGALORE
PIN CODE: 560058, STD CODE: NA , TEL NO: 28394774, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2229

BOMBAYITOOLS SUPPLY

NO24 ARUNABUILDING JCROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
26707650, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2230

UDAY COMPUTER MANUFACTURING


PRIVATE

LIMITED B O8 B E L NDNSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD


CODE: 23, TEL NO: 23450162, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2231

JAP KNGINEERING

B-I4 BEL INDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23451210, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2232

SXAYAD ENGINEERING WORKS

PETECHANNAPPA TNDUSTRIAL AREA KAMAKSHI8ALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23582769, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2233

MICRON ENGINEERS

B-IO B E L NDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23452055, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2234

PNEUMAC COMPANY

I3TH MAIN ROAD GAYATHR NAGAR RAJAJINAGARA, BANGALORE PIN CODE: 560021, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2235

DHANBIR SINGH DASHMESH


ENGINEERING

PLOT NO 56 RAJAGOPALA NAGAR MARUTH THEA RE ROAD NEAR R V SCHOOL BANGALORE


PIN CODE: 560058, STD CODE: NA , TEL NO: 8361504, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2236

LAVEENA ENGINEERING WORKS

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23586024, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2237

AXWEL (INDIA) PRIVATE LIMIIED

AI2 HM INDUSTRIAL ESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389582, FAX NO: 28389823, E-MAIL : N.A.

1995

10 - 50

PIN CODE: 560022, STD CODE: 9180, TEL NO:

167

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NO 1O44116 3RDMAINROAD RIVANIROAD BANGALORE 56OO54 PIN CODE: 560034, STD


CODE: NA , TEL NO: 23576299, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2238

***

2239

DEVELOPMENTAL INCUATIVES FOR


SOCIAL CAUSE

NO 35, HOTEL VIJAYADARSHINI BEHIND MYSORE ROAD, BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2240

VENKATESH

SHIVASHAKTHI ENTERPRISES 9/22CROSS 6BLOCK BANGALORE PIN CODE: 560010, STD CODE:
080, TEL NO: 23407087, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2241

ANAND

SHIVASAKTH MISSION SHAP MES ROAD JALAHAL LY BANGALORE PIN CODE: 560013, STD
CODE: 080, TEL NO: 28381315, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2242

SURESH

TOOLS INDASTRITS NO 21 14 CROSS DUSTRIA L A RAJAJINAGAR BANGALORE 14 PIN CODE:


560044, STD CODE: 00080, TEL NO: 23201640, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2243

LAKSHMINARAYANA

SREELAKSHM ENTERPRISES SEETARAMAIAH NDL ESTATE MES ROAD JALAHALLY


BANGALORE PIN CODE: 560013, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2244

SHIXASHANKAR

POOJA LATHE ENG WORKS SEETHARAMAIAH INDL ESTATE JALAHALLY BANGALORE PIN
CODE: 560013, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2245

RANU D R

PREMIER INDUSTRIES 14 MAIN ROAD PRAKASHNAUAR BANGALORE PIN CODE: 560021, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2246

C S VENKATESH

3079 SEETHARAMAIAH NDL ESTATE MES ROAD BANGALORE PIN CODE: 560013, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2247

RAVIKANTHA

NO G A CROSS A MAIN NDUSTRIAL TOWN RAJA JINAGAR BANGALORE PIN CODE: 560044,
STD CODE: 080, TEL NO: 51287550, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2248

MICRO HARD SER CE P A SHAJI

CR SS R M HAN ROY EXTENSION K H ROA BANU LORE PIN CODE: 560027, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2249

VENUGOPAL LATH MACHINE SHOP


JALAHALL

VILLAGE POLICE STATION ROAD BANGALORE ,


28381196, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2250

SUBHAS

3O2A SEETHARAMAIAH NDL ESTATK JALAHALLY BANGALORE PIN CODE: 560013, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2251

GRAND WELL NDUSTRIES

NO I2/21 4TH CROSS 6TH BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE:
NA , TEL NO: 23354252, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

PIN CODE: 560013, STD CODE: NA , TEL NO:

168

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2252

MANAGEA

TOOL ENGINIERING SARVEES PEENYA INDASIRIA L ESTA BGNGALORE SGOOSB PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2253

MANAGER

MAICROTIC TOOLSROOM PV LTD SB57 2CROSS ISTSTAGE PEENYAINDUSTRIALAREA


BANGALORE PIN CODE: 560058, STD CODE: 93412, TEL NO: 28077, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2254

MANAGER

INTEX TOOLS ZZO PEENYA NDUSTRILARIA PEENYA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28394218, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2255

MANAGER

OM HITEC OOL ROOM 4CROS STAGE BANGALDRE PEENYA NDVSTRIAL ESTATE BANGALORE
PIN CODE: 560058, STD CODE: 23723, TEL NO: 462, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2256

MANAGER

ORIENTAL OOLS NO2O 4CROSS STAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN CODE:
516008, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2257

ALPHA SYSTEMS

HMT MAINROAD DHIVANARA PALAYA BANGALORE PIN CODE: 560054, STD CODE: 080, TEL
NO: 23322260, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2258

ALPHA SYSTEMS GANESH MALLYA

NO 999, 10TH CROSS DEEWANARA PALYA EXTENSION BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2259

HITACH KOKI NDIA LIMITED

#9A IPHASE PEENYA INDUSTRIAL AREA BANGALO RE PIN CODE: 560055, STD CODE: 080, TEL
NO: 28396198, FAX NO: 51170777, E-MAIL : N.A.

1996

51 - 100

2260

***

2001

51 - 100

2261

VISHNU FORGE NDUSTRIES LIMITED

COI HM INDUSTRIALESTATE BANGALORE PIN CODE: 560031, STD CODE: NA , TEL NO:
28389195, FAX NO: 28388947, E-MAIL : N.A.

1963

101 - 500

2262

M PRBBAKZREN

HMT MALHINE TOOLS LIMETED REEL NO1STON OG VISIOA JALQHALLI BANGALORE PIN CODE:
560031, STD CODE: 080, TEL NO: 28394758, FAX NO: NA, E-MAIL : N.A.

1992

101 - 500

2263

***

NA

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: 1111, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2923-Manufacture of machinery for metallurgy: converters, ingot moulds, ladles and casting machines; metal rolling mills and rolls for
such mills.
2264

VEERARAGHAVY

NO 172 INDUSTRIALESTATE BANGALORE 44 PIN CODE: 560044, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

169

1971

10 - 50

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1988

(5)
10 - 50

GARUDA FASHIONS PV LTD 1OO 48 2NDMAIN ROAD RAGAJINAGAR BANGALORE 44 PIN


CODE: 560044, STD CODE: NA , TEL NO: 2505678, FAX NO: 23389610, E-MAIL : N.A.

1991

10 - 50

RAMESHKUMAR

A 68 2 CROSS NDUSTRIAL ESTATE RAJAJINAGA R BANGALORE 44 PIN CODE: 560044, STD


CODE: NA , TEL NO: 23113334, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2268

SANJIVANAYAK 779/106 5MAIN


PRAKASHNAGAR

BANGALORE PELEX INDUSTRIES MOTO PIN CODE: 560021, STD CODE: NA , TEL NO: 23324090,
FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2269

PANREDDY

RO ALEX MANSIONSURYA B2D39I82NDMAIN ROAD RAPAJINAGAR


INDUSTRIALTOWNBAGALORESGO044 PIN CODE: 560044, STD CODE: NA , TEL NO: 23230606,
FAX NO: NA, E-MAIL : N.A.

1998

51 - 100

1995

10 - 50

2265

DPBHATTACHARYA

BRITEPLATERSANDELECTRICALENGINEERS NO334 335 LIC COLONYNEARKESHAVATHEATRE


PIN CODE: 560022, STD CODE: NA , TEL NO: 23472460, FAX NO: 23373532, E-MAIL : N.A.

2266

M G REDDY

2267

NIC 2004 : 2924-Manufacture of machinery for mining, quarrying and construction


2270

TELCO CONSTRUCTION EQUIPMENT CO


LIMITED

NO 46E LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: 22243788,
FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 2925-Manufacture of machinery for food, beverage and tobacco processing
2271

VORION DISTILLERIES NC

VORION DISTILERIES NC NO1 NDUSTRIAL SUBURB YESHWANTH PURA BANGALORE 22 PIN


CODE: 560022, STD CODE: NA , TEL NO: 23379572, FAX NO: 23370548, E-MAIL : N.A.

1978

101 - 500

2272

LIKKER DEPO GOVT

SNGERSOLL RAND ROAD IPHASE NDUSTRIAL ARE A PEENYA BANGALORE PIN CODE: 560058,
STD CODE: 080, TEL NO: 28392433, FAX NO: NA, E-MAIL : N.A.

2002

> 500

NOZ3 SHIVA ORCHADE ZGMAIN ISTAGE BTM LAYOUT BBNGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: 26789025, FAX NO: 26788780, E-MAIL : N.A.

1980

10 - 50

NOIG MSR NDUSTRIAL ESTATE MATHIKERE BANGALORE PIN CODE: 560054, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

TAGETUMKURROADBANGALORE ,
NO: NA, E-MAIL : N.A.

2002

10 - 50

IJ

NIC 2004 : 2926-Manufacture of machinery for textile, apparel and leather production
2273

2274

2275

CD PARMESHWAR NAIR

HOMAGINDIAGMBHNO86INDVSTRIALSU
BRUBSECONDS

PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX

170

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

2276

SHANKAR R SHINDE MURIGESH S;A

SULOCHANA ENTERPRISES NO636 IS FL00R FIRS F CROSS 8 BLOCK KORAMANGALA LAYOUT


PIN CODE: 560095, STD CODE: NA , TEL NO: 25702913, FAX NO: 25713647, E-MAIL : N.A.

2277

DHARAM CHAND

NO 10/1 ST A CROSS OBALAPPA GARDENS NEW MISSION ROAD BANGALORE PIN CODE:
560027, STD CODE: 080, TEL NO: 22241293, FAX NO: 22220913, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

1988

51 - 100

NIC 2004 : 2929-Manufacture of other special purpose machinery


2278

RECISTARMANUFACHRING COMPANI
NO2 BANGALOR

SHBANAPRAKASH RECISTAR MANUFACHARINGCOMPQ NY MSRINDASTRIALXESTATE GOKULA


EXTENCION PIN CODE: 560054, STD CODE: 23603, TEL NO: 897, FAX NO: 23606212, E-MAIL :
N.A.

1969

10 - 50

2279

WORK SHOP BISMAN CHORD ROAD

JC ROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

1975

10 - 50

2280

***

NOB MSR INDUSTRTAL ESTAFE MATHIRERE BANGALORE PIN CODE: 560054, STD CODE: 00080,
TEL NO: 23600941, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2281

INFO CONTROL SYSTEMS

59 A CROSS 4 N BLOCK RAJAJINAGAR BANGALOR E PIN CODE: 560010, STD CODE: NA , TEL
NO: 23128464, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2282

MADHUS EQUIPMENTS

C_03 BRIGADE M M K R ROAD BANGALORE PIN CODE: 560082, STD CODE: 9180, TEL NO:
26763159, FAX NO: 26762912, E-MAIL : N.A.

1989

10 - 50

2283

RAMESHCHNDRA

NDGT G6MMAIN P M KALYANAMANTAPAROAD N S P ALYA BANGALORE PIN CODE: 560076,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2284

MSM AIRONISE NDUSTRIES

NO 16/A, MSR NDUSTRIAL ESTATE MATHIKERE BANGALORE PIN CODE: 560054, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2285

KINARA POWER SYSTEMS AND


PROJECTS PV LTD

N 21FIRSTMAIN THIRDCROSS SARASWATHIPURAM NANDINILAYOU BANGALORE


KINARA@VSNL.NE PIN CODE: 560096, STD CODE: NA , TEL NO: 23490254, FAX NO:
23490254, E-MAIL : N.A.

1994

10 - 50

2286

J P INDUSTRIES

PEENYA ISTAGE GORAGUNTEPALYA BANGALORE PIN CODE: 560022, STD CODE: NA , TEL
NO: 23371601, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2287

SRI RANGANATH

NO16/14 MYSORE KAVER PRODUCTS AGARABHAT ,4THCROSS SRIRAMPURAM BANGALORE


56O021 PIN CODE: 560021, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

171

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1999

(5)
10 - 50

153 166 1 EASTEND MAIN ROAD 9 BLOCK JAYANAGAR BANGALORE PIN CODE: 560069, STD
CODE: NA , TEL NO: 26588870, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

VIJAY KUMAR

I56 2ND STAGE 3RD BLOCK SANEGURUVANAHALL BASAVESHWARNAGAR BANGALORE PIN


CODE: 560079, STD CODE: NA , TEL NO: 57600815, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2291

UMA MAHESHWARA

IZZ H B MAIN ZND STAGE 3RD BLOCK SANEGU RUVANAHALL BASAVESHWARANAGAR


BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: 23236376, FAX NO: NA, E-MAIL :
N.A.

2004

10 - 50

2292

SELCO SOLAR PV LTD

#313 12 MAIN 15CROSS 5PHASE JPNAGAR BANGALORE PIN CODE: 560078, STD CODE: NA ,
TEL NO: 26493144, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2293

MANAGER

PYARAMAN COOLINGS M402 PEEEYA NDUSTRAL ESTATE BANGALORE 560058 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2929

10 - 50

2294

MANAGER

RAVI PETIHOUBE ZO9 PEENYAIDUSTRIALARIA PEENYA BANGALORE - PIN CODE: 500058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2295

MANAGER

S O TELIMETR CONMEN D389 PEENYAIDUSTR ALARIA PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2296

MANAGER

UNETED SELS S P NO 296/2PEENYAIDUSTRLALAR IA PEENYABANGALDRE PIN CODE: 560058,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2297

MANAGER

SREE A LAKSHMI SCRAP RADERS NO448 PEENYA INDUSTRIAL AREA 1 STAGE BANGALORE
PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2298

MANAGER

ALUKOT APLIKETARS NOZ3/4 DUSTRIALARIA Y P R BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2299

MANAGER

KUMARA NDUSTRIES NO8 PEENYA NDUSTRIAL ESTAE BANGALORE 56OO58 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2300

MANAGER

SUPARSTRENTHSTEEL NOI72 6THCROSS PEENYAID USTRIALAREA PEENYA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2301

MANAGER

KANODIYASTILAJAV PVTLTD NOA366 3TH CROSS 1STSTAGE PEENYAIDUSTRILAREA


BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: 28398702, FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

2288

PLASTRON PRODUCTS

PETECHANNAPPA INOUSTRIAL AREA KAMAKSHIPGLYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23489354, FAX NO: NA, E-MAIL : N.A.

2289

E N N D ASSOCIATES PRIJATE LIMITED

2290

172

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2302

MANAGER

STAR ENGINIARIG NOZS ISTAGE PEENYAINDUS RIAL ARIA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28391531, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2303

MANAGER

MANJUNATHA NDUSTRIALS NO 4Z ST STAGE PE ENYA NDUSTRIAL ARIA BANGALORE PIN


CODE: 5600 5, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2304

MANAGER

AMBA NDASTRIES NO825 LTHCROSS STSTAGE PEENYA NDASTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2305

MANAGER

INDUSTRIAL CONTROL NOB92 1STAGE2CROSS PEENYA NDUSTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: 2839928, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2306

MANAGER

SEFCON SYSTEMPTD NOM3 IS STAGE PEENYA INDUSTRIALTOWN BANGALORE 56OO5B PIN


CODE: 560058, STD CODE: NA , TEL NO: 839038, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2307

SYED HAROON IRON BOX FACTORY

NO 2O 6THCROSS CHALUVADI PALYA D1 TCM ROYAN ROAD BANGALOKE PIN CODE: 560053,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2308

SYED HASHIM SH NDUSTRIAL


CORPORATION

NO21 6TCROSS DR TCM ROYAN ROAD CROSS CHALUVAD PALYA BANGALORE PIN CODE:
560053, STD CODE: 080, TEL NO: 26709155, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2309

SHAHTH VENKATESH INDUZTRY

#63/1 NEWI5 VEERAPILLA STREET BANGALORE ,


NO: 25561973, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2310

INGERSOLLROND INDIA LIMITED

N78 IPHASE PEENYA INDUSTRIAL AREA BANGALO RE PIN CODE: 560058, STD CODE: 080, TEL
NO: 28371436, FAX NO: NA, E-MAIL : N.A.

1977

51 - 100

2311

MANAGER

C E C C FACTARY NO244 PEENYA NDUSTRIS NO 244PEENYAINDUSTRIALARIA BANGALORE


PIN CODE: 500058, STD CODE: NA , TEL NO: 28399602, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2312

MANAGER

J B C INDUSRIS NATIONAL PV LTD NO2I9 PEE NYA INUSTRIAL ARIA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2313

MANAGER

CANCOM ENGINEERINGS B86 2CROSS ISTAGE PEENYA NDUSTRIAL ESTATE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

1917

10 - 50

PIN CODE: 560042, STD CODE: NA , TEL

NIC 2004 : 2930-Manufacture of domestic appliances, n.e.c.


2314

CC CHELUVA

METALCLOTH PRODUCT PRIVATE LIMITED BEGVR ROAD BOMMANAHALLR PIN CODE: NA , STD
CODE: NA , TEL NO: 25732325, FAX NO: NA, E-MAIL : N.A.

173

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2315

KARLE INTERNARIONAL PRIVATE


LIMITED WIDIA

OPPOSITE NAGASANDRA PO BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560073, STD CODE: NA , TEL NO: NA

1960

10 - 50

2316

MYSORE HERMO ELCTRICALS PVT


LIMITED

#36 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28395525, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2317

HEAT CARB INDIA ENTERPRLSES

34 4MAIN 3PHASE PEENYA LNDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2318

SUSUOER

AGROENGINIATNMSERVICE DOODANNAINDIESTATE UISHWANEKDAMPOST PEENXA2STAGE


BANGALORE PIN CODE: 560091, STD CODE: 28362, TEL NO: 601, FAX NO: 554, E-MAIL : N.A.

1975

10 - 50

2319

SADANADA SITE NO 8 TUMKUR ROAD

DASARA HALLI BANGALORE PIN CODE: 560057, STD CODE: NA , TEL NO: 28395201, FAX NO:
NA, E-MAIL : N.A.

1980

10 - 50

2320

SADANANDA

SRINDUSTRIES112/53DODDANNAINDIESTATE VISH WANEEDAMPOST PEENYA2NDSTAGE


BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: 8365389, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

2321

TULIEF ENGINEERS

NOI4S 9MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE SB PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

2322

JANARDHAN

ACE TOOLS AND GUAGES RHB COLONY MAHADEVAPURAPOST BANGALORE PIN CODE:
560008, STD CODE: NA , TEL NO: 28512251, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

2323

SCORPTO INGINEERING PRIVATE


LTMITEO

#55 2 MAIN PEENYA INDUSTRIAL AREA 2 PHASE BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 25485376, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2324

SALAMSTEELSUPPLIERS

NO97SECONDSTAGEINDUSTRIALSUBRUBTUMKURROAD BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2325

MALLIKARJUN

NO 14 IZ MILE TUMKUR ROAD OPP PEENYA ELE PHON EXCHAGE BANGALORE PIN CODE:
000058, STD CODE: 080, TEL NO: 28391039, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

2326

DURGA PRAKASH

DUBAS ENGNEEYARING PRIVATE LIMITED NO327/IA 6CROBS N S PALYA BANGALORE-76 PIN


CODE: NA , STD CODE: 26683, TEL NO: 463, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2327

SOMASHEKAR CHIRANJIV SANJIV


INDUSTRIES

NEAR KALIVAMMA EMPLE DASARAHALL BANGALORE SGOOST PIN CODE: 560057, STD
CODE: 00000, TEL NO: 28396539, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2328

CARTONAL MACHINES INDIA PRIVATE


LIMITED

#31 4MAIN 3PHASE PEENYA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

174

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2329

PASUMA NDUSTRIAL TECHNOLOGIES

NO 368_369 4PHASE PEENYA NDUSTRIAL AREE BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28362147, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

2330

SREE GURU ENGINEERING WORKS

NOI37 I43 9MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

2331

NANDANA

STAN MEK ENGNERING MAZZID ROAO VIRATANAGM BOMMANHALL BANGALORE PIN CODE:
560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2332

MOHAPESH

KADDMBA PARNISHCRNTRR SISTEM 452 MASTD S RRET BEGUR ROAD BOMMANAHALLI


BANGALORE-68 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

2333

UNITEO MICROWAVES PRIVATE LIMITED

NO 8 2 MAIN JP NAGAR J PHASE BANGALORE PIN CODE: 560078, STD CODE: NA , TEL NO:
26588742, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2334

A PRABHU

CIRCUI AIDS ENER SAVE 238 31CROSS 7BLOCK JAYANAGAR BANGALORE PIN CODE: 560082,
STD CODE: NA , TEL NO: 26347401, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2335

SAN ELECTRONICS

NO C 9 K H B KSSIDC Y N K NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL


NO: NA , FAX NO: 11111111, E-MAIL : N.A.

1995

10 - 50

2336

PARAS METALLURGICALS

#ST 2CROSS 4MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 51170004, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2337

MADHUSUDHANREDDY

WIRING SRI SAI ECHNOLOGY RHB COLONY MAHADEVAPURAPOST BANGALORE PIN CODE:
560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2338

SHREE MAHESHWARI MARKETING

NO415IFLOOR 3MAINROAD MATHIKERE BANGALORE PIN CODE: 560054, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2339

DANIEL DAVID

NETWORK SERVICES NO 27 3 CROSS BEGUR ROAD OPPOSITE MICO BOMMANAHALLI


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 5735067, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2340

AMTABHALINDUSTIERS

DORESANIPALYA BANNERGHATTAROAD BANGACORE PIN CODE: 560076, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2341

S B AUTD NDUSTRIES

89 1 8MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2342

MURUGESH

SRI MURUGA ENGINEERING WORKS RHB COLONY MAHADEVAPURAPOST BANGALORE PIN


CODE: 560048, STD CODE: NA , TEL NO: 25600279, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

175

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2343

LUMEX SRINIVASA

42-4 3RD CROSS 1ST MAIN YESWATHAPUR BANGALORE PIN CODE: 560022, STD CODE: NA ,
TEL NO: 56694477, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2344

SHEE METAL CRAF PIPE LINE CIRCLE

SUNKADAKATTE VISHWANEEDAM POST BANGALORE PIN CODE: 560091, STD CODE: NA , TEL
NO: 23486825, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2345

CHANDANA ENGINEERING

BAIRAWESHWARA NAGAR 9TH H MAIN NAGARABHAV IS PHASE BANGALORE PIN CODE:


560072, STD CODE: 9580, TEL NO: 23390936, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2346

MAMAMADA PASHA STAN MEK


ENGENERING

MAZZID ROAD VIRATNAGAR BOMMANHALLT BANGALORE PIN CODE: 560068, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2347

SIRIUS CONTROL PV LIMITED

I77/3A DOLLARS COLONY BILEKAHALL B GROAD BANGALORE PIN CODE: 560076, STD CODE:
26584, TEL NO: 932 33, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2348

VRENGENERINGSPL

MAINROAD WARDNOZ KAMAAGONDANAHALL BANGALORE PIN CODE: 560015, STD CODE: 1,


TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2349

MAHAMADABDUL

HOUSUR ROAD ANEKAL BANMALORE SOUTH PIN CODE: 562106, STD CODE: NA , TEL NO:
7829124, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2350

TULASIRAMA GOWDA

ASHWIN ENTERPRISES NO 3288 5TH CROSS GAYATHRINAGAR BANGALORE PIN CODE:


560021, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2351

RAJASHEKAR

E S ELECTRONICS INDIA PRIVATE LIMITED #438 4MAIN 4CROSSNAGENDRABLOCK BSK1STAGE


PIN CODE: 560050, STD CODE: 91080, TEL NO: 26420623, FAX NO: 20420624, E-MAIL : N.A.

2000

10 - 50

2352

MAYASHRINIVAS MICROLITEINDUSTRIES

SINGASANDRA HOSURROAD BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2353

SWATHI ENGINEERINGS

DORESANIPALYA BANNERGHATTAROADBANGALORE PIN CODE: 560076, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2354

RAMA CHANDRA NAYAR

MANU ENGINEERING ENTERPRISES NO I04 K G HALLI BANGALORE PIN CODE: 560015, STD
CODE: NA , TEL NO: 28388582, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2355

ISMAIL

NOBLE STEELS PRIVATE LIMITED GARUDACHARPALYA BANGALORE_48 PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2356

JUICE AND SMAR FOOD SERVICE


SYSTEMS

KOTTIGEPALYA BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560068, STD CODE: NA , TEL NO:

176

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2357

CHANDRA ADMINISTRTOR

431 D 1 FLOOR N BLOCK RAJAJINAGAR BANGALORE 5600IO PIN CODE: 560010, STD CODE:
NA , TEL NO: 23472285, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2358

TATA SHIV PRASAD

VENKATFSHWARA ENGINEERING WORKS GARUDAEHARPALYA M D PURA POS BANGALORE


PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2359

GINEVA

PATTANDUR AGRAHARA NEAR BUSSTOP WHITE FIELD ROAD BANGALORE PIN CODE: 560066,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2360

A K SHETTY CL MATS

8THBLOCK KORAMANGALA BANGALORE PIN CODE: 560095, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2361

TRISHUL ENGINEERING

NO C 22 K H B KSSIDC Y N K NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2362

***

HI TECK INDUSTRIES 68/5 BEGUR ROAD CROSS KODICHIKHANAHALLI ROAD BHALLI BLORE-68
PIN CODE: NA , STD CODE: NA , TEL NO: 51110613, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2363

SRIMANIKANTENTERPRSES

DORESANIPALAYA BANNERGNATTAROADBANGALORE PIN CODE: 560076, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2364

KRISHNAKDMAR

JEENA ENGINIARING KAMPANS PRIVATE LTD DODDANEKKUND ROAD M D PVRA POST


BANGALOR PIN CODE: 56004, STD CODE: NA , TEL NO: 57683017, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2365

MURUGAN

MEENAKSH SHEE METAL WORKS RHB COLONY MAHADEVAPURAPOST BANGALORE PIN


CODE: 560048, STD CODE: 94, TEL NO: 48453652, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2366

KAMALSAGAR WHITEFIELD ROAD

NEAR TPL HOOD MAHADEVAPURA POS BANGALORE PIN CODE: 560048, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2367

INDIA INDUSTRIAL REFREGIRATION


COMPANY

NO. 25, IS FLOOR, KARNA SREE POINT, ANAND NAGAR, MARATHAHALL RING ROAD PIN
CODE: 560037, STD CODE: NA , TEL NO: 25238012, FAX NO: 25238116, E-MAIL : N.A.

2004

10 - 50

2368

RICHFIELD APTS NEAR OUTER RING


ROAD

RICHFIELD MAINTENESS OFFICE MARATHALLI POST KRPURA HUBL BANGALORE PIN CODE:
560037, STD CODE: NA , TEL NO: 25226100, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2369

MANAGER

NEW TACH SOLAR SYSTAM CASO PEENYAINUSTRIA LAREA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28395624, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2370

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

177

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

I9 MAJ GEN AD LOGANANDAN NA CROSS QUEENS ROAD BANGALORE PIN CODE: 560052,
STD CODE: NA , TEL NO: 22282221, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

KANAGA POLYMERSANDPOULTRY
EQUPIMEN

NAGADEYI NDOSTRIAL ESTATE KACHARARANAHALLI S HOMSTOWN POS PIN CODE: 560084,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2374

AIR ACTION EQUIPMENT

NAGADEVI NDUSTRIAL ESTATE KACHARAKARA HALL STTHOMASTOWN POS PIN CODE:


560084, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2375

NAGARAJ

JAYABHARATH LIPP PRJNOTE LIMITED 9THCROSS MARVTHTNAGAR BAPUJINAGAR


BANGALORE PIN CODE: 560042, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2376

PINTO

MICRO MAC ENGZNEERING NO SSI BEGUR ROAD BOMMANAHALLI BANGALORR 56OO68 PIN
CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2377

K THANKAPPAN SS ENGINEERING
ENTERPRISES

KALANAGAR MAIN ROAD KAMMAGONDANAHALL JALAHALL WEST BANGALORE PIN CODE:


560015, STD CODE: 00080, TEL NO: 80283890, FAX NO: 28384502, E-MAIL : N.A.

NA

10 - 50

2378

REGHUENGINEERINGWORKS
NOSTTHCROSS NEAR

SDAHIGHSCHOOL KALA COMPLEX ROAD KAMMAGONDANAHALL BANNALORE PIN CODE:


560015, STD CODE: NA , TEL NO: 93428194, FAX NO: 3457058, E-MAIL : N.A.

NA

10 - 50

2379

RAVIKIRANENGINEERINGWORKS
32SHANMUGAM

BUILDING 10THCROSS 2NDWARD KALANAGAR KAMMAGONDANAHALL BANGALORE 15 PIN


CODE: 560015, STD CODE: NA , TEL NO: 8388657, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2380

SHARATHENGINEERING NO5
4THMAINROAD

NEARJYOTHI COMPLEX KAMMAGONDANAHALLI JALAHALLIWES BANGALORE PIN CODE:


560015, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2381

SREELAKSHMIENGINEERINGWORKS

SUBBAIHBUILDINGOPPPOSTOFFICE 1STCROSS ABBIGEREMAINROADKGHALL JALAHALLIWES


PIN CODE: 560015, STD CODE: NA , TEL NO: 93413660, FAX NO: 22922756, E-MAIL : N.A.

NA

10 - 50

2382

***

NA

10 - 50

2383

K NES ENGINEERING WORKS

NO 383 4 PHASE 1O CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28360069, FAX NO: 8362383, E-MAIL : N.A.

NA

10 - 50

2384

CELTAK BATTERIES PV LTD

NO 47I B IV PHASE PEENYA ZNDUSTRZAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28361089, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2385

***

NA

10 - 50

2371

STEEL FACTORY MEHPBOOB

NOIGG BHAVANINAGAR NEAR MASSIDEBUBAI BSKASTAGE BANGALORE JO PIN CODE:


560070, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2372

ADITYA SOLAR SHOP

2373

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

178

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2386

SHREE V K N ENGENIERS

DEVASANDRA NDUSTRIAL AREA MAHEDEVAPURP POST SJNGHYANAPALYA PIN CODE:


500048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2387

UNIVERSAL ENGENEERING WORKS

DEVAVA AND NDUSTRIAL ESTATE STNGHYANAPAL YA BANGALORE PIN CODE: 560048, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2388

VIKAS ENGINEERING

MAMADEVAPURAPOST SINUHYANAPALYA BANUALORE PIN CODE: 560058, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2389

KARAN ENGINIYARING

MAHADEVAPURA POS DEUASANDRA INDUSTRIAL ARIA BANGALORE 48 PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2390

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2391

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2392

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2393

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2394

BADRA MATEL DRODAC OBALA REDDY


BUTLDING

DODDANEKUTDI POS MAHADEVAPURA POS BANGALORE PIN CODE: 560048, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2395

PRIMIER WAL TAK KVNHALAHALL MAIN


ROAD

DODDANEKUNDH INDUSTRIAL AREA MAHADEVAPURA POS BANGHLORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2396

PARK ECHNOLOGY OBALA REDDY


BUILDINS

DODDANEKUNDI NDUSTRIAL AREA MAHADEVAPURA POS


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

BANAALJRE PIN CODE: 560048,

NA

10 - 50

2397

OMI PORJ PRIVATE LIMITED


KUNDHALAHALL MA

N ROAD DODDANEKUND INDUSTRIAL AREA MAHADEVAPURA POS BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2398

DEMKOON HYDERO NEWMAYTICK


COMPANY

RAMAKRISHNA REDDY LAYOUT MRHAREVARURA BANGALORE 48 PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2399

VEER-O-MKTALS

A-OZ BEL IUDUSTRIAL ESTATE JALAHALL BAHGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23451945, FAX NO: NA, E-MAIL : N.A.

1986

51 - 100

2400

PRASSAR CKUKAR LTP

NO Z PEENYA INDUSTRIAL ESTATE 2 PHASE N T F ROAD BANGALORE NOKTH PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

179

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

2401

VIJAYA OOLS OBALA RADDY BUILDING

DODANEKUND INDUSTRLAL AREA MAHDEVAPVRA POST BANNGLORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2402

MAGENGINEERINGPV LTD

2403

Year of start of
Operation

(4)

Employment
Class

(5)

NA

51 - 100

IAII FIRSTMAYNROAD SECONDPHASE


Z PEENYAINDUSTRIALAREA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1986

101 - 500

JOHN PANIKAR PRAXAIR NDIA PRIVATE


LTD

D NO 8 ULSOOR ROAD BANGALORE ,


PIN CODE: 560042, STD CODE: NA , TEL NO:
25595922, FAX NO: 25595925, E-MAIL : N.A.

1997

101 - 500

2404

MEKS MISSION OOLS MD

MEKSINOMISIONTOOLS OPP HEARTHOSPITAL RAJAPALYA MAHADEVAPURAPOST BLORE


SOUTH PIN CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

2405

STARGATE ENGINEERING PRIVATE


LIMITED 861

MUNIREDDY LAYOUT MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN CODE: 560068,


STD CODE: NA , TEL NO: 25730609, FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

2406

SURA METAL INDUSTRTES

#GG 8MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

2407

C SUBRAMANYAM, MEHALA MACHINES


NDIA LTD.

# 268 18TH D MAIN ROAD, 6TH BLOCK, KORAMANAGALA, BANGALORE PIN CODE: 560095,
STD CODE: NA , TEL NO: NA , FAX NO: 25631765, E-MAIL : N.A.

2005

101 - 500

2408

MANAGER

ANU SOLARIPV LTD NO248 1S STAGE PEENYA INDUSTIAL AREA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2409

FLOWSERVE INDIA CONTROLS P LTD

PLAT N04 1A ROAD NO8 EXPOR PROMOTION INDUSTRIAL PARK WH E FIELD BANGALORE PIN
CODE: 560066, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2410

ANU TONES KUNDHALAHALLI MAIN


ROAD

DODDANEKUNDH INDUSTRIAL AREA MAHADEVAPURA POS BANGALORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2411

PUTTASWAMY REDDY

NOI2 ADJASGN BPL HOSUR MAIN ROAD BOMMANAHALLI BANGALORE PIN CODE: 560068,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

> 500

2412

KAVIRAJ IN CORPORATION

NO99 3MAIN3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

> 500

2413

SREE CHAKRA ENGENEARING NORKS

NO25 PEENYA INUSTRIAL ESTATE 2 PHASE N.T.T.F ROAD


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

BANGALORE PIN CODE: 560058,

NA

> 500

2414

GAP ENGENEERING

DEVASANDRA NDUSTRIAL ESTATE MAHADEVAPURA POST BANGALORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

180

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NIC 2004 : 3000-Manufacture of office, accounting and computing machinery


2415

NR FRANCIS

AZ APMC YARD BANGALORE ZZ PIN CODE: 560022, STD CODE: NA , TEL NO: 5128 805, FAX
NO: NA, E-MAIL : N.A.

2416

TSUNDARAMMAIYENGARANDSONS

NO67INDUSTRIALSUBRUBSECONDSTAGEYUMKURROAD BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

2417

DREAM QUES INFOTECH PVT LTD

NOI2/A POTTERY ROAD FRASER OWN BANGALORE PIN CODE: 560005, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

2418

V G P BABUDAS

PNB TECH VIEWS NO 51 27 MAIN 1CROSS BTM LAYOUT BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: 51201919, FAX NO: 51201180, E-MAIL : N.A.

2004

101 - 500

NA

10 - 50

NIC 2004 : 3110-Manufacture of electric motors, generators and transformers


2419

NO-33 1S MAIN CROSS


SRIKANTESHWARA

NAGAR YESHWANTHPUR NDUSTRIAL SUBURB BANGALORE ENI ANK@YAHOO.COM PIN


CODE: 560022, STD CODE: 080, TEL NO: 23577539, FAX NO: 23577540, E-MAIL : N.A.

1888

10 - 50

2420

KAPPA ELECTRICALS

B 1 JAIBHARATH NDUSTRIES ESTATE YASHWANTHPUR PIN CODE: 560022, STD CODE: NA ,


TEL NO: 23375096, FAX NO: 23345869, E-MAIL : N.A.

1974

10 - 50

2421

INDIANA METAL ZNDUSIRIES

#I69 X MAIN 3PHASK PEKNYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28395662, FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

2422

TRANSTECH ENGINEERS

B BEL NDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA , TEL
NO: 23451401, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2423

HY-TEK NDUSTRIES

CB JAIBHARATH INDUSTRIES YASHWANTHPVR BANGALORE-42 PIN CODE: NA , STD CODE: NA


, TEL NO: 23374404, FAX NO: 23374405, E-MAIL : N.A.

1991

10 - 50

2424

ASIAN INDUSTRIES

PETECHANNAPPA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23281103, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2425

V B L INNOVATIONS LIMLTED

#81 BZ 2MAIN 3PHASE PEENYA NDUSIRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2426

MANJUSHREE ELECTRONICS
LAKSHMISH KIN

GANGAMMA C
CHURCHROAD JALAHALLI POS ,
NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

PIN CODE: 560033, STD CODE: NA , TEL

181

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2427

MANGER

KANGOV ELECTRANICS PV LTD SBIOS ZCROSS PEENYAIDUSTRILARIA PEENYA BANGALORE


PIN CODE: 560058, STD CODE: NA , TEL NO: 23724709, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2428

MANAGER

KAMATH RANS FORMARS NCI24 PEENYA1 STAGE PEENYA NDASTRIAL ESTA


BANGALORE560058 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

2429

PRASHANTHA SHE Y PROFESSIONAL


DIESEL POW

ER ENGINEERS #88 D FLOOR 8MAIN I2CROSS BANGALORE 86 PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2430

TR BALARAM

ELECTRICAL EUPMENT CDMPANY MS RAMAIAH SNDUSTRIAL ESTATE GOKULA PIN CODE:


56004, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2431

CATAPILLAR EARTHMOVING EQUIPME


DISEALGEN

RATOR 38/5 COLRD ROAD FRAZER OWN BANGALO IE PIN CODE: 560005, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2432

AGNI MOTORS

NEAR GANGATHRI NURSING COLLEGE HANUMANTHA NAGAR SUNKADAKATTE BANGALORE


PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 3120-Manufacture of electricity distribution and control apparatus


2433

SWITCHGAREELECTRICALLIMITED

INDUSTRIALSUBRUBSECONDSTAGETUMKURROAD BANGALORE PIN CODE: 560022, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2434

NANDIPOWERELECTRONICS NO 6,
5MAIN MAGADI

MAIN ROAD KAMAKSHIPALYA BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2435

POWER BUTLDERS

R V ROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2436

VASUNDARA AUTOMATION
ENGINEERING LIMITED

NO 40-I0-8 MAIN BOVI COLONY BYRASANDRA JAYANAGAR BLOCK EAST BANGALORE PIN
CODE: 560011, STD CODE: NA , TEL NO: 26535340, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2437

MANAGER

SWICH CRAF INDIA NO383 6THCROSS 4THMAIN 1STAGE PEENYA NDUSTRIAL AREA
BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1983

10 - 50

PIN CODE: 560079, STD CODE: NA , TEL NO:

NIC 2004 : 3130-Manufacture of insulated wire and cable


2438

NARSIPUR & SONS

A-5 JAIBHARATH NDUSTRIES YASHWANTHPUR BANGALORG-22 PIN CODE: NA , STD CODE:


NA , TEL NO: 23376310, FAX NO: 23370088, E-MAIL : N.A.

182

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

2439

MAHENDRA

2440

***

(3)
MAHENDRAINDUSTRIESNO9OSECONDSTAGE INDUSTRIALSUBRUBYASHAVANTHAPUR
BANGALORE PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1994

10 - 50

NA

10 - 50

1998

10 - 50

1998

10 - 50

NA

10 - 50

NIC 2004 : 3140-Manufacture of accumulators, primary cells and primary batteries


2441

DEVARAJ IMAINROAD 2CROSS


GORAGUNTEPALYA

BANGALORE ,

2442

V S MANOHAR

GENESIS POWER EQUIPMENTS LIMITED SRINIVAGALU ROAD, EJIPURA, BANGALORE PIN CODE:
560047, STD CODE: NA , TEL NO: 25713514, FAX NO: NA, E-MAIL : N.A.

2443

***

2444

MANISHLAL

3/A 1PHASE 2CROSS PEENYA NDUSTRIAL AREA BANGBLORE PIN CODE: 560086, STD CODE:
080, TEL NO: 28395905, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2445

AMCO FACTORV

MYSORE ROAD BAPUJINAGAR RANGAIARE PIN CODE: 560026, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2004

101 - 500

2446

MR BALACHANDRA KIRLOSKAR
BATTERIES

NOBG 4 NDUSTRIAL SUBRUB YESWANTAPUR BANGALORE PIN CODE: NA , STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 3150-Manufacture of electric lamps and lighting equipment


2447

SADARAN

NO I6A PEENYA PHASS ZNDUSTRIAL AREA BANGALORK PIN CODE: 516005, STD CODE: 1080,
TEL NO: 28394292, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2448

RAMACHANDRAH ELECTRIC FACTORY

DOOR NO 42SUDHAMA NAGARA BANGALORE ,


NO: 855, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2449

DEEPA SOLAR LIGHTING SYSTEH

NOI9 HTHCHAIN OPPOSITE BNES COLLEGE MAHALAKSHMILAYOU BANGALORE PIN CODE:


560086, STD CODE: NA , TEL NO: 23494462, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2450

MANAGER

HYOROLIGHT NDAI NOC27O5THCROSSTSTSTAGE PEENYA NDASTRIAL TOWN BANGALORE


56OO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2451

MANAGER

MODRAN LLGHI NDAINOBIO3 STSTAGE PEENYA INDASTIAL TOWN BANGALORE SGOOS8 PIN
CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

PIN CODE: 560027, STD CODE: 30923, TEL

183

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 3190-Manufacture of other electrical equipment n.e.c.


2452

QUALITY ENGINEERING INDUSTRIES

KALYAN GARDENS NR COLONY BSF STAGE BANGALORE PIN CODE: 560050, STD CODE: NA
, TEL NO: 26767 56, FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

2453

NO 36/A, VACCUM EQUIPMENT, AGS


LAYOU

M S R NAGARA BANGALORE PIN CODE: 560054, STD CODE: NA , TEL NO: 23603183, FAX NO:
23601639, E-MAIL : N.A.

1989

10 - 50

2454

BELTRANICS

NO 59 S TH MAIN ROAD APPURAO ROAD CHAMARAJPE BANGALORETIB PIN CODE: 560018,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2455

LUWATNDIAPRIVATELIMITEDNO95SECO
NDSTAGE

INDUSTRIALSUBRUBTUMKURROADYASHAVAMTHAPUR BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2456

SUBRAMANYAM SR ENTERPRISES 45/4


8CROSS

6BLOCK DR RAJKUMAR ROAD BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2457

PAN GUPTA

NO IG I4 E CROSS NDUSTRIAL TOWN MAGAD R BAD BANGALORE PIN CODE: 560044, STD
CODE: 080, TEL NO: 23402550, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2458

SATEESH KUMAR ACE

#81\OLD NO 89\1 3RD CROSS SHAMARAJA IYE SATEESH KUMAR ACE PIN CODE: 560019, STD
CODE: 080, TEL NO: 26600959, FAX NO: 26600959, E-MAIL : N.A.

1998

10 - 50

2459

SNEHA ENTERPRISES

4O4I GROUND FLOOR 2OTHCROSS AND3 RD EAST BLOCK JAYANAGAR BANGALORE PIN
CODE: 560011, STD CODE: NA , TEL NO: NA , FAX NO: 55978990, E-MAIL : N.A.

1999

10 - 50

2460

GURUNATH ELECTROSYSTEMS

MAIN SUBRAMANYANAGAR BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2461

NITHIN DUT SAMSUNG INDIA PV LTD

NO 9 Z MAIN BTM STAGE BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
57595000, FAX NO: 57595024, E-MAIL : N.A.

2002

10 - 50

2462

RIYAGUR REHAMAN

CLASSIC ENTERPRISES FACTORY 310 25 5 MAIN HOSUR ROAD CROSS BEGUR ROAD
BOMMANAHALLI PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2463

BHARATH POWER CONTROL SYSTEMS

NO33 KOTTIGEPALYA MAGAD MAIN ROAD PIN CODE: 560091, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2464

YOUTH AFFIRS AND SPORTS GOVT OF


INDIA

WEST OF CARD ROAD INDUSTRIAL OWN RAJAJINAGAR BANGALORE PIN CODE: 560010, STD
CODE: NA , TEL NO: 23117787, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

PIN CODE: 560010, STD CODE: NA , TEL NO:

184

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2465

MANAGER

V V CONTRDL PTD NO1 PEENYA NDASTRIAL ES AT BANGALOR 560058 PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2466

MANAGAR

N V CONTROOL PEENYA IDUSTRIAL ESTA BANGA LORE 56OO58 NO L3/4 PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2467

MANAGER

NETWORK POWER TOOLS NO3 PEENYA NDUSTRIAL BANGALORE SGOO58 PIN CODE: 560058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2468

MANAGER

VALIDES CENTER A364 PENYAINDUSTRIAL AREA PEENYA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 51272026, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2469

MANAGER

SCAMETIC SISTAMS SB37O/2PEENYAINUSTRILAR A PEENYA BANGALORE PIN CODE: 560058,


STD CODE: NA , TEL NO: 28399558, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2470

MANAGER

ANNAPOORNESWAR ENTERPRISES PEENYAESTATE PEENYA NDUSTRIAL AREA BANGALORE


A357 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2471

MANAGER

P C KENON JEEN PVT LTD B385 STAGE PEENYAIDUSTRILARIA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 23724707, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2472

MAWAGER

PRAKASH ENTERPRISES NO56 PEENYA NDUSTR ALAREA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28395570, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2473

ONAR

TEKNO SENTAR 224 PEENYAIDUSTRIALAREA PEENYA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28391628, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2474

MANAGER

NAGTEC ELECTRONICS A421 PEENYAINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: 28959013, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2475

MANGER

KONACHIYA ALAY CORPORETION NOBO PEENYAIDU STRIALARIA PEENYA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: 28395608, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2476

MANAGER

ITACH PARLASIS LTD PLO NO 2B HTHCROSS PEENYAINDUSTRILARIA PEENYA BANGALORE


PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2477

MANGER

RAJESH ELECTRANICS A7B 5CROSS PEENYAIDUS RILARIA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28394634, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2478

MANAGER

TECNALAGE DEYELAPMEN KANSUZETION NOSG PEENYAIDUSTRYAARIA PEENYA BANGALORE


PIN CODE: 560058, STD CODE: NA , TEL NO: 22371203, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

185

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2479

MANAGER

TUMMALA ELECTRANICS PV LTD NOSZ 2NCROSS PEENYA NDUSTRILARIA BANGAZORE D PIN


CODE: 560058, STD CODE: NA , TEL NO: 28394256, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2480

MANAGER

M M EQPMENTS L P GAS EQVIPMENTS B391 PEENYA NDUSTRIALARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2481

MANAGER

DASTVEEN PVTLTD AI75 4 CROSS PEKNYAIDUSTR ILARIA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28366002, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2482

MANAGER

DHINESH EXPORT ADJASEN 3378 STAGE PEENYAIDUSTRILARIA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28396344, FAX NO: 1, E-MAIL : N.A.

NA

10 - 50

2483

MANAGFR

UNIVARSAL SPESHAZ ATRASIVS ATPEENYA IDOS RILARFA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28395117, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2484

MANGER

A B B SERVICES CENTAR NO 6 ACIDC BRIVICECENTER PEENYA S A BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28395912, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2485

MANGER

SADGURU SERMASISPV LTD PLATNO3II9 1STSTAGE PEENYAINUSRTIALARIA BANGALORE PIN


CODE: 560058, STD CODE: NA , TEL NO: 3396670, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2486

MANAGER

BHARATHIYA MANAKA BYURO NO48 PEENYAIDUST ALARIA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28395111, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2487

MANAGER

TADIMETI AROMATICAS LTD B3771 STAGE PEE NYAIDUSTRIAL ESTEI PEENYA BANGALORE
PIN CODE: 560058, STD CODE: NA , TEL NO: 28395233, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2488

MANAGER

C N C ATOMETIKBS B344 PEENYAIDUSTRILARIA PEENYA BANGALORE PIN CODE: 560058, STD


CODE: NA , TEL NO: 22372093, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2489

SUPARWAISAR

SUPAR RPAKEM KANSUCAC I52 PEENYAINDUSTRIL ESTE PEKNYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28395232, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2490

MANAGER

BHARATSISTAM P ESTE CAHI PEENYA INUSTR AL AAIA PEENYA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28399870, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2491

MANAGER

UNIVARSAL PARN PVT LTD A371 CROSS PEENY AIDUSTRIALARIA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28371956, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2492

MANAGER

E L HEET SERANIC NGINEERINGNOB93 1STAGE PEENYA NDASTRIAL TOWN BANGALORE


5GOO58 PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

186

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2493

YOUGANADA NO63

BASHA CERLE BANTALORE S60OOZ PIN CODE: 561003, STD CODE: NA , TEL NO: 23870021,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2494

NARENDRA

NARENDFA L MARKS NEAR WATERTAMK Z STAGE BASAVESWARANAGARA BANGALORE PIN


CODE: 560079, STD CODE: 080, TEL NO: 23224345, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2495

AUTO ENGINEERING WORKS

A-OI BEL NDUGTRCAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 56994093, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2496

***

PIN CODE: 560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2497

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2498

ELECTRICAL AND PRASS COMPANENDS


IS MAIN

CHIKKA ADUGODI HAVAREKERE MAIN ROAD BANGALORE PIN CODE: 560029, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2499

PROTECTRON ELECTROMFCH PUT LTD

D-11-14 BRIGADE MM KRROAD BANGALORE ,


26766696, FAX NO: 26761138, E-MAIL : N.A.

PIN CODE: 560070, STD CODE: 9180, TEL NO:

1972

51 - 100

2500

JH NAHATA REESARCH DEVALAPMENT


MANUFACHER

ING CORPORATION GOKULA BANGALORE 54 ,


23604133, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560054, STD CODE: NA , TEL NO:

1972

101 - 500

2501

MANAGER

ELECTROAPTICASSISTAMSLABRORTARY S R O GOVTOFINDIA PEENYAIDUSTRIALARIA


BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

NIC 2004 : 3210-Manufacture of electronic valves and tubes and other electronic components
2502

BHAVAN INDUSTRIES MANUFACTURING


COMPANY

MARENAHALL J P NAGARA 2 ND PHASE BANGALORE PIN CODE: 560078, STD CODE: 9180,
TEL NO: 26591609, FAX NO: 26595385, E-MAIL : N.A.

1884

10 - 50

2503

SHILTRONELECTRONICSENGINEERING
PRIVATELTD

SECONDSTAGENO62INDUSTRIALSUBRUBTUMKURROAD BANGALORE PIN CODE: 500022, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2504

RAKSHA ELECTRONIC INDUSTRIES

NO-147-2 MAINROAD A R COMPOUND MYSOREROAD BANGALORE PIN CODE: 560026, STD


CODE: NA , TEL NO: 26741424, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2505

KIRAN ELECTRICALS

NO 8 8 CROSS SHAKTH GANAPATHINAGARA BAS AVESWARANAGARA BANGALORE PIN


CODE: 560079, STD CODE: 080, TEL NO: 23230251, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

187

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
2000

(5)
10 - 50

NO 141 MARENAHALLI 2 ND PHASE J P NAGARA BANGALOKE PIN CODE: 560078, STD CODE:
NA , TEL NO: 26596289, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

D_03 BRIGADEMM KRROAP JAYANAGAR BANGALORE PIN CODE: 560082, STD CODE: 00080,
TEL NO: 30926232, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

MURTHV ELEGTRONTCS PVT LTD GZIR BEGURICR OSS ROAD BLORE G8 PIN CODE: NA , STD
CODE: NA , TEL NO: 25736694, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

DINESH SINGH

LIVE WIRE ELECTRONICS NO 73 14 CROSS 1 BLOCK RT NAGAR BANGALORE 32 PIN CODE:


560032, STD CODE: NA , TEL NO: 23530578, FAX NO: 23530578, E-MAIL : N.A.

2009

10 - 50

2511

O E N NDIA LIMITED

NO 487A 4 PHASE Z CROSS PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28360217, FAX NO: 28360217, E-MAIL : N.A.

NA

10 - 50

2512

DEVARI ENGINEERINGS NO 396

A PHASE IO CROSS FEENYA INDUSTRTAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28360599, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2513

CLASSIC COMPUTERS

SECONDSTAGE INDUSTRIAL SUBRUB TUMKUR ROAD YESHAWANTHAPURA BANGALORE PIN


CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

2514

ELECTRONICS ASEMBLICS COMPANY

NO 64 MARENAHALL 21 57 MAIN ROAD J P NAGARA 2 ND PHASE BANGALORE PIN CODE:


560078, STD CODE: NA , TEL NO: 44212204, FAX NO: NA, E-MAIL : N.A.

1997

101 - 500

2506

RAGHU NANDHAN

UPADATAR ELECTRICAL SERVICES PVT LTD A-8 RANKA COLONY B G ROAD BANGALORE 76
PIN CODE: 560076, STD CODE: 00080, TEL NO: 26689100, FAX NO: NA, E-MAIL : N.A.

2507

ELECTRDNICS
MANUFACRURINGLCOMPANV

2508

ESSAE_TERAOKA LIMITED

2509

***

2510

NIC 2004 : 3230-Manufacture of television and radio receivers, sound or video recording or reproducing apparatus, and associated goods
2515

RAJA SHREE NSTRUMENTS

# 56 2ND FLOOR ON RAMAIAH LAYOUT BEHIND PRASHANTH HOTEL, PG HALL PIN CODE: NA ,
STD CODE: NA , TEL NO: 23449860, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

2516

K C KRISHAN

HO 494 R NAGAR MAIN ROAD R NAGAR BANG ALORE PIN CODE: 560032, STD CODE: 080,
TEL NO: 23546608, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2517

SUNDAR

#697 SUNDAR MILENIUM PLAZA CBI ROAD HM LAYOUT GANGANAGAR BANGALORE PIN CODE:
560032, STD CODE: 080, TEL NO: 51284351, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2518

RAKHESH TRADJNG COMPANY

NO 37 NEHRUCIRCLE SHESHADRIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA , TEL


NO: 23444500, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

188

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
2000

(5)
10 - 50

BPLBANNERUGHATTARORD ARAKERE BANGALORE 76 PIN CODE: NA , STD CODE: NA , TEL


NO: 23589080, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

DIGITAL WORLD

NO55 RAILWAY PARALLEL ROAD KUMARA PARK WEST BANGALORE PIN CODE: 560020, STD
CODE: NA , TEL NO: 23566644, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

SARAVU

BILEKAHALL B G ROAD BANGALORE-76 PIN CODE: NA , STD CODE: NA , TEL NO: 26782958,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2519

BALAJI ELETRO CONTROLARES PV LTD

NOI53/1BHARATHINDUSTRIALAREA BANNEGHA AROAD BANGALORE PIN CODE: 560076, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2520

RANJIATASHA

2521

2522

NIC 2004 : 3311- Manufacture of medical and surgical equipment and orthopedic appliances
2523

MANAGER

SAJNTIFIC SILICA RADERS NOI3 PEENYA NDA STRIAL ESTAT BANSALORE 56O058 PIN CODE:
560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2524

MANAGER

DMEGA SCIENTIFIC NDUSTRIES NO12 4CROSS PEENYA NDUSTRIAL ESTATE BANGALORE PIN
CODE: 560058, STD CODE: 51177, TEL NO: 726, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2525

MEDICAL INSTRUMENTS COMPANY

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

2526

CONFIDENTAL EQUIFMENTS

PETECHANNAPPA INDUSTRIAL AREA RAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23481619, FAX NO: NA, E-MAIL : N.A.

1986

101 - 500

2527

CONFIDEN DENTAL EQUIPMENTS

PETECHANNAPPA INDUSTRIAL AREA RAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23481694, FAX NO: NA, E-MAIL : N.A.

1993

101 - 500

NIC 2004 : 3312-Manufacture of instruments and appliances for measuring, checking, testing, navigating and other purposes except industrial process
control equipment
2528

S MURULIDHARAN SHIVA MAN


INDUSTRIES

OPPOSITE H M NDUSTRY KALA NAGAR K G HALL BANGALORE PIN CODE: 560015, STD
CODE: NA , TEL NO: 28389506, FAX NO: NA, E-MAIL : N.A.

1900

10 - 50

2529

TKKINIMANIGINGPOTNER

ELRKEINDUSTRIALENTERPRISESTOOLROOMDIUISIO N NO112AA
0OODANNAINO2ESTATEPEENXA2STAGE PIN CODE: 560091, STD CODE: 28360, TEL NO: 827,
FAX NO: 827838, E-MAIL : N.A.

1980

10 - 50

2530

THE SADARAN QAS LIMITED

NO 1O PEENYA NDUSTRIAL AREA BANGALORE 58 PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

189

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2531

KANTHI LAL

ARIYANTH NDUSTRIES 46/6 8 MILE BANGALORE HESRAGAHATTA BHUVANESHWARI NAGARA


PIN CODE: 560007, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2532

PROCESS PUMPS INDIA LJMLTED

86 6MAIN 3PHASE PEENYA INOUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28395327, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2533

MAMATHA INDUSTRIES

NOIS 1MAIN 3 PHASE PEENYA INDUSTRIAL AREA BANGALORE SE PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2534

GANESH NDUSTRIES

NO153 10MAIN JPHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2535

VARUNI NDUSTRIES

I3B B 9MAIN ROAD 3PHASE PEENYA INDUSTRIAL AREA BANGALDRE 58 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2536

GEOLOGICAL METALLURGICAL
LABORATORIES

IOS B MAIN 3 CROSS 2 STAGE YESHWANTHPUR ND SUBURB BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: 23472020, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2537

KAMALCFANIDORESANIPALAYA OPOSITE

INSTITUTE OF MANEGEMEN BG ROAD BANGALORE PIN CODE: 560076, STD CODE: NA , TEL
NO: 26584960, FAX NO: 26584963, E-MAIL : N.A.

1990

10 - 50

2538

MAHADAVI

AEGISINDUSTRIES NO99202OA DODDANNA NDES ATE NEARPEENA2NDSTAGE BANGALORE


PIN CODE: 560091, STD CODE: 28360, TEL NO: 847, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2539

M JAYASHEELAN

M K INDUSTRIES NO 20 KAMAGONDANA HALLI JALAHALL BANGALORE 56OO15 PIN CODE:


560015, STD CODE: NA , TEL NO: 28389359, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

2540

HINDUSTAN LEVER LTD

NO64 WHITE FIELD MAIN ROAD BANGALORE PIN CODE: 560066, STD CODE: 080, TEL NO:
28451605, FAX NO: 28453086, E-MAIL : N.A.

1994

10 - 50

2541

SURAJ METAL INDUSTRIES

FLOTND99 3PHASE PEENYA INDUSIRIAL AREA BANGALORE 58 PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2542

BALAJI

AEON GARUDACHARPALYA MAHADEVAPURA POS BANGALO PIN CODE: 560048, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2543

SABASTIN DSOUZA AUTOMACH


INDUSTRIES

HOSPALYA MANGAMMAPALYA ROAD BOMMANAHALL BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2544

TRIDEN POWER CRAPTS PVT LTD

NOTS BYRAVESHWARA IND ESTATE ANDRAHALLI MAIN ROAD BANGALORE PIN CODE:
560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

190

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2545

INDUSUTHENGINEERING PVJLTB

NO1 A FMRSTMAIN TPHASE PEENYAINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: 080, TEL NO: 28378172, FAX NO: 28398406, E-MAIL : N.A.

1997

10 - 50

2546

PADHMANADHAN

SPM TECHNICALS GARUDACHARPALYA MAHADEVAPURA POS BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2547

SUDHAKAR

SANPAR MICRO FILTERS GARUDACHARPALYA BANGALORE PIN CODE: 560048, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2548

JOEL KOECHLIN

RAJAHAMSA MAICROLIGH AIRCRAFT GOSAALE RO AD GARDDALAARPALYA M D PORA POST


BANGALOR PIN CODE: 560048, STD CODE: NA , TEL NO: 28516937, FAX NO: 28518485,
E-MAIL : N.A.

1997

10 - 50

2549

MASTER CONFECTIONARY

AYYAPPANAGAR DEVASANDRA KR PURAM BANGALORE PIN CODE: 560036, STD CODE: NA ,


TEL NO: 25618599, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2550

***

1998

10 - 50

2551

ASHOK SSELECTRICAL WORKS


BASAVANAGARAROAO

MAHADEVAPURAPOST BANGALOREDIST HOOOI ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2552

SHARIN HENSELFACTORYINDIA PV LTD

COUNTRYCLUBROAD SINGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2553

DURGADEV NDUSTRES

DORESANIPALYA BGROADBANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA ,


FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2554

AGAPPAINDUSTIES

DORESANIPALYA BANNERGHATTAROAD BANGALORE PIN CODE: 560076, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2555

NANDHITEK

DORESANIPALYA BANNERGA AROAD BANGALORE PIN CODE: 560076, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2556

OUSPHANTONY

ALOKA FLEX PVT LTD GARUDACHARPALYA BANGALORE PIN CODE: 560048, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2557

PG MEON

PADGO HYDRAULICS GARUDACHARPALYA B-48 PIN CODE: 560048, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2558

AJAYAGARNAL

458/24I/3AGROVN0FLOORBOMMANAHALL BANGALOR ,
TEL NO: 57629636, FAX NO: 739, E-MAIL : N.A.

2000

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560048, STD CODE: NA , TEL

191

PIN CODE: 560068, STD CODE: 080,

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2559

PRABHAKAR RAJU

ORIGIN OO COMS #39C SARVABOMA NAGAR BILEKAHALL BANNERUGATTA ROAD


BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2560

SAEE SAYHYANARAYANA IND

SHE NO1 GAJANAN NAGAR HEGGANAHALLI CROSS SUNKADAKATTE BANGALORE PIN CODE:
560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2561

PREMO PACK NO 155 BYRAVESHWARA


IND ESTA

E HEGGANAHALLI PEENY 11STAGE BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2562

ARVIN KVMAR

AKRO PACKAGING PRODUCTS GARUDACHARPALYA BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2563

AYYAPPA

LAXM SHEE METAL ENGINEERING WORKS GARUDACHARPALYA BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2564

D SELVA KUMAR

7 RHB COLONY WHITEFIELD ROAD MAHADEVAPURAPOST BANGALORE PIN CODE: 560048,


STD CODE: 080, TEL NO: 25600743, FAX NO: 28513201, E-MAIL : N.A.

2000

10 - 50

2565

NARASMIHARAO

TECHNOVISION NDUSTRIES BEGUR ROAD BOMMANBHALLI BANGALORE PIN CODE: 560068,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2566

SENTOM NDUSTRIES

NO C19 K H B KSSIDC Y N K NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2567

SRISRINIVASAINDUSTRES

N11MAINROAD WARDNO 2 KAMMAGONDANAHALL BANGALORE PIN CODE: 560015, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2568

SIRAJ AHMED KHAN

SWARAJ ENTERPRISES MAHADEVPURA MAIN ROAD GARUDACHARPALYA PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2569

RAVI AND RAMESHI

BHARATH PRESS COMPONENTS GARUDACHARPALYA BANGALORE 48 PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2570

POLY V

ARP INDUSTRIES FABRICATION K JOB WORKS MAHADEVAPURAPOST BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: 28515003, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2571

SAI PACKAGING

#A3 3PHASE 4 MAIN PEENYA NDDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2572

VIKASHA SA TRONICKS

NO 18 1 S CROSS CHURCH STREE B.NARAYANAPURA EXTENTION D V NAGAR POS PIN CODE:


560016, STD CODE: NA , TEL NO: 57728394, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

192

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

2573

JAYAPRAKASH SHETTY ARATHEEK CNC

2574

Year of start of
Operation

Employment
Class

(4)

(5)

HOSUR ROAD GARWKBHAVIPALYA BANGLORE 560068 PIN CODE: 560068, STD CODE: NA ,
TEL NO: 57675081, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

V RAMAKRISHNAPPA
PARTNERTOPCOATINDUSTRIES

NO26 9 MAINBEGURROADBOMMANAHALLIBANGALORE ,
57328, TEL NO: 05573216, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560068, STD CODE:

2004

10 - 50

2575

NAGENDRA H L

PURAVANKAR PROJECT LTD DODDANEKKUNDD ROA D GARDDACHARPALYA


MAHADEVAPURA POS BANGA PIN CODE: 560048, STD CODE: NA , TEL NO: 30622944, FAX
NO: NA, E-MAIL : N.A.

2004

10 - 50

2576

RAMA KRISHNA INDUSTRIES

3 4 1 CROSS RHB COLONY MAHADEVAPURA POS BANGALORE PIN CODE: 560048, STD CODE:
NA , TEL NO: 51163391, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2577

PUSPAKA ELECTRONICS PRO GAYITHR

NO155/4 WHITEFIELD ROAD B NARAYANAPVRA BANGALORE PIN CODE: 560016, STD CODE:
NA , TEL NO: 57653852, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

2578

SAPTHAGIRI NOI4A JAYALAKSHMI


POWER LOOMS

BELMARESTATE NAGASANDRA POST BANGALORE J ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL

2204

10 - 50

2579

PRAGNA MAICRO BISIN

KAREKALLU KAMAKSHIPALXA BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2580

HEGDE

MANUFACTUREOFTOOLS SIRMVROADBOMMANAHALL BANGMLORE PIN CODE: 560068, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2581

SATAN

SHEETALINDVSTRZESMVROADZM CROSS BOMMANAHALLIBEGURHOBLI BANGALORE PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2582

SRIHARSHAINDUSTRIES GTHCROSS
NEAR SDA

HIGHSCHOOL KAMMAGONDANAHALLI O JALAHALLIWES BANGALORE PIN CODE: 560015,


STD CODE: NA , TEL NO: 93437206, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2583

SREECHOUDAISHUAR NDUSTRIES
NO10 JYOTH

COMPLEXROAD ABBIGEREMATNROAD KAMMAGONDANAHALLIJALAHALLIWEST BANGALORE


PIN CODE: 560015, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2584

SREERAGAVENDRAINDUATRIES

ABBIGEREMAINROAE KAMMAGONDANAHALLI JALAHALLIWES BANGALORE PIN CODE:


560015, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2585

PRAKASH PISHEY INDUSTRIES

46/1 HESARAGHA A MAIN ROAD BHUVANESHWARINAGAR BANGALORE PIN CODE: 560057,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

193

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NO443 A 4 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28362455, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

14TH CROSS PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 580056, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

UNIPO INDUSTRIES 6TH CROSS DHODDANNA INDUSTRIES PEENYA ZND STAGE VISWANIDAM
PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NEARKTGCOLLEGE MATRUSHREEINDUSTRIALESTATE HEGGANAHALLI PEENYASECONDSTAGE


PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

GS INDUSIRIES ARUDACHARPALYA BANGALOREI PIN CODE: 560048, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1O7 PARUIN RANSPORT COMPOUND OPP ITPL GATE PA ANDUR AGRAHARA BLORE PIN CODE:
560066, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

#79-8O/I 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

51 - 100

FURNITURE FACTORY 7 CROSS


RAZHADNAGAR

BANGALORE-45 ,
N.A.

PIN CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

1995

51 - 100

2597

POLYWIN INDUSTRIES

120/1 B NARAYANAPURA DOORVANINAGAR WFROAD BANGALORE PIN CODE: 560016, STD


CODE: NA , TEL NO: 8518235, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

2598

BHASKARAN

VIVEK INDUSTRIAS GARUDACHARPALYM BANGALORE-48 PIN CODE: 560048, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

51 - 100

2599

DOLONOTECHNOPVTLTD

DORESANIPALYA BANNERGHATTAROADBANGALORE PIN CODE: 560076, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

2600

SHRINGAR ENGINEERINGS

92 93 5MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28398197, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

2586

SUSHMA NDUSTREES NO BE 2PHASE


IS MAIN

PEENYA NDUSTREES BPNGALORE SB ,


28395273, FAX NO: NA, E-MAIL : N.A.

2587

MULTMIN AGRO CHEMICALS

2588

RAKESH RENS PVT LTD PLO NO 488/E


PHASE

2589

***

2590

TURNTECK NDUSTRIES

2591

***

2592

MADHEVA1AH

2593

FHOCUS PACKS PVT LTD

2594

***

2595

BHARGAVA ROTOPACK

2596

PIN CODE: 560058, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

194

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2601

V BALASUBRAMANIAM VRS
ENIERPRISES

PUTTAPPA NDUSTRIAL ESTATE MAHADEVAPURA PO BANGALORE PIN CODE: 560048, STD


CODE: NA , TEL NO: 25600923, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

2602

MERCURYCORRUGATORS

60BMUNIREDDYBUILDINGKODICHICKKANAHALLI KAVERINAGARBOMMANAHALLIBANGALORE
PIN CODE: 560068, STD CODE: 57330, TEL NO: 25, FAX NO: 55, E-MAIL : N.A.

2000

51 - 100

2603

H M NAYAK

SHRIVA ENTERPRISES GARUDACHARPALYA M D PURA POS BANGALORE PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

2604

***

NA

51 - 100

2605

NAVAMT ENGINEERTNG PVT LTD

NO 461 4 PHASE PEENYA NDUSTRTAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 51272884, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2606

UNIVERSAL CARBURZING WORKS P LID

GEAR DIVISION POST BOX NO UBIS WHITEFIELD ROAD MAHADEVAPURA POST BANGALORE
PIN CODE: 560048, STD CODE: 91080, TEL NO: 28510408, FAX NO: 28518142, E-MAIL : N.A.

NA

51 - 100

2607

SIRIUS ZIP FASTENERS PRIVATE


LIMITED

NO13 2B PA ANDOOR AGRAHARA NEAR HOPE FARM WHITEFIELD BANGALORE PIN CODE:
560066, STD CODE: NA , TEL NO: 28452310, FAX NO: 28451644, E-MAIL : N.A.

NA

51 - 100

2608

KHEMKAINVESTMENT P LTD

WHITE FIELD ROAD NEAR MIB COMPLEX MAHADEVAPURA POS BANGALORE PIN CODE:
560048, STD CODE: NA , TEL NO: 28510467, FAX NO: 08511026, E-MAIL : N.A.

1967

101 - 500

2609

RAJKUMAR

SIPANI FIBERS LIMITED MAHESHWARYNAGAR MAHADEVAPURA P O BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: 28510828, FAX NO: NA, E-MAIL : N.A.

1981

101 - 500

2610

ARVIND MILLS LIMITED LALBA

WHITEFIELD ROAD PU APPA NDUSTRIALESTATE MAHADEVAPURA PO BANGALORE PIN CODE:


560048, STD CODE: NA , TEL NO: 28510787, FAX NO: NA, E-MAIL : N.A.

1993

101 - 500

2611

DUCKWORTH FLAVOURS NDIA PRIVATE


LIMITED

NO 99 HOPE FARM HOODY WHITEFEILD ROAD WHITEFIELD BANGALORE PIN CODE: 560066,
STD CODE: 91080, TEL NO: 28455560, FAX NO: 28455565, E-MAIL : N.A.

1995

101 - 500

2612

RAMRSH

MECOLAMENGINEERINGPVTLIMITED VIRATNAGARBOMMANAHALLIBANGALORE] PIN CODE:


560068, STD CODE: 91802, TEL NO: 5732919, FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

2613

YOGANANDAN ANAND ECHNOLOGIES


MJNIREDDY

BLD GARWEBHAVIPALYA HOSUR ROAD BANGLORE SGOOGB PIN CODE: 560068, STD CODE:
NA , TEL NO: 25736128, FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

2614

AFL LOGISTICS

MAHESHWARINAGARA MAHADEVAPURA P O PIN CODE: 560048, STD CODE: NA , TEL NO: NA


, FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

195

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

2615

SAMEER EXPORTS FABRIC GOWDAN


YESHWANTHPR

2616

***

DISTRICT : Bangalore

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

SLP COLP STORAGE COMPOUND NO IO4 G G PALYH 3 CROSS Z STAGE PIN CODE: 560022,
STD CODE: NA , TEL NO: 23371783, FAX NO: NA, E-MAIL : N.A.

1992

> 500

H K M C CO ON JNDUSTRIES NIOISI DEVARA C HIKKANAHALLI ROAD BEGUR BHALLI BLORE-GB


PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

> 500

SUPER FINE COLOUR TEX 397 2CROSS PEENYA NDUSTRIAL ESTATE PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 3313-Manufacture of industrial process control equipment


2617

MANGER

TL

2618

SHANKAR KASMIK MICRO SYSTEM PVT


LTD

53 5MAIN 6STAGE 1PHASE NDUSTRIAL AREA RAJAJINAGAR BANGALORE PIN CODE: 560044,
STD CODE: 98800, TEL NO: 45540, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2619

MANAGER

BIO CRAF NO 26 4CROSS STAGE PEENYA NDUSTRIAL ESTATE BANGALORE PIN CODE:
560058, STD CODE: 28395, TEL NO: 570, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

NA

10 - 50

NIC 2004 : 3330-Manufacture of watches and clocks


,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2620

***

2621

KN MUNIFACHBIAH

HMT SPECJBLISED WATCH CBSE DIVISION HM JALAHALL BANGALORE PIN CODE: 560031,
STD CODE: 080, TEL NO: 23370067, FAX NO: NA, E-MAIL : N.A.

1981

51 - 100

2622

KARTHIK ENTERPRISES

NO 8 PRABHATH COMPLEX KEMPEGOWDA ROAD BANGALORE PIN CODE: 560009, STD CODE:
NA , TEL NO: 22266811, FAX NO: NA, E-MAIL : N.A.

1997

51 - 100

2623

S K MANDEL

H M WATCH FACTORY JALAHALL BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1965

101 - 500

26 3 MAIN ROIAD PEENI PHASR NDUSTRIAL B RER BANGLORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

NIC 2004 : 3410-Manufacture of motor vehicles


2624

V RAMACHANRANI

NIC 2004 : 3420-Manufacture of bodies (coach work) for motor vehicles; manufacture of trailers and semi-trailers

196

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1950

(5)
10 - 50

NO32 WEAVERS LAYOUT VIJAYANAGAR ROAD OPP RAILWAY BRIDGE DEEPANJALINAGAR


BLORE PIN CODE: 560040, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

M R VISHWANATH BODY BUILDING RON


CULT

FITNESS CENTER NO IOP 8 TH MAIN 4 TH STAG E BASAVESHWARANAGAR BANGALORE PIN


CODE: 560079, STD CODE: NA , TEL NO: 23350180, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

MANAGER,S M KANNAPPA AUTOMOBILES


PVT LTD

NO12UNIT ST STAGE UMKUR ROAD BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28396609, FAX NO: NA, E-MAIL : N.A.

NA

2625

BANGALORE BODY BUILDERS PRIVATE


LIMITED

NO 147 MYSORE ROAD NEAR SIRS CIRCLE BANGALORE PIN CODE: 560018, STD CODE: NA ,
TEL NO: 26744696, FAX NO: NA, E-MAIL : N.A.

2626

SRI VINAYAKA COACH BODY BUILDERS

2627

2628

101 - 500

NIC 2004 : 3430-Manufacture of parts and accessories for motor vehicles and their engines
2629

ANILAMALA

NO 175 INDUSTRIALESTATE RAJAJINAGAR BANGALORE 44 PIN CODE: 560044, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2630

SRI VINAYAKA BODY BUILDER

NO32 ANJANAPPALAYOUT OPPOSITERAILWAY BRIDGE A IGUPPE BANGALORE PIN CODE:


560040, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2631

ARR PRECISION WORKS PV LTD

NO53/2 KAMAKSHIPALYA MAGAD MAIN ROAD BANGALORE PIN CODE: 560079, STD CODE:
080, TEL NO: 23583056, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2632

MANAGER

R K PRODCT BJ52 1SSTAGE PEENYAIDUSTRIALAR IA PEENYA BANGALORE PIN CODE: 560058,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2633

SUNIL RATHAMAT

NO 179 INDUSTRIALESTATE BANGALORE 44 PIN CODE: 560044, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2634

ORIGINE TOOLS CAMPS

N06O0/676NAJUNDIAHINDUSTRIALESTATE BANNEGHA AROAD BANGALORE PIN CODE:


560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2635

SANJEEVINI CNC EC

NEAR ADDON FACTORY KOTTIGEPALYA MAGADI MAIN ROAD BANGALORE PIN CODE: 560091,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

CT NO334 KUBERA MANSION NATIONAL HIGH SCH OOL ROAD V.V.PURAM BANGALORE PIN
CODE: 560004, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 3511-Building and repairing of ships


2636

THE JOIN DIRECTOR BANGALORE


RURAL DISTR

197

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 3512-Building and repairing of pleasure and sporting boats
2637

***

(3)

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

1989

10 - 50

NA

10 - 50

NIC 2004 : 3530-Manufacture of aircraft and spacecraft


2638

NERAGAEN

2639

***

NO-A-67 2ND CROSS INDUSTRIAL ESTATE RAJAJINAGAR BANUALORE-4H PIN CODE: 560044,
STD CODE: NA , TEL NO: 23402045, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 3599-Manufacture of other transport equipment n.e.c.


2640

ADDON FACTORY

NO462 KOTTIGEPALYA MAGADIMAINROAD BANGALORE PIN CODE: 560091, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

2641

ADDON FACTORY

NOHGZ KO IGEPALYA MAGADI MATN ZOAD BANGALORC PIN CODE: 560091, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

2642

THE HINDUSTAN ENTER PRISES

N 39-I3 I2WARD OCROSS PARIMALANAGAR BANGALORE PIN CODE: 560096, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2643

RAGENDRAN

I3I A 8O FEE ROAD ASHWATHNAGAR RMV EX LAYOUT BANGALORE 94 PIN CODE: 560094,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2644

MBVJESH

SHCVBFORM SIJ M GAJI MAEN R AD XBMAKSH BLYB NGB ORE PIN CODE: 560079, STD
CODE: 9580, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2645

SHANMUKHA INDUSTRIES

NOGIJ 1CAOSS MSRE LOLLEGE ROAD MATHIKERE BANGALORE PIN CODE: 560054, STD CODE:
NA , TEL NO: 51275519, FAX NO: 23602652, E-MAIL : N.A.

NA

10 - 50

2646

ADDON FACTORY

NO 462 KO IGEPALYA BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1980

51 - 100

2647

DIAMLER CHRYSLER

2ND FLOOR NO 2 EMBASSY CON INFANTRY ROAD BANGALORE PIN CODE: 560051, STD
CODE: NA , TEL NO: 56603700, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

PIN CODE: 560091, STD CODE: NA , TEL NO: NA ,

NIC 2004 : 3610-Manufacture of furniture

198

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2648

VARUNI NDUSTRIES

138 3 3MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1918

10 - 50

2649

FEATHER LITE OFFICE SYSTEMS

7/2 FLOWER GARDEN OPPOSITE BHEL MYSORG ROAD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2650

MARUTHITIMBARANDWOODWORK
AVALAHALLIDISTRH

AVALAHALLI IMBARVARDLAYOU MYSOREROAD BANGALORE 26 PIN CODE: NA , STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2651

RAHUL PARI

PARI SALES NDIA 3 STAGE RAJ ROAD PRAKASHNAGAR BANGALORE PIN CODE: 560021,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2652

MANIFACTURING SCIENTIFIC
NSTRUMEN

BROY NO 139 48 100 FEETRING ROAD 3RDPHASE PEENYA NDUSTRIAL AREA BANGALORE 58
PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2653

SUBBANNA ANIL INDUSIRIES


MANUFALTURERS OF

ALL TYPES OF STEEL ALMAIRS AND STEEL FURN ITURES CROS GBLOCS
RAJKUMARROADIBANGALOR PIN CODE: 560010, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1995

10 - 50

2654

23O
4KGNFURNITKRESDODNNANAGARAKAV
ALBIARSA

NDRARTNAGARAPOSTBANGALOAE32 ,
FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2655

ARMUGUM C

I485 6CROSS MARIYAPPANA PALYA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO:
23327037, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2656

GOKARNNA STEEL FURNITVRES

NOKGS IOTH CROSSANDIOTHMAIN LAKSHMINARAYA NAPURA BANGALORE PIN CODE:


560021, STD CODE: NA , TEL NO: NA , FAX NO: 1, E-MAIL : N.A.

1998

10 - 50

2657

VISHWAKARMA WOODCARVING WORKS

NOSS MAIN ROAD KOTTIGEPALYA BANGALOE PIN CODE: 560091, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2658

BILDRS KARPENTRY WORKS

MYSORE ROAD BANGALORE 98 ,


NO: NA, E-MAIL : N.A.

1998

10 - 50

2659

GREEN FIELD INDUSTRIES

NO2 4TH C CROSS ULLAL MAIN ROAD MUNESHWAR NAGAR JNANABHARATH BANGALORE
PIN CODE: 560056, STD CODE: 080, TEL NO: 23213771, FAX NO: 23213771, E-MAIL : N.A.

1999

10 - 50

2660

ASLAM

NO 110 KALASIPALYAM BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL NO:
86335733, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560032, STD CODE: NA , TEL NO: NA ,

PIN CODE: 560098, STD CODE: NA , TEL NO: NA , FAX

199

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

PIN CODE: NA , STD CODE: NA , TEL

2000

10 - 50

PIN CODE: 560072, STD CODE: NA , TEL NO: NA ,

2000

10 - 50

2661

SRI BARUCHA FURNITURES


SHOWROOM NO 766

I0OFTROAD HAL 2NDSTAGE BANGALORE 56OOO6 ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

2662

RAJA RAJESHWAR WOOD WORKS


GNANABHARAT

ROAD MOODALA PALYA BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

2663

KOMALKAPOOR INTERIOR DESIGNER

RAMAKRISHNA REDDY LAYOUT MAHADEVAPURA BANGALORE PIN CODE: 560048, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2664

SYNERGY LIFE STYLE COLTD

NO93 CROSS 1BLOCK JAKKASANDRAEXTENSION KORMANGALA BANGALORE PIN CODE:


560034, STD CODE: NA , TEL NO: 25530130, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2665

THE SUPREME INDUSTRIAL

N8FIRSTFLR KSGARDEN 4THCROSSLALBAGHROAD BANGALORE PIN CODE: 560027, STD


CODE: NA , TEL NO: 24145077, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2666

STEEL WABS

TOIZ MAIN AMBAMAHESWARI EMPLE KAMAKS PALYA BANCALOR PIN CODE: 560079, STD
CODE: NA , TEL NO: 94484730, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2667

LAKSHM POWER GEARS

NO 2O6 I/2B HENNUR BANDE KALYAN NAGAR POS BANGALORE PIN CODE: 560043, STD
CODE: NA , TEL NO: 25433143, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2668

MADHUKAR SHE Y PROPRITOR INTER


SPACE

INTERLORS DECORATIONS BLUE MOON ICAN GTH BLOCK 20THMAIN KORAMANGALA


BANGALORE PIN CODE: 560095, STD CODE: NA , TEL NO: 25533512, FAX NO: 25534722,
E-MAIL : N.A.

2003

10 - 50

2669

FAVERATE FURNITURE

703 LAXM COMPLEX 10OFTROAD JPNGR 6PHASE BANGLORE PIN CODE: 560078, STD CODE:
NA , TEL NO: 26556153, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2670

SUNSHINEFURNITURESSHOPPE

NO2IOPPOSITEOILA2COMPZENPANDTCOLONYAREBIC COLLEGEMAINROADBENGALORE2I PIN


CODE: NA , STD CODE: 98454, TEL NO: 94931, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2671

TOMY MYTHYU DIRECTOR NATURA


WOOD WORKS

#239 18 MAIN 6THBLOCK KORAMANGALA BANGALA PIN CODE: 560095, STD CODE: 91 80, TEL
NO: 25631241, FAX NO: 51105536, E-MAIL : N.A.

2004

10 - 50

2672

PACKAGE INDUSTRY FRUIT BOX


MANUFACTURING

NEAR NAGAVARA CIRCLE NAGAVARA ARABIC COLL EGE POST BANGALORE PIN CODE:
560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

2673

MR SHARIEFF

BANQALORE NODD FACTORY VT LTD NOI6INDUSTRIALSUBRJBTUMKURROADBANGALORE PIN


CODE: 560022, STD CODE: NA , TEL NO: NA , FAX NO: 11, E-MAIL : N.A.

NA

10 - 50

200

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

Employment
Class

(4)
NA

(5)
10 - 50

NA

10 - 50

NA

10 - 50

SONNAPPA GARDEN JUNADIYA STREE MODI ROAD CROSS DEVARAJEEVANAHALLI


BANGALORE 45 PIN CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PRINCE FURNITURES A CROSS WORK


SHOP NO 2

MODI ROAD DEVARJEEVANAHALL BANGALORE 45 ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560045, STD CODE: NA ,

NA

10 - 50

2679

HARSHATIMBAR &SAWMIL
HARSHAVARDHANA

TIMBARHARD LAYOU AVALAHALLI MYSORE ROAD BANGALORE 26 PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2680

NO6/IWOODEXBOX SCRAING
5THCROSS HASAKERE

HALL MAIN ROAD GANAPATHINAGAR MYSORE RD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2681

***

NA

10 - 50

2682

NO7/ 3RDMAIN MYSOREROAD


BANGALORE

1999

51 - 100

2683

MUKUNDAN REOM FURNITURES


EQUPMENTS

NO 777J 1OO FEET ROAD H A L 2 STAGE DHUPANAHALLI BANGALORE PIN CODE: 560038, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

101 - 500

2684

MANAGER

HINDUSTAN PARNICHR WORKS NO234 PEENYAINDS TRIAL ARIA BGNGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 8396197, FAX NO: NA, E-MAIL : N.A.

2674

***

2675

ALUNKRUTA FURNISHING

2676

***

2677

STAR FURNITURES ZALEEL NO I299

2678

(3)

Year of start of
Operation

BAGLA EXPORTS PRIVATE LIMITED I26/I8 8TH CROSS WILSON GARDEN BANGALORE PIN CODE:
560027, STD CODE: NA , TEL NO: 2296135, FAX NO: 2275285, E-MAIL : N.A.
ERESEN ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

NIC 2004 : 3691-Manufacture of jewellery and related articles


2685

RAJESH EXPORTS LIMITED

MFRS AND EXPORTERS OF FINE GOLD JEWELLERY BATAVIA CHAMBERS KUHARA KRUPA ROAD
PIN CODE: 560001, STD CODE: NA , TEL NO: 22266735, FAX NO: 22259503, E-MAIL : N.A.

1990

10 - 50

2686

ABAARANA GOLD

ABHARANA GOLD SHDP NO I92 IMAIN RDAD MAHALAKSHM LAYOUT ENTRAMCE BANGACORE
BS PIN CODE: 560086, STD CODE: NA , TEL NO: 35986000, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2687

SOMAR DESIGNATION WORKS

NO 168 1 CROSS AVENUE ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

201

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2688

NLRAPAD GOLDSMITH

NO12 7THCROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2689

SOMID HALLAK GOLDSMITH

NO 27 BAKSHI MOHIDIN SAB LANE JUMMA MASJID ROAD BANGALORE PIN CODE: 560002,
STD CODE: 00080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2690

ANJIN BAA HONER NO S1 DLSPENSARY


ROAD

SHINAOINATQR BDNTALORE SGO001 PIN CODE: NA , STD CODE: NA , TEL NO: 25591137, FAX
NO: NA, E-MAIL : N.A.

1999

10 - 50

2691

RAMAMOORTH SILVERSMITH

I7 2 2GTH CROSS KILARI ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO:
22203923, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2692

DEEPAKBAAG GOLDSMITH

NO 6 2NDCROSS NEAR R STREE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22353620, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2693

BAYAVAKIRAN TEWELLARY WORKS

NOK 2 KILARI ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

2005

10 - 50

2694

***

NA

10 - 50

2695

KOHINOOR GEM JEWELLARY

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

2696

NAVARATHNA JEWECS

RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

2697

PRATHIBHA JEWELLERS

RICHMOND CIRCLE BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

2698

HASSAN GEMS ANB JEWELLERS

RICHMOND CIRCLE BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

2699

SATHAI

3O TITH CROSS CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2700

CHINNN MAHIDAS

32 11TH CROSS CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
51143647, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2701

ASSPA DONE GOLDSMITH

33 11TH CROSS CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

202

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NO 65 CUBBON PET MAIN ROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: 1,
FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

ARUN

NO GS CUBBON PET MAIN ROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2705

SUNIL

NO ZS GANIGARA C LANE CUBBONPE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2706

NO 176 12 CROSS

CUBBONPE MAINROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

2707

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2708

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2709

BHIMA JEWLLERY

JAYANAGAR 3 BLOCK BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO: 26342300,
FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

2710

DOLANOTECHNOCHLRAFTSPRIVATELIM
ITED

BANNERGHATTAROAD DORESANIPALAYABANGALORE PIN CODE: 560076, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

2702

SAMIR GOLA

1B6/2 1 ST FLOOR CUBBONPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22234148, FAX NO: NA, E-MAIL : N.A.

2703

SHAMUL

2704

NIC 2004 : 3693-Manufacture of sports goods


2711

OFFICE OF THE EXECUTIVE ENGINEER


CENTRAL

STORE 3MAIN MARGOSA ROAD MALLESHWARAM BANGALORE PIN CODE: 560012, STD CODE:
NA , TEL NO: 22945205, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

2712

GOVT SERICULTURE MARKE

NO113 FIRSTFLOOR SUBEDAR CHATRAM ROAD GANDINAGARA BANGALORE PIN CODE:


560009, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

KARIYANNA PALYA BANGALORE ,


NO: NA, E-MAIL : N.A.

2000

10 - 50

2002

10 - 50

NIC 2004 : 3694-Manufacture of games and toys


2713

KHADHAR 75/9 RAMACHANDRAPPA


LAYOUT

2714

***

PIN CODE: 560084, STD CODE: NA , TEL NO: NA , FAX

TOYS N TOYS BABYSH NO 238 DSOUZA COMPLEX ROAD 1ST STAGE BANGALORE PIN CODE:
560038, STD CODE: NA , TEL NO: 51269426, FAX NO: NA, E-MAIL : N.A.

203

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 3699-Other manufacturing n.e.c.


2715

LAVEENA ENGINEERING

PETECHANNAPAA INDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: 080, TEL NO: 23586024, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2716

SIMHA ASSOCIATES

PETECHANNAPPA BNDUSTRIAL AREA KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2717

DIAMOND GRINDING AND NDUSTRY

TBG MAGADI ROAD SUNKADAKATTE HANUMANTHA NAGAR VISHWANEEDAMPDST


BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: 23337151, FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

2000

10 - 50

NA

10 - 50

NIC 2004 : 3710-Recycling of metal waste and scrap


2718

RAPEEQ OLD PLASTIC NDUSTRIEC

2719

***

NOGT1 AZIZSAIT NDUSTRIAL TOWN NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 3720-Recycling of non-metal waste and scrap


2720

SHEEBA POLYSONNS NOCKS PRIVATE


LIMITED

58 VRUSHABHAVATHINAGAR KAMAKSHIPALYA BANGALORE PIN CODE: 560079, STD CODE:


NA , TEL NO: 23484214, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2721

RAMANNA PLASTIC BATLE

NO94 A2IZSAL INDUSTRIAL OWN NAYNDAHALL MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2722

SWHEAL PLASTIC NDUSTRIEC

NO594 METRO FACTRY NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE: 560039, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2723

BOTTLE AND PAPER SECTION OR


GOWDAN

MUTHYALAMMA TEMPLE NEAR NAYANDANAHALLY BANGALORE 39 PIN CODE: NA , STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

1971

10 - 50

NIC 2004 : 4010-Production , collection and distribution of electricity


2724

KAVITHA ENTERPRISES

MANUVANA VIJAYANAGARA BANGALORE PIN CODE: 560040, STD CODE: 080, TEL NO:
23300196, FAX NO: NA, E-MAIL : N.A.

204

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

1971

10 - 50

2725

INDIAN GAS D K AGENCIES

J P NAGAR 2NDPHASE BANGALORE ,


6596530, FAX NO: NA, E-MAIL : N.A.

2726

KARNATAKA ELECTRICITY BOARD

LAZAR ROA BANGALORE PIN CODE: 560005, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1975

10 - 50

2727

MOHAN GAS SERVICE

M S RAMAIAH ROAD GOKULA BANGALORE PIN CODE: 560013, STD CODE: NA , TEL NO:
23451385, FAX NO: NA, E-MAIL : N.A.

1976

10 - 50

2728

AVINIASH AGENCY

NO8 8THMAINROAD SARASWATHIPURAMUNESHWARA MAHALAKSHMILAYOU BANGALORE 86


PIN CODE: 560086, STD CODE: NA , TEL NO: 23494800, FAX NO: 23494700, E-MAIL : N.A.

1984

10 - 50

2729

KARNATAKA POWER TRANSMISSION

OPPOSITE KWALITY BISCUIT COMPAMY MYSORE ROAD BANGALORE PIN CODE: 560026, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2730

***

MAHADEVAPPA LPG GAS DISTRIBUTOR 17ACROSS AGRAHARA DASARAHALL BANGALORE


PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2731

DEVAGANGA ASSOCIATES

NO 147 MAIN ROAD AAR COMPOUND MYSOREROAD NEARSIRSICIRCLE BANGALORE PIN


CODE: 560018, STD CODE: NA , TEL NO: 26749874, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2732

GD SHREEDHAR 1/49
SUBRAMANYAPURA ROAD

BENDRE NAGAR BSK Z ND STAGE BANGALORE PIN CODE: 560070, STD CODE: NA , TEL NO:
26660783, FAX NO: 26660783, E-MAIL : N.A.

1995

10 - 50

2733

SUNRISE SOLARI(P)LTD

B 4 JA BHARAT P LTD YASHWANTHPVR BANGALORE-22 PIN CODE: 560022, STD CODE: NA ,


TEL NO: 23574332, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2734

HARI KRISHNAA KASI AGENCIES ND


431/A

3RD FLOOR 1 N BLOCK RAJAJINGAR BANGALORE IO PIN CODE: 560010, STD CODE: NA , TEL
NO: 56952345, FAX NO: 51223409, E-MAIL : N.A.

1998

10 - 50

2735

SALEEM

KARNATAKA ELECTRIC CITY BOARD CHANDRA LAYOUT BANGALORE PIN CODE: 560040, STD
CODE: NA , TEL NO: 23392261, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2736

J P NAGAR TELEPHONE EXCHANGE

I35/3 2 FLOOR 5CROSS 100 FEE RING ROAD NGR 3 PHASE BANGALORE PIN CODE: 560078,
STD CODE: NA , TEL NO: 26589178, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2737

RASHMI GAS AGENCY

NO 23/4 NAYANDANAHALLI MYSORE ROAD BANGALORE PIN CODE: 560039, STD CODE: NA ,
TEL NO: 28602090, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2738

BHAVAN BHARATH GAS DISTRIBUTION

ND ISI LJ COMPLEX SHOP NO ZIB NITHYANADA NAGAR NAYANDANRHALLI BANGALORE PIN


CODE: 560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

PIN CODE: 560076, STD CODE: NA , TEL NO:

205

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2739

SHAKTH ENTERPRISES

NO 77 23 CROSS 12 MAIN 3 BLOCK EAS JAYANAGAR BANGALORE PIN CODE: 560011, STD
CODE: NA , TEL NO: 26630130, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2740

R K CYLTNDERS

702 BEHIND BDA COMPLEX JRD BLOCK KORMANGALA BANGALORK PIN CODE: 560034, STD
CODE: NA , TEL NO: 25520060, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2741

SRI BOMMALINGESHWARAGASAGENCY
NO 295 K Z

Z MAINROAD VBHCOMPLEX GIRINAGAR OPP VIVEKANANDA CIRCLE BANGALORE 85 PIN CODE:


560085, STD CODE: NA , TEL NO: 26727677, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2742

***

NA

10 - 50

2743

MR S DDARAJU LPG

NO23 NDUSTRIAL SUBRUB YESWANTHPUR BANGALORE 22 PIN CODE: 560022, STD CODE:
56008, TEL NO: 36, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2744

MANAGER

BANGALORE ELACTRIC SEREES COMMPANY SRS ROAD AEENYA INDUSTRIAL ESTAT PEENYA
BANGL PIN CODE: 660058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2745

KPTCL OFFICE

BATATINAGAR BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

2746

INDANE GAS

REMCO LAYOUT VIJAYANAGARA BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2747

WATER SUPPLY AND SEVERAGE BOARD

IOTH MAIN IS CROSS INDIRANAGAR 2ND STAGE BANGALORE EAST DIVISION PIN CODE:
560038, STD CODE: 00080, TEL NO: 22945158, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2748

BESCOM

RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

2749

SIDMA INDANE GAS DISTRIBUTERS

NO 339 10MAIN ROAD RAJAJINAGAR STAGE BANGALORE PIN CODE: 560010, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2750

KARNATAKAPOWERTRANSMITCORPORA
ITONLIMITED

24 MAIN 2 SECTOR HSR LAYOU PARANGIBALYA BANGALORE SOUTH RANGE 3 BANGALORE


PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2751

KARNATAKA POWER TRANSMISSION


CORPORATION

24 MAIN 2 SECTOR PARANGIPALYA BANGALORE BANGALORE SOUTH RANGE 3 PIN CODE:


560034, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2752

SREE SHIVASHAKTH INDUSTRIES

NO 3U4 PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28362442, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560040, STD CODE: NA , TEL

206

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

2753

PARAS POWER ENGINEERS PV LTD

NO 434 4 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 51170983, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2754

TECHNO POWER NDUSTRIES

NO 342 C PEENYA FNDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28362012, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2755

DHANLAXM ELECTRO EQUIPMENTS


HTANDLT ELEC

TRICAL CONTROL PANEL PLO NO 434 PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE:
NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2756

RAJU BANGALORE ELECTRICITY


SUPPLY COMPANY

LTD IACROSS PLOT NO ABB PEENYA NDUSTRFAL AREA BANGALORE 58 PIN CODE: 580058,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2757

NAGESH KARNATAKA POWER


RANSMISSION CORPO

RATION LTD 66/11 K V SUB STATION 14TH CRO SS PEENYA INDUSTRIAL AREA BANGALORE 68
PIN CODE: 580056, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2758

BESCOM

NO169 ASSISTANTENGINEER OANDM UNIT2I W SUBDIVISION KS BANGALORE PIN CODE:


560060, STD CODE: 28484, TEL NO: 284, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2759

B M LAYOUT B W S S B SERVICE
STATION

DO NO 8 WATER SUPPLY SUB DIVISION 100 FEE ROAD BTM 2 ND STAGE BANGALORE PIN
CODE: 560081, STD CODE: NA , TEL NO: 22945151, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

2760

MANAGER

ROJA ENTER PRESS GAS SPLAIAR NO458 PEENYA IDUSTRIAL ARIA PEENYA RANGALORE PIN
CODE: 560058, STD CODE: NA , TEL NO: 28395522, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2761

KPTCL OFFICE

RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE: NA , TEL NO: 22454388, FAX NO:
NA, E-MAIL : N.A.

NA

51 - 100

2762

BANGALORE ELECTRICITY SUPPLY


COMPANY

SOOTH OIVISIOW Z CROSS ROAD ZB MAIN BANASHANKARI BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2763

KARNATAKA VIDYUTHPRASARANA
NIGAMA NIYAMI

HA 4CROSS IOTHMAINHANUMANTHANAGARWARDNO5 #2 SHIVARAMAKARANTH ROAD PIN


CODE: 560019, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2764

KARNATAKA VIDYUTH KARKANE


NIYAMITA

MYSORE ROAD BAPUJINAGAR WARD NO 42 BANGALORE PIN CODE: 560026, STD CODE:
00080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1933

101 - 500

2765

LP GAS

3CAOSS CHAMRAJPE BANGALORE IB PIN CODE: 560013, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

101 - 500

2766

TAERMAL TRANSFERPRODUCTW PVT


LTD

NO 486D 4 PHASE 13 CROSS PE3NYA INDUSTR IAL AREA BANGALORE PIN CODE: 560058,
STD CODE: NA , TEL NO: 28361939, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

207

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 4020-Manufacture of gas, distribution of gaseous fuels through mains.


2767

INDIAN OIZ COMPANY NDAN BATLING


PLANT

WHITE FIELD ROAD B NARAYANPURA PIN CODE: 16, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1982

10 - 50

2768

MURALI ENTERPRISES

RAMANJENEYA LAYOU MARATHALLI EXTN, BANGALORE PIN CODE: 560037, STD CODE: NA ,
TEL NO: 25233303, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

2769

SOUTH INDIA GAS

NO1 I2 9MAIN 3PHASE PEENYA INDVSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2770

MADAM ENTERPRTSES BHARATGAS

NO70/5SHAMANNA REDDY BUILDING 4 CROSS NEAR BOMMANAHALL BUS STOP BANGALORE


PIN CODE: 560068, STD CODE: NA , TEL NO: 25720073, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2771

GEETHA SUKUMARA

120/1 KANAKAPURA MAIN ROAD HP GBS AGENCY BANGALORE PIN CODE: 560078, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2772

NATRAJ ENTERPRISES

INDANE GAS DISTRIBUTORS THINDLU BANGALORE PIN CODE: 560097, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2773

N K SURESH

KODIGEHALL SAHAKARNAGARA POST BANGALORE PIN CODE: 560092, STD CODE: 23536,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2774

JAIN

BHARATH GAS L VISWANEEDAM POST MAGAD MAIN ROAD SUNKADAKATTE BANGALORE PIN
CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2775

H P GAS

DYVASANDRA NDUSTRIAL AREA SINGAYANAPALYA BANGALORE 48 WHITEFIELD ROAD PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2776

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2777

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2004

10 - 50

NIC 2004 : 4030-Steam and hot water supply


2778

V SRIDHAR VINVTHA

NO335ISTMAIN5THCROSS BHANUNURSING ROAD BOMMANAHALLI BANGALORE 68 PIN CODE:


560068, STD CODE: 08025, TEL NO: 736909, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 4100-Collection, Purification and distribution of water

208

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2779

OFFICE OF THE EXECUTIVE ENGINEER


NORTH

DIVISION BWSSB SCROSS MALLESHWARAM BANGALORE PIN CODE: 560055, STD CODE: NA ,
TEL NO: 22945130, FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

2780

OFFICE OF THE ASSISTAN EXECUTIVE


ENGINEE

R BWSSB NDRTH SUBDIVISION IBCROSS MALLESHWARAM BANGALORE PIN CODE: 560055,


STD CODE: NA , TEL NO: 22945131, FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

2781

WATER SUPPLY OFFICE

KUMARA PARK RESERWAIR ROAD BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

2782

OFFICE OF THE ASSISTAN EXECUTIVE


ENGINEE

R 4 SUBDIVISION BOREWELL DIVISION IBCROSS MALLESHWARAM BANGALDRE PIN CODE:


560055, STD CODE: NA , TEL NO: 22945200, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2783

M N LOKESH

N R SERVICE STATION AND TRAVELS 5O3/984 BSK3STAGE 7BIOCK 2PHASE


HSKCROSSBANGALORE PIN CODE: 560085, STD CODE: NA , TEL NO: 26721954, FAX NO: NA,
E-MAIL : N.A.

1993

10 - 50

2784

A E E C-2 BWSSB HIGH GROUND


RESERVOIR

IO MILLER ROAD BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 22945191, FAX NO:
NA, E-MAIL : N.A.

1994

10 - 50

2785

BHARATHI

UNIVERSAL MARKETING CORPORATION 198ISI BLOCK 3RDPHASE BSK3RDSTAGE


OOFTROADBLORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2786

OFFICE OF THE ASSISTAN EXECUTIVE


ENGINEE

R BWSSB NORTH SUBDIVISION 2 8 CROSS MALLESHWARAM BANGALORE PIN CODE: 560055,


STD CODE: NA , TEL NO: 22945135, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2787

RAMAKUMAR K S KARANJ INDUSTRIES

#A13 2 CROSSBCROSS KATHRIGUPPEMAINROAD BANGLORE PIN CODE: 560085, STD CODE:


080, TEL NO: 26695489, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2788

U MAHESH WATER SUPPLY AND


SEWERAGE BOARD

IOTM MAINISTICROSS NDIRANAGAR 2ND STAGF BANGALORE PIN CODE: 560038, STD CODE:
NA , TEL NO: 22945158, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2789

SEWAGE REKTMENT PLANT

B E L INDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2790

TO THE EXECUTIVEIENGINEER

DIVISIONNARTH BWSSB ANANDARAOCIRCLE BANGALORE PIN CODE: 560009, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2791

V S RAMAIH

DO NO 54 SIDHANA GALLI CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: 51519931, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

209

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

1910

51 - 100

PIN CODE: 560012, STD CODE: NA , TEL NO: 22945196,

1997

51 - 100

BWSSB

OLD MADRAS ROAD ULSOOR BANGALORE PIN CODE: 560008, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2796

OFFICE OF THE ASSISTAN EXECUTIVE


ENGINEE

R BDREWELL SUBDIVISION.1 18CROSS MALLESHWARAM BANGALORE PIN CODE: 560055, STD


CODE: NA , TEL NO: 22945197, FAX NO: NA, E-MAIL : N.A.

1964

101 - 500

2797

GOVT ARKAVATHIBAVAN STNCROSS 5TH


MAINI

VIJAYANAGAR BANGALORE ,
NA, E-MAIL : N.A.

NA

101 - 500

2798

EXECUTIVE ENGINEER DL WORKS 2


DIVISION

BWSSB ANANDA RAO CIRCLE BANGALORE PIN CODE: 560009, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

2799

E E CEHTRAL
LISANITARY

IOI3 MILLER RO4D SANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 22945187, FAX
NO: NA, E-MAIL : N.A.

1997

> 500

2792

UMA SHANKAR MINARAL WATER


MANUFACTURING

DO NO 26 HONNURPPA LANE CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: 00080,
TEL NO: 51519931, FAX NO: NA, E-MAIL : N.A.

2793

BWSSB KAVERI DIVISION 4 19CROSS

MALLESHWARAM BANGALORE ,
FAX NO: NA, E-MAIL : N.A.

2794

BWSSB BOREWELL DIVISION 3MAIN


MARGDSA ROA

D MALLESHWARAM BANGALORE ,
FAX NO: NA, E-MAIL : N.A.

2795

WATER SUPPLY

PIN CODE: 560003, STD CODE: NA , TEL NO: 22945216,

PIN CODE: 560040, STD CODE: NA , TEL NO: NA , FAX NO:

NIC 2004 : 4510-Site preparation


2800

R K JAYAGOPAL STRUCT GEOTECH


RESEARCH

LABOROTARIES LTD NO588 JPHOUSE RFLODR 6BIOCK BSK3PHASE HOSAKEREHALLI


BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: 26421932, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2801

KUPENDRA REDDY BUILDING


CONSTRUCTIONS

GA BLOCK KORAMANGALA LAYOU BANGALORE PIN CODE: 560095, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2802

***

BES CONSTRUCTIONS 5BLOCK KORAMANGALA BANGALORE PIN CODE: 500090, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

2803

S L N ENTREPRISES

HIGH POINT V 45 PALACE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2804

GOUTAM JAHANVI CONSTRUCTION I7


CROSS CEN

RAL STREET KUMARA PARK WES BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560020, STD CODE: NA , TEL

210

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2805

MYCON CONSTRUCTION LTD

INDUSTRY HOUSE 45 RACE COURSE ROAD BANGALORE PIN CODE: 560001, STD CODE: 080,
TEL NO: 22266253, FAX NO: 22205695, E-MAIL : N.A.

1944

51 - 100

2806

NAGARJUNA CONSTRUCTION COMPANY


LTD

NO BOI BATAVIA CHAMBERS 8 KUMARA KRUPA ROAD BANGALORE PIN CODE: 560001, STD
CODE: NA , TEL NO: 22253309, FAX NO: 22259848, E-MAIL : N.A.

1977

101 - 500

2807

HARA HOUSEING AND LAND


DEVELOPMENT CO PV

LTD 4609 6TH FLOOR HIGH POINT 45 PALACE ROAD BANGALORE PIN CODE: 560001, STD
CODE: NA , TEL NO: 22269093, FAX NO: 22263935, E-MAIL : N.A.

1990

101 - 500

2808

M A VAKIL4OUSINU CORPORTTON
DEDELOPMENFI

NO 7B HOSUER ROAD KORAMANGALA RANUALORE GS PIN CODE: NA , STD CODE: NA , TEL


NO: 51193293, FAX NO: NA, E-MAIL : N.A.

1999

> 500

NIC 2004 : 4520-Building of complete constructions or parts thereof; civil engineering


2809

SEMAC PV LTD M N RAGHAVENDEA


RAO

24 PALACE CROSS RDAD BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO:
23567200, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

2810

NILAKANTANWINDERNAL

YAMALURE POS BANGALORE 37 PIN CODE: 560037, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1972

10 - 50

2811

LAKSHMANA

BUILDING CONTRACTOR MUNESHWARA BLOCK MAIN 18H CROSS BANGALORE PIN CODE:
560056, STD CODE: NA , TEL NO: 26728605, FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

2812

SHARUK MISTRY A MISTRY ARCHITEC


NO 4K4

5MAIN 2 STAGE TNDTRANARA BANGALORE ,


5256266, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

2813

SAKTHIDEVELOPMEN

NOBS R JAGRUHA CROSS MAIN JPNAG R PHA E BANGALORE PIN CODE: 560078, STD CODE:
NA , TEL NO: 2659578, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2814

EXEUTIVE ENGEINER BSNL DIVISION

9/3 INFANTRY ROAD SHIVAJ NAGAR BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 22864138, FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2815

GANESH CONSTRUCTIONS

8 17THMAIN 2NDCROSS MUNESHWARA BLOCK BANGALORE 56OO26 PIN CODE: NA , STD


CODE: NA , TEL NO: 26797931, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2816

R SHEKAR GEM GRANITES

I2O HOOD APARTMEN BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 22257824,
FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2817

SHIVARAMAKRISHNA

NO1O18 BTMLAYOUT BANGALORE ,


26787791, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

PIN CODE: 560038, STD CODE: NA , TEL NO:

PIN CODE: 560029, STD CODE: NA , TEL NO:

211

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
2818

2819

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)
RAJAMATHA CONSTRUCTIONS

EBS

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3A 4 CROSS 7 MAIN MUNESHWARA BLOCK BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: 26421965, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

JP NAGR 3RD PHASE I5TH CROSS PIN CODE: 560078, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1993

10 - 50

2820

TEAM 3 CONSTROCTION

NO 402 14 4TH MAIN 5OFFE ROAD HANUMANTHANAGAR BANGLORE PIN CODE: 560050, STD
CODE: NA , TEL NO: 26527273, FAX NO: 26601431, E-MAIL : N.A.

1994

10 - 50

2821

RANGANATH

DECCAN GROUPS NO 652 5 RAJKUMAR ROAD RAJAJINAUAR BANGALORE PIN CODE: 560010,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2822

EMBASSY GROUP OF COMPANIES

EMBASSY POIN 15O INFANTRY ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 22286868, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2823

SRI BALAJI BUILDING CONTRACTOR

46 16 MAIN 2 CROSS MUNESHWARA BLOCK BANGALORE 56OO26 PIN CODE: 560026, STD
CODE: NA , TEL NO: 57733394, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

2824

SATHYA CONSULTANTS

#166KATHRIGUPPE WATERTANK ROAD 4 CROSS4 BLOCK 3 PHASE B S K 3 STAGE BANGALORE


PIN CODE: 560085, STD CODE: 080, TEL NO: 26794220, FAX NO: 26794220, E-MAIL : N.A.

1995

10 - 50

2825

AUTO COM ENGINEERS NO 6 SURVEY


NO 38 1TH

KM HOSUR ROAD BOMMANAHALLI BANGALORE 58 ,


NO: 25731878, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2826

SHAPOORJ PALLONE AND CO LTD


REGIONAL OFF

ICE NO58 ST CROSS 4TH MAIN HAL 3RD STAGE BANGALORE 56OO75 PIN CODE: 560075, STD
CODE: NA , TEL NO: 25282144, FAX NO: 56338176, E-MAIL : N.A.

1998

10 - 50

2827

AVAN GOPAL PRAKRUTHY SHELTER PVT


LTD

NOG I3TH CROSS LAKSHMIAH RLOCK GANGANAGAR BANGALORE PIN CODE: 560032, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2828

NO14GARASHMINDUSTRIESTRAMANAKA
LLIBATTA RA

YANAPURABANGALORE26 ,
E-MAIL : N.A.

1998

10 - 50

2829

SPALE TECH PRIVATE LIMITED


CONSULTINS

ENSINEERS NO 34 JRD FLOOR SR PU AANA CHETTY COMPLEX 32\910BULLTEMPLE ROAR


BANG PIN CODE: 560004, STD CODE: NA , TEL NO: 51144350, FAX NO: 26600277, E-MAIL :
N.A.

1998

10 - 50

2830

MARULL 33I 8RH MAIN 4TH CROOS RMV


EKLAL

O SADALHIVENAGAR BANGIOACLO RE ,
53613614, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

PIN CODE: NA , STD CODE: NA , TEL

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA,

PIN CODE: 560080, STD CODE: 00080, TEL NO:

212

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1999

(5)
10 - 50

Z4 16TH MAIN 4TH BLOCK KORMANGALA / BANGALORE PIN CODE: 560095, STD CODE: NA ,
TEL NO: 25525129, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

ABDUL GAFFAR BHARATH BUILDERS

29O 1 CROSS 1 BLOCK R NAGAR POST BANGAL ORE 32 PIN CODE: 560032, STD CODE: NA ,
TEL NO: 23332778, FAX NO: 23536910, E-MAIL : N.A.

2000

10 - 50

2834

STANDARD CONSTRCTION COMPANY


NO138/9

ELEPHANT ROCK ROAD JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL
NO: 26658999, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2835

SWEA HOMES CORPORATION

NOI00/A 19 MAIN FIRS N BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010, STD CODE:
NA , TEL NO: 23471273, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2836

M S NARAHARI S J R BUILDERS 27 MAIN


NO 49

STAGE BTM LAYOUT BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: 51201111,
FAX NO: 51231111, E-MAIL : N.A.

2001

10 - 50

2837

BL KASHYAP & SONS LTD

F002 EDEN HALL 245 DEFENCECOLONY 80FT RD INDIRANAGAR BANGALORE PIN CODE:
560038, STD CODE: 9180, TEL NO: 25201394, FAX NO: 25295499, E-MAIL : N.A.

2001

10 - 50

2838

PRAKRUTI NES BUILDERS


DEVELOPERS

NOII/34ANSHUMAN NEST PALACE CROSS ROAD BANGALORE PIN CODE: 560020, STD CODE:
NA , TEL NO: 23440333, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2839

INTEGRAL CONSTRUCTIONS, L R
VENKATESH

NO.318, 1ST CROSS C BED, THYGARAJANAGAR, BANGALORE PIN CODE: NA , STD CODE: NA
, TEL NO: 26770418, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2840

PRARMD PACHIM DCURIOPCRL


COMPCYAZLIOM

ISQIS IOLK MAIN EQZILLIOM SMALAZIVANAGQR BAGLIOYE PIN CODE: 560080, STD CODE: NA
, TEL NO: 23613355, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2841

R SHIVA KUMAR

# 6 A, 1S FLOOR, 2ND CROSS, 8TH MAIN 7TH BLOCK, BSK 3RD STAGE, BANGALORE PIN
CODE: 560085, STD CODE: 98459, TEL NO: 20168, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2842

CUSTOMER FIRST SERVICES PRIVATE


LIMITED

NO A TKN MANSION BUIL NG BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22273053, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2843

MYTHERYJ PROMOTERSSDEVELOPERS
P 2TQ

SI GGTU CROSS JAYANAGAR 5TH BLOCK ,


26631955, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2844

NAGARAJ FURN BUILDERS AND


DEVELOPERS

NO 1212 100 FEET ROAD H A L 2ND STAGE DHOOPANAHALL BANGALORE PIN CODE: 560038,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2831

TVRNKEY CONSTRUCTION ENGINEERS

ZO 2FLOOR S CROSS CHIKKANNA GARDEN SHANRARPURAM BANGALORE PIN CODE: 560004,


STD CODE: NA , TEL NO: 26521379, FAX NO: NA, E-MAIL : N.A.

2832

GREEN PIECE

2833

PIN CODE: 41, STD CODE: NA , TEL NO:

213

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2845

MYTHREYI PROMOTERS AND


DEVELOPERS

SI 4G CROSS S BLOCK JAYANAGAR BANGALORE PIN CODE: 560041, STD CODE: NA , TEL
NO: 26631955, FAX NO: 26631956, E-MAIL : N.A.

2004

10 - 50

2846

ITINAAKALA MAHABALESHWARAPPA

HOODYROAD RAJAPALYA MAHADEVAPURA POS BANGLORE SOUTH DISTRICT PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2847

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2848

NAND HOUSING

AG 3GTHMAIN ROAD ST STAGE DOLLARS SCHEME BTM LAYOUT BANGALORE PIN CODE:
560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2849

VJJAYA KUMAR NOI4 3FIOOR 3MAIN


7CROSS

DOMLUR BANGALORE PIN CODE: 560071, STD CODE: NA , TEL NO: 51256129, FAX NO:
51256130, E-MAIL : N.A.

NA

10 - 50

2850

CLASSIC DISTEIBUTERS

ACAAN CAOUE AOUND BANGALDRE S ,


2286797, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2851

BES OEVELOPERS

NO16 CROVE ROAO OSEOAN BANGALORE 51 PIN CODE: NA , STD CODE: NA , TEL NO:
2286797, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2852

***

NA

10 - 50

2853

WATER PROFFING

NA

10 - 50

2854

***

NA

10 - 50

2855

CONSTRUCTION NEW PROJECTS

BEL INDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA , TEL
NO: 22195271, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2856

CONCEP CITY DEVELOPERS

NO IIO FOCAL CENTER 2ND FLOOR OTC ROAD BANGALORE PIN CODE: 560002, STD CODE: NA
, TEL NO: 22700361, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2857

PARAMAHAMSA ELECTRICAL
CORPORATION

TG SHANKAR MVT PARALLEL ROAD SHANKARPURAM BANGACORE PIN CODE: 560004, STD
CODE: NA , TEL NO: 26609905, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2858

MANJUNATH MYSORE ENGINEERING


COMPANY

14TH CROSS PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2859

***

NA

10 - 50

PIN CODE: 560051, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

INDIRA NAGAR BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

214

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2860

CHANDAVARHAR HACKER
ARCHITECTS PV LTD

NO,T PALACE CROSS ROAD BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO:
23342101, FAX NO: NA, E-MAIL : N.A.

1950

51 - 100

2861

VIJAYAKUMAR

MARUTI BRICK WORKS, NO. 97, CHINNAPPANA HALLI, GRAMTHANA, MARATHAHALLI


BANGALORE PIN CODE: 560037, STD CODE: NA , TEL NO: 28475075, FAX NO: 22200022,
E-MAIL : N.A.

1979

51 - 100

2862

ASSOCIATED ASPHALT CONSTRUCTION


PRODUCTS

68 1ST FLOOR 9TH MAIN 4TH C BLOCK KORAMANGALA BANGALORE PIN CODE: 560034, STD
CODE: NA , TEL NO: 25520841, FAX NO: NA, E-MAIL : N.A.

1992

51 - 100

2863

MOHHNKUMHR
MECHANICENGINEERING

TECNOCNS PVT LTD SINGASANDRA HOSURROAD BANGALORE PIN CODE: 560068, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

2864

CONSULTANT CONTRACTORS

604 2ND FLOOR 17TH MAIN 5TH CROSS 4TH BLOCK KORMANGALA BANGALORE PIN CODE:
560034, STD CODE: NA , TEL NO: 25522823, FAX NO: NA, E-MAIL : N.A.

1997

51 - 100

2865

ANJUSHREE PRADHAN

NO5 2O CROSS 4 MAIN N S PALYA BANNERUGTA ROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: 26789807, FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

2866

M N A BUILDING CONSTRACTION

N 84 4TH CROSS MY SCHOOL ROAD ,


55339811, FAX NO: NA, E-MAIL : N.A.

2005

51 - 100

2867

SMC BUILDING

AIRPOR ROAD KODIHALLI BANGALORE PIN CODE: 560017, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

NA

51 - 100

2868

A N PRAKASH CONSTRUCTION
PROJECT MANAGEME

NT CONSULTANTS PVT LTD VISWAKARMA 491 2FLR EASTENDMAINRD JAYANAGAR 9BLOCK


BLR PIN CODE: 560069, STD CODE: NA , TEL NO: 26655090, FAX NO: 26545165, E-MAIL : N.A.

1986

101 - 500

2869

SONRISEFRIGHTMOVERSPLTD

IGBSECONDFLOORFIRSTCROSSLALBAGHROGDBANGAL ORE PIN CODE: 560027, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

2870

M S INDIA PRIVATE LIMITED

148 5MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

2004

101 - 500

NA

101 - 500

PIN CODE: 360027, STD CODE: NA , TEL NO:

2871

NARENDRASHARMA ECKNOLEGIS

DIVYASHREEBULDING NEARITPL MAHADEVAPURAPO POORVAI2 BANGALORE SOUTH PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2872

SHIVAJYOTH DEVELOPERS NO I7
KUDUREMUKA

COLONY KORAMANGALA ,
: N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL

215

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 4530-Building installation

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

#32- MODULE HOUSE STREE 4TH CROSS BASAVANAGUDI BANGALORE PIN CODE: 570004,
STD CODE: NA , TEL NO: 26766771, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2873

***

2874

NO AZS WIND WFLL ELECTRICAL


EVGINEERS

CHIKKAMARANAHALLY NEW B E L ROAD BANGALORF PIN CODE: 560054, STD CODE: NA ,


TEL NO: 23604225, FAX NO: 236 0641, E-MAIL : N.A.

1990

10 - 50

2875

S SCIRCUTPRIVATELIMTED 9/1HMR
INDUSTRIAL

PURNAPURA GOKULA BANGALORE 54 ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560054, STD CODE: NA , TEL NO: NA ,

1999

10 - 50

2876

SUDHAKARANNAIR AND COMPANY PVT


LIMITED

NO. 537 B BLOCK, AECS LAYOUT KUNDALAHALL BANGALORE PIN CODE: 560037, STD CODE:
NA , TEL NO: 28476286, FAX NO: 28476283, E-MAIL : N.A.

2000

10 - 50

2877

H SSENKRUPP ECEA ELEVA O RIVATE


L MIT

N
SU H MANAGAR MA ROA BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22392662, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

NIC 2004 : 4540-Building completion


2878

CTVFL ENGINEERING DEPARTMENT

BANGALORE UNIVERSITY BANGALORE PIN CODE: 560056, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1980

10 - 50

2879

ARCITECI DIPARTEMENT

BANGALORE UNIVERSITY BANGALORE PIN CODE: 560056, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1980

10 - 50

2880

NAGARAJA S

KAHAKSHAHMA BADAVANAY CHOWDESWAR LAYOUT PIN CODE: 560064, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

2881

SALVIA DEVELOPERS PV LTD

NO I5 4CROSS 35 MAIN 2STAGE BTM LAYOUT BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2882

SRI MALATH MOSACK MARBALS

PANDURANGANAGAR BANNERGHATTA ROAD BANGALORE PIN CODE: 560076, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2883

ISHWARYA BOUTIAUE PV LTD

NO 531 2 FLOOR 11T MAIN JAYANAGAR 4 BLOCK BANGALORE PIN CODE: 560011, STD CODE:
NA , TEL NO: 6559609, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2884

MAHADAVAPPA

DINO 0O 7THCROSS VIRAJANAGAR BOMMANHALL BANGALORE 68 PIN CODE: NA , STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

216

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2002

(5)
10 - 50

# 44/I SRM ROAD BASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

FLOWWELL PUMPS AND METERS

KSR LAYOUT DEVARACHIKKANAHALLI BANGALORE PIN CODE: 560076, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2888

JAI KIRAN ENTERPRISES FIBRICATION

KRISHNA REDDY ESTAIE OPPOSITE K FCI ROAD DOORVANINAGAR BANGALORE PIN CODE:
560016, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2889

***

NA

101 - 500

2885

DADDY DEVELOPERS AND BUILDERS

NO 383 9 MAIN 7TH SECTOR H S R LAYOUT BANGALORE PIN CODE: 560034, STD CODE: NA ,
TEL NO: 25727644, FAX NO: NA, E-MAIL : N.A.

2886

THEME HDME CONTRACTORS

2887

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 4550-Renting of construction or demolition equipment with operator


2890

MS GEETHA MALINI M R CID SAMA


SUNDAR

# 2I/B 9THMAIN ROAD SHAKARA NAGARA BANGALORE PIN CODE: 560010, STD CODE: NA ,
TEL NO: 23427321, FAX NO: 23522917, E-MAIL : N.A.

1994

10 - 50

NIC 2004 : 5010-Sale of motor vehicles


2891

PRIYADARSHIN VIDYAKENDRA NO 4O7

N6THMAIN ROAD KENGER SATELLITETOWN PIN CODE: 560060, STD CODE: 28483, TEL NO:
28483647, FAX NO: NA, E-MAIL : N.A.

1977

10 - 50

2892

MEJESTIC MOBIKE PRIVATE LIMITED

NO128/2 RVROAD VVPURAM BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

12 MAIN ROAD HAL 2 STAGE INDIRA NAGAR BANGALORE 8 PIN CODE: NA , STD CODE: 25080,
TEL NO: 51521212, FAX NO: 040, E-MAIL : N.A.

1985

10 - 50

2893

S MAHALINGAM AND SONS

2894

SURESH MARUTHIMOTORS PVLTD

#132/6 SHESHADRIPURAMROADMALLESHPURAMROAD BANGALORE 73 PIN CODE: 560023,


STD CODE: NA , TEL NO: 23347777, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

2895

POPULAR MOTOR CORPORATION

123/107 2MAIN 7BLOCK JAYANAGAR BANGALORE PIN CODE: 560082, STD CODE: NA , TEL
NO: 26657170, FAX NO: 21664098, E-MAIL : N.A.

1996

10 - 50

2896

NO 7 11SAS BIKES

NEW B E L ROAD BANGALORE PIN CODE: 560054, STD CODE: NA , TEL NO: 23604241, FAX
NO: NA, E-MAIL : N.A.

1997

10 - 50

2897

ABHIJTTH

HEROHONDA SHOWROOM MAX MOTORS 3CROSS RAJA JINAGARA BANGALORE PIN CODE:
560010, STD CODE: 080, TEL NO: 23353849, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

217

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2898

SOLAR FIRE SAFETY EQUIPMEN SENA

#26 3CROSS NEHRUNAGAR SESHADRIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2899

YAMAHA PLAZA

ZFA HG CROSS S BLOCK OO FEE RING ROAD JAYANAGAR BANGALORE PIN CODE: 560041,
STD CODE: NA , TEL NO: 6533112, FAX NO: 6559472, E-MAIL : N.A.

2000

10 - 50

2900

TVS SERVICE

TVS SERVICE NO595 1 FLOOR D RAJKUMAR ROAD PRAKASH NAGARA BANGALORE 2 PIN
CODE: NA , STD CODE: NA , TEL NO: 23327669, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2901

KHIVRAJ MOTORS

ND B83A Z MAIN LALBAGH ROAD SUDAAMA NAGAR BANGALORE PIN CODE: 560027, STD
CODE: NA , TEL NO: 22217392, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2902

SILIION HONDA

304 7THBLOCK STAGE BANASHANKAR RING ROAD BANGALORE 85 PIN CODE: 560085, STD
CODE: NA , TEL NO: 26892533, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2903

YAMAHA PLAZA

279 46TH CROSS 5TH BLOCK JAYANAGAR BANGAL ORE PIN CODE: 560011, STD CODE: NA ,
TEL NO: 26533109, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2904

FARID BAIK 1 LTD

NO O17 D RAJAKUMAR ROAD 6TH BLOCK RAJAJINAGAR BANGALORE PIN CODE: 560010,
STD CODE: NA , TEL NO: 233 5106, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2905

JATT BAJAJ SALES AND SERVICE

HENNUR MAIN ROAD ST HOMAS TONN POS BANGALORE 84 PIN CODE: 560084, STD CODE:
NA , TEL NO: 2580857, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

2906

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2907

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2908

ASHWA MOTORS

NO 311 RING ROAD BANASHANKAR 1STAGE 1STPHASE 7THBLOCK BANGALORE85 PIN CODE:
560085, STD CODE: NA , TEL NO: 23425152, FAX NO: 26891213, E-MAIL : N.A.

2002

51 - 100

2909

PLANET HONDA SHOW ROOM

NO I04O RAJAKUMAR ROAD QTH BLOCK RASAJFNAGAR BANMALORE PIN CODE: 560010,
STD CODE: NA , TEL NO: 23501010, FAX NO: NA, E-MAIL : N.A.

2003

51 - 100

2910

GARUDA AUTO GRAPHED

NOZG LALBHAGH ROAA BANGARORE ,


22215782, FAX NO: NA, E-MAIL : N.A.

2001

101 - 500

1972

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL NO:

NIC 2004 : 5020-Maintenance and repair of motor vehicles


2911

S M KANNAPPA AUTOMOBILES LTD

NO 2 NEW MENTAL HOSPITAL ROAD BANGALORE 27 PIN CODE: 560027, STD CODE: 00080, TEL
NO: 22216229, FAX NO: NA, E-MAIL : N.A.

218

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2912

CM PAI

NO2 INTE AIRIYA INDUSTIAL SITE INDIRA NAGAR BANGALORE PIN CODE: 560038, STD CODE:
NA , TEL NO: 25255052, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

2913

ABRAHIM

NO ZG PERFEC MOTOR SERVICE UPAKA GARDEN BANGALORE Z PIN CODE: 560077, STD
CODE: 080, TEL NO: 22234626, FAX NO: NA, E-MAIL : N.A.

1976

10 - 50

2914

GARUDA AUTO CRAF PRIVATE LIMITED

NO IZ ULSOOR ROAD BANGALORE PIN CODE: 560008, STD CODE: NA , TEL NO: 25565550,
FAX NO: 25565001, E-MAIL : N.A.

1980

10 - 50

2915

KARNATAKA GRAMEENA BADAVARA


MATHU ANGAVIK

ALARA MAHILA ABHIVRUDH SAMSTHE 66/A 6M AIN 3PHASE PRENYA INDUSTRIAL AREA
BNLORE PIN CODE: 560058, STD CODE: NA , TEL NO: 23724519, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

2916

ASMATHULLA

A H AUTO GARAGE RAJLWAY STATION ROAD NAYANDANAHALLI BANMALORE PIN CODE: NA


, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

2917

COMMERCIAL MOTORSI

N024 25 IOORNALISTCOLONYIJCROAJ BANGALOREI PIN CODE: 560002, STD CODE: NA , TEL


NO: 26708061, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

2918

GURU PRASAD BANGLORE AUTO


ENGINE

NO 3G 37 3B 9THCROSS H SIDDAIAH ROAD M KRISHNAPPA LAYOU BANGLORE PIN CODE:


560027, STD CODE: NA , TEL NO: 22227242, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

2919

ASHOK LEYLAND

JYOTHI NAGAR MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

2920

STARBATALACLEANTNGWORKANDSALE
S

CHANDAPURAROAD ANEKAL BANGALORE PIN CODE: 562106, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2921

MR SAMPATH KUMAR

NO 54 SAMPATH KUMAR AUTOMOBILES NANDIDURG RDAD EXTN BANGALORE PIN CODE:


560046, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2922

RAJA DATTHA

RAJA YOGA SHIKSHANA SHANTHINAGAR ROAD BANGALORE 27 PIN CODE: 560027, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

2923

MAHESHA

NO 41, ASHWATHNAGAR, BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: 560094,

1991

10 - 50

2924

CLASSIC MOTORS

PIN CODE: 560022, STD CODE: NA , TEL NO: NA , FAX

1995

10 - 50

2925

S J S M0TORS SERVICES PRIVATE


LIMITED

1995

10 - 50

MAIN

BLOCK

GORAGUNTEPALYA BANGALORE ,
NO: NA, E-MAIL : N.A.

NO 46 9 BLOCK JAYANAGAR EAST BANGALORE PIN CODE: 560069, STD CODE: NA , TEL NO:
26586006, FAX NO: NA, E-MAIL : N.A.

219

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2926

SHIVARAMA KRISHNA 101/2 49TH


CROSS

OLD DOMLUR BANGALORE PIN CODE: 560071, STD CODE: NA , TEL NO: 25350726, FAX NO:
NA, E-MAIL : N.A.

1995

10 - 50

2927

RAVEESH AUTOGARAGF

RAMACHANDRAPURA BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: 1, FAX NO: NA,
E-MAIL : N.A.

1996

10 - 50

2928

BHASKER TRITEN MOTOR

PI BELLARY ROAD GANGANAGAR BANGALORE 32 ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

2929

SHARAVANA NO I8 4TH BLOCK 4TH


STAGE 8TH

A MAIN ROAD TATA DIESEL VEHICLES BASAVESHWARANAGAR BANGALORE PIN CODE:


560079, STD CODE: NA , TEL NO: 23408422, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2930

R V MANUFACTURING PRTVATE LIMITED

NO94C AZIZSAIT NDUSTRIAL TOWN NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

2931

RAJESH SAGAR AUTO MOBILE NO 36


4TH MAIN

4TH STAGE BASAVESHWARANAGAR BANGALORE PIN CODE: 560079, STD CODE: NA , TEL
NO: 23203518, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2932

MARUTHISERVICESCARGARAGE NOA3
KAMAKYALAYO

UT IOOFEETROAD RTNGROAD BANASHANKARI 3RD STAGE BANGALORE85 PIN CODE: 560085,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2933

ALLDAR B U R AUTO MOTIUE PRIUATE


LIM ED

NO SZ J P A AR SRD PHASE IS MAIN BA SALORE PIN CODE: 560078, STD CODE: NA , TEL NO:
26582543, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2934

MURUGAN

NO 467 SRINIVAGILU MAIN ROAD EGIPURA PIN CODE: 560047, STD CODE: NA , TEL NO:
25704514, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

2935

TRUPTI SERVICE STATION

N B AB EASTEN C MARN IOOFEE RING ROA JP NAGAR B PHASE BANGALORE PIN CODE:
560078, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2936

KRISHNAMURTHY

VANTAGE EXPRESS LOUIER SERVICE SHANTH NAGAR ROADIRANGALORE PIN CODE: 560027,
STD CODE: NA , TEL NO: 51142093, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2937

AUTO BAGS

BHEL OPPOSITE GATE NO 2 MYSOR ROAD BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2938

GOVARDHAN AVTOMOTIVE LABOURS

NOZOG IOOFEE RINGROAD BRDPHASE BSKZND BLOCK JRD SIGE BAMGLORE PIN CODE: NA ,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2939

SHABBEER

SHABBEER 414 6 BLOCKRAJAJINAGAR BANGALORE ,


TEL NO: 23500069, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: 560032, STD CODE: NA ,

PIN CODE: 560010, STD CODE: NA ,

220

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2000

10 - 50

2940

VNITED MOTORS

R SSL LB A R AD SGARD N ANG E ,


51245174, FAX NO: 1, E-MAIL : N.A.

2941

SHEKAR

SRI KAVERI SERVICE STATION 35 MUNIESWARA LAYOUT MANORAYANA BANGALORE 22 PIN


CODE: 560032, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2942

C ANATHALAH MANASA MOTARS SLRUR


PARK ROAD

SHESHAURTPURAN BANGALORE 2O ,
FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: 98861455,

2000

10 - 50

2943

EN GRADE GASOLINE STATION


OPPOSITE

RHEL MYSOREROAD BANGALORE ,


NO: NA, E-MAIL : N.A.

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX

2000

10 - 50

2944

LMLLIM E

NO ZN CROSS ALB AGH R AD BA GAL RE ,


22247031, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2945

SIDDA AUTO GARAJE

THYAGARAJANAGARA BANGALORE PIN CODE: 560028, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

2001

10 - 50

2946

HEROHONDAMOTORS

#218 O0ROAD BSK3STAGE 3PHASE 2BLOCK BANGALORE PIN CODE: 560085, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2947

VIKAS MUTORS

OPPOSITE KWALITY BISCUIT COMPANY MYSDRE ROAD BANGALORE PIN CODE: 560026, STD
CODE: 1111, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

2948

MANPOWER SERVICES INDIA PV LTD

NO 5 SPRINGDALE IFLOOR SCROSS RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD
CODE: 91080, TEL NO: 51321000, FAX NO: 51321001, E-MAIL : N.A.

2003

10 - 50

2949

MANAGER

PRATHAM MOTARS RAJKUMARROAD SUBRAMANYANAGARA BANGALORE PIN CODE:


500010, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2950

ELAVANGOVAN

BREE RENUKA MOTORS NO49 3RD CROSS SARJAPURA ROAD JAKKADANDRA BANGALORE
PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

2951

BABUPRASD NO 334 2ND CROSS HAL


MAIN

ABS KAMPAN BANALORE ,


NO: NA, E-MAIL : N.A.

2004

10 - 50

2952

FAIYAZ

VENKATESHWARA GARRAGE NO 48 5THBLOCK 5 CROSS KORAMANGALA BANGALORE 95


PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

2953

DHRUVDESHHONDA DATIL MANAGER

ZA\I GROUNDFLOOR FIFTHMAINROAD JAYAMAHAL BANGALORE PIN CODE: 560046, STD


CODE: NA , TEL NO: 51285291, FAX NO: NA, E-MAIL : N.A.

2006

10 - 50

PIN CODE: 560027, STD CODE: NA , TEL NO:

PIN CODE: 560027, STD CODE: NA , TEL NO:

PIN CODE: 566008, STD CODE: NA , TEL NO: 30617461, FAX

221

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)
,

Year of start of
Operation

(4)

Employment
Class

(5)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

SATHISHSARVISSTATION O5 PEENYAINDUSTRIAL ARIA PEENYA BANGALORE PIN CODE:


560058, STD CODE: NA , TEL NO: 28311956, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

GROUND FLOOR 8 CROSS WILSON GARDEN BANGALORE PIN CODE: 560027, STD CODE: 9180,
TEL NO: 22242530, FAX NO: 51206620, E-MAIL : N.A.

NA

10 - 50

VS VENKATARAMAN

MADRAS AUTO SERVICE NO65/3 7THCROSS HOMBEGOWDANAGAR WILSONGARDEN


BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2962

SUNDARAM MOTORS

IO7 KASIURBA ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

2963

***

NA

10 - 50

2964

PRAKASH CAFE

NA

10 - 50

2965

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2966

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

2967

MURTHY NO1/3 RAJKUMAR RDAD 1ST


MAIN

NA

10 - 50

2968

***

NA

10 - 50

2969

ATOOMETS FACTARY ST MAIN CHIKKA


ADUGOOI

NA

10 - 50

2954

***

2955

MANAGER

2956

***

2957

S VANO G PAL V K S NDU TRIE SE VILIN

2958

***

2959

***

2960

XENOS TECHNOLOGIES NO 9I/46

2961

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

K ROAD BANGALO E MAJN RDAD ,


E-MAIL : N.A.

PIN CODE: NA , STD CODE: 1, TEL NO: NA , FAX NO: NA,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

RESIDENCY ROAD BANGALORE PIN CODE: 560006, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1ST CROSS SUBHRMANYA NAGAR BANGAGORE PIN CODE: 560010, STD CODE: NA , TEL NO:
23332026, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

THAUAREKERE MAIN ROAD BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560029, STD CODE: NA , TEL NO: NA

222

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

2970

S H P AUTO SERVICE PRIVATE LIMITED

HARIPRASAD SHE ARU AMRUTHANAGAR IO67 BELLARY ROAD SAHAKARANAGAR POST PIN
CODE: 560092, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2971

B N LAXM NARAYAN MRFS AND FOOO


PROCESSOR

S PLOT NO 47O G 4TH PHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: 580056,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2972

K S D C WORKSHOP

H SIDDAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: 22222400, FAX
NO: NA, E-MAIL : N.A.

2973

MANAGER

2974

R N S MOTORS

2975

***

2976

NO4I3RDMAINROADRANGANTHACOLON
Y BATTADANAD

URAMYSORE RAOBANGALORELG ,
NO: NA, E-MAIL : N.A.

2977

CARPOLECE TRANSPOR OFFICE

MYSORE ROAD BANGALORE ,


NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

NA

10 - 50

1976

51 - 100

LAKSHM MOTARS NO21I DUSTRIAL ARIA TUMKU R ROAD BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: 23574430, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

2275 RNS MOTORS TUMKUR ROAD YESHWANTHPUR BANGALORE PIN CODE: 560022, STD
CODE: 080, TEL NO: 23474354, FAX NO: NA, E-MAIL : N.A.

1999

101 - 500

NA

101 - 500

NA

101 - 500

NA

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 560018, STD CODE: NA , TEL NO: NA , FAX NO:

NIC 2004 : 5030-Sale of motor vehicle parts and accessories


2978

2979

MOINUDDIN

BINC NDRAN

2980

BANGALORE MOTOR OWNERS


CONSUMERS CO OP

2981

ABRB

2982

HI TECH PAIN INDUSTRIES

UTO MO ILE L Y L D

SRI KAEYANIENTERPRISES 33 23RD CROSS H SIDDAIAH ROAD BANGALORE27 PIN CODE:


560027, STD CODE: 98800, TEL NO: 352822, FAX NO: NA, E-MAIL : N.A.

1944

10 - 50

K IVRA BA AJMO RS B
SUDHAMANAGARL LB EROAD BLD ZZ PIN CODE: 560027, STD
CODE: NA , TEL NO: 22217392, FAX NO: NA, E-MAIL : N.A.

1963

10 - 50

SOCIETY 36 PAMPA MAHAKAVI ROAD CHAMARAJPE BANGALORE PIN CODE: 560018, STD
CODE: NA , TEL NO: 26668692, FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

Z CROS HSIDD H ROA A YALORE OOZ ,


397, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

1982

10 - 50

PIN CODE: 560027, STD CODE: 22220, TEL NO:

NO Z S CROSS H SIODAIAH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

223

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1985

(5)
10 - 50

NO 2 LAKSHMANAIAH BLOCK BELLARY ROAD GANG NAGARA BANGALORE PIN CODE:


560024, STD CODE: 080, TEL NO: 23530615, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

ZBZ 2PHASE N MAIN BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO: 51170238,
FAX NO: 23724957, E-MAIL : N.A.

1988

10 - 50

M AKBAR

SCOOTER SPARE PARTS SERVICE YESHAVANTHAPURA BANGALORE PIN CODE: 560054, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2987

ARUNKUMAR
GURUKRPASERVICESTATION

SINGASANDRA HOSURMAINROAD BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2988

SUKRO AUTOMOBILES

ARAVINO JARAGANA HALLY KANAKAPURAMAINROAD BANGALORE PIN CODE: 560078, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

2989

RATUBBBU

TINKER AUTO WORK NOZ7 3CROSS HSIDDIHA ROAD BQNGAIOREZ7 PIN CODE: 560027, STD
CODE: 98451, TEL NO: 09762, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

2990

KRISHNAPPA

S V ENTERPRISES 107/35 KAMAGONDANA HALL JALAHALL WESTBANGALORE PIN CODE:


560015, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

2991

PRAKAJHMOTORS

DI LALB HROA BAN ALORE ,


NA, E-MAIL : N.A.

1998

10 - 50

2992

BHASKAR

NO 2 LAKSHAMAIAH BLOCK VETENARY COLLEGE O PP BELLARY ROAD GANGANAGAR


BANGALORE PIN CODE: 560024, STD CODE: 080, TEL NO: 26537844, FAX NO: NA, E-MAIL :
N.A.

1998

10 - 50

2993

KRISHNA MURTHY NDUSTRIES ESTATE

OPPOSITE TK FCI ROAD DOORVANINAGAR BANGALORE PIN CODE: 560016, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

2994

EDWIN OIAS

SPEED MOTORS #4B GTH MAIN 3RD BLOCK BASAV ESHWAR NAGAR BANGALORE PIN CODE:
560079, STD CODE: NA , TEL NO: 23224411, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2995

SRI MANJUNATHA ENGINEERING

OPPOSITE TK FCI ROAD DOORVANINAGAR BANGALORE PIN CODE: 560016, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

2996

GEMS CARS

NO I CENTRAL EXCISE LAYOUT MAIN ROAD RMV 2 STAGE BHOOPSANDRA BANGALORE PIN
CODE: 560094, STD CODE: NA , TEL NO: 23341972, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

2983

GOWR SANKAR ENGINEERING


EDINDUSTRIES

NO 269 PEENYA INDUSTRIAL ARIA BANGALORE S6OOS8 PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28394317, FAX NO: 8394317, E-MAIL : N.A.

2984

S DEVENDARAO

2985

AUTO C NEC MACHIWTNG PN LTD

2986

PIN CODE: 560027, STD CODE: 22233, TEL NO: 353, FAX NO:

224

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

2001

10 - 50

2002

10 - 50

2997

***

2998

MANDOV MOTORS PRIVATE LIMITEO

J P NAGAR 3RD PHASE IS MAIN BANGALORE ,


2684363, FAX NO: NA, E-MAIL : N.A.

2999

MAHINDRA COMPANY KARNATAKA


AUTOMOBILES

BENNIGANA HALLJ OLD MADRAS ROAD DOORVANINAGAR BANGALORE PIN CODE: 560016,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3000

AUTOMABILE COMPANY
GHARVEBHAVIPALYA HOSUR

ROAD RANGALDRETGB ,
: N.A.

2004

10 - 50

3001

VIJA AUTO SALES SERVICES PRIVAIE


LIMITED

OLD MADRAS ROAD BENNIGANA HALL DOORVANINAGAR BANGALORE PIN CODE: 560016,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3002

SUDEEP SAWANTH

NO13 2 RAMANNAPE CROSS JUMMA MASJID ROAD BANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3003

MARUTH UDYOG LID

GRAN ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3004

***

NA

10 - 50

3005

ANAND MANGAL MOTORS

AMRI PLAZA NO 1099 KOTE MARIYAPPA LANE OTC ROAD CROSS BANGALORE PIN CODE:
560002, STD CODE: NA , TEL NO: 22272306, FAX NO: 22294159, E-MAIL : N.A.

NA

10 - 50

3006

STANZEN LINKES NO 473 A

PEENYA NDUSTRIAL AREA 4 PHASE 2 CROSS BANGALDRE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28362129, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3007

***

NA

10 - 50

3008

PREUSE NDIA PVT LIMITED

884 MAGADIMAINROAD KAMAKIPALYA EXTENSION ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

51 - 100

3009

NARANDRRA

RESISTER AUTO PRODUTES R LAYOUT OPANA AGARA BANGALORE PIN CODE: 000065, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

3010

NAND TOYATA GHARVEBMAVIPALYA


HOSUR ROAD

BANGALORE-68 ,

2000

51 - 100

3011

SARCTOOLSPL

ABBIGEREMAINROAD KAMMAGONDANAHALL BANGALORE PIN CODE: 560015, STD CODE: NA


, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

PIN CODE: 560078, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560079, STD CODE: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

225

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

2001

51 - 100

3012

VENKATACHALAPATH CAR SHOWROOM


AND SERVIC

WHITE FIELD ROAD B NARAYANAPURA PIN CODE: 16, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

3013

S SEKHORVASAN

SANSARA ENG PV LTD GARWEBHAVIPALYA BANGLORE 56OO68 HDSUR ROAD PIN CODE:
560068, STD CODE: NA , TEL NO: 25730188, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3014

VIKRAMSHEITY AUTO MOBTLE TILES

MVLTE BRAND BODXSHOW ROOM DORESANIPALYA BANGXLDRE PIN CODE: 560076, STD
CODE: NA , TEL NO: 51107999, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3015

AUTOMOTIVE CONVERTERS
WHITEFIELD MAIN ROA

WHITE FIELD BANGALORE PIN CODE: 560066, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

51 - 100

3016

DYNAMATIC TECHNOLOGIES LIMLTED

NO I DYNAMATIC PARK PEENYA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
28394933, FAX NO: NA, E-MAIL : N.A.

1973

101 - 500

3017

SMITH HAMMER PVT LTD

NO 270 4 PHASE PEENYA NDUSTRIAL AREA BANGALGRE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28396865, FAX NO: 28372382, E-MAIL : N.A.

1984

101 - 500

3018

N KRISHNA KUMAR

K K ENTERPKISES N0 38 39 MUNISWAMY LAYOU HONGASANDRA VILLAGE BEGUR HOBL


BANGALORE PIN CODE: 560068, STD CODE: 080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

3019

MAHENDRA VIJAI AUTO SALES &


SERVICES LTD

677 BANNERAGHA A ROAD BANGALORE PIN CODE: 560076, STD CODE: 26584, TEL NO:
51109896, FAX NO: 26580959, E-MAIL : N.A.

1995

101 - 500

3020

BDVL BBAR

MUGA COM NY L Y LAND ATA SPARES NO ROS HSIDDIA RO D BANGAL RG AN PIN CODE:
NA , STD CODE: 22122, TEL NO: 555666, FAX NO: NA, E-MAIL : N.A.

2201

101 - 500

3021

NA

101 - 500

F NO 486

NELAGADARANAHALLY MAIN ROAD BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: 28394840, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 5040-Sale, maintenance and repair of motorcycles and related parts and accessories
3022

SVI BRUSH GEARS

KRISHNA REDDY ESTATE OPPOSITE K FCI ROAD DOORVANINAGAR BANGALORE 16 PIN


CODE: 560016, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1898

10 - 50

3023

BAJAJ MOTORS

NOATG BTHMAIN ROAD HANUMANTHANAGAR BANGALORE PIN CODE: 560019, STD CODE: NA
, TEL NO: 26678629, FAX NO: NA, E-MAIL : N.A.

1932

10 - 50

NO2 NO38 KALASIPALAYAM NEW EXTN BANGALORE560002 PIN CODE: NA , STD CODE: NA ,
TEL NO: 22220066, FAX NO: NA, E-MAIL : N.A.

1965

10 - 50

3024

POPULAR AUTOMABILES

226

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3025

MADHUS YRES

NOZZ JCROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: 26709110, FAX NO:
NA, E-MAIL : N.A.

1970

10 - 50

3026

JANARDHAN BABU

NO22/4BANGALORE MARAPPAROAD BANGALORE PIN CODE: 560008, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3027

MAGADI AUTOMOBILES

#134/4 AM ROAD NEAR POPULAR AUTOMOBILES BANGALORE PIN CODE: 560002, STD CODE:
00080, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3028

B V VENKATESH MURTHY

#479 8TH MAIN TARA SUBBARAO ROAD HANUMANTHANAGAR BANGALORE 19 PIN CODE:
560019, STD CODE: NA , TEL NO: 26678629, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3029

ASHOKRAO M D
MANDOVTMOTARSEPRIVATELIMITED

D NO 2O/4 B S ROAD 1MAIN WILSONGARDEN BANGALORE PIN CODE: 560027, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

3030

SRINIVASA RAO

BUS GARRAGE YELECHENAHALLI KANAKAPURA MAIN ROAD BANGALORE PIN CODE: 560078,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3031

RASUPATH BATHA

USHA AUTO SERIVESE MOUSERMAIN ROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

3032

SAMICHOWDARI N O G H KANAKAPURA
MAIN

ROAD JARAGANAHALLI BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3033

FAST CARS SOUTH PV LTD

NO 29 P CROSS I8 MAIN BTM 1 STAGE BANGALORE PIN CODE: 560076, STD CODE: NA , TEL
NO: 26682679, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

3034

BAHUBALI

N0459 DHANALAKSHMI BUILDING CO ONPE BANGALORE PIN CODE: 560053, STD CODE: NA ,
TEL NO: 26707687, FAX NO: 26709170, E-MAIL : N.A.

1993

10 - 50

3035

ZEN TVS

127/10 BULL TEMPLE ROAD CHAMRAJPET BAMGALORE PIN CODE: 560019, STD CODE: NA ,
TEL NO: 26678266, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3036

AUTO WORLD CENTRE

NOIZ JCROA ANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: 26707921, FAX NO: NA,
E-MAIL : N.A.

1995

10 - 50

3037

SURESH

NO 62 R MV EXTENTION 80 FEE ROAD BANGAL BANGALORE PIN CODE: 560094, STD CODE:
080, TEL NO: 23412200, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3038

VIKRAM ENGINEERING WORKS

NOZA GONDTHOP NFAR KTC GODOWN CROSS HOSUR ROAO BOMMANA HALLI BANGALORE
PIN CODE: 560068, STD CODE: NA , TEL NO: 57316118, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

PIN CODE: 560078, STD CODE: NA , TEL NO: NA ,

227

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
3039

3040

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

NAGARATHNAMMA
NATARAJENTERPRISES
V S COMPANY

Year of start of
Operation

Employment
Class

(4)

(5)

NO201 SFS208 YELAHANKANEWTOWN BANGALORE PIN CODE: 560065, STD CODE: NA , TEL
NO: 28567553, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

AAS G MAIN Z BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: 93, TEL NO:
42517488, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

NO 390 K R PURM BANGLORE 36 ,


FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

NOS GANESH BUILDING MYER PAIYA INDIRANAG AR BANGALORE PIN CODE: 560038, STD
CODE: NA , TEL NO: 25201385, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3041

CHADANA MOTORS

3042

***

3043

M J ADENS LEMANS MOTORS

NEAR AYYAPPA EMPLE S M ROAD DASARAHALL BANGALORE 560057 PIN CODE: 560057,
STD CODE: NA , TEL NO: 28371182, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3044

HCNDA SERVCCE

NOIO98 SUMANA TQWERS CHANDRA LAYOUTMAIN ROAD BANGALORE-IO PIN CODE: NA , STD
CODE: NA , TEL NO: 3395858, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3045

FARID MOTORS PRIVATE LIMITED R


VASU

NO 65/1 MISSION ROAD BANGALORE 27 ,


22276255, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3046

MAHALAKSHM TYRES SALE OF TYRES

NO 28 RANOJIRAO STREET KALASIPALYA BANGALORE PIN CODE: 560002, STD CODE: 00080,
TEL NO: 26800207, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3047

AUTOMBILES

NO3 JCROAU CROSSI JOURALISTCOLONY BANGALOREI PIN CODE: 560002, STD CODE: NA ,
TEL NO: 26800037, FAX NO: 11111111, E-MAIL : N.A.

1999

10 - 50

3048

HERO HONDA SHOWROOM

OLD MADRAS ROAD ULSOOR BANGALORE PIN CODE: 560008, STD CODE: NA , TEL NO:
25596606, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3049

CR SEALS NDUSTRIES

NO 13 BINGBRSADRA HOSUR ROAD BANGALOREA PIN CODE: 560068, STD CODE: NA , TEL
NO: 25730207, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3050

B C SAROGI

BHARATH MOTORS DEALEARS IN ALL WOWEELERS WHITE FOELD ROAD B NARAYANAPURA


PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3051

SILICON HONDA

#84 R V ROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3052

SRIKANTHARORA ALFALAWALAINDIA
LTD NO 793

12THMAINROAD STCROSS INDIRANAGAR HAL2ND STAGE BANGALORE 56OO08 PIN CODE: NA


, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

NARAYANAM

PIN CODE: 560036, STD CODE: 56171, TEL NO: 25613038,

PIN CODE: 560027, STD CODE: NA , TEL NO:

228

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3053

RAHAMATH AUTO GARAGE

MYSORE KOAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

3054

DINESH BODYCENTREQUALITYBODY
REPAIRAND

PAIN NGTOBS CHIKKABEGURGATE BANGALORE 68 PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3055

BECS GAS AGENCY NO 205A BECS


SHOPPING

COMPLEX 3RD STAGE BEML LAYOU RAJESWARINAGAR BANGALORE PIN CODE: 560098, STD
CODE: NA , TEL NO: 28600379, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3056

NO 3I2/A45THCROSS9THMAIN VTH
BLOCK

JAYANAGAR BANGALORE 4I ,
NA, E-MAIL : N.A.

2001

10 - 50

3057

NR.LOKESH KUMAR

NO_5 SERVICE ROAD DOMLOR BANGALORE


25351846, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3058

NANDHANA

GARRAGE NO 94 5 CROSS 5 BLOCK NEAR MANGAL A CHOWTARY KORAMANGALA


BANGALORE 95 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3059

ANTHONYDIESELAUTOWORKS

AUTHORISEDSERVICE SINGASANDA BANGALORE ,


NO: 25737752, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3060

VEHICAL SERVICE

N 20 1STCROSS HARIHANT COMPLEX CKS GARDEN BANGALORE PIN CODE: 560027, STD
CODE: NA , TEL NO: 22291611, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3061

SWASTIKMOTARS NO 45\48 GOKUL


STAGR

# 2NDPHASE MATHIKEREMAINROAD RANGACDRE PIN CODE: 560022, STD CODE: NA , TEL NO:
23574177, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3062

MANTUNATH
ESSARPRECISIONENGINEERING

HOSURMAINROAD SINGASANDRA BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3063

MARUTH SHOW ROOM

IOO FEET ROAD INDIRANAGAR BANGALORE ,


30533383, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3064

LXLABS

NOIZC IS CMAIN G SECTOR BLOCK HSR LAY OUT BANGALORE PIN CODE: 560034, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3065

SOFT DRINK STORE AND SUPPLY


MUNNEKOLALU

MARATHHALL POST BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3066

SIKANDARPASHAWORKSHOP

OPPOSITEKGHALLIPOLICESTATIONNAGANARAMAJNR OADAREBICCOLLEGEPOSTBANGALORE
45 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: 26340202, FAX NO:

E PIN CODE: 560071, STD CODE: NA , TEL NO:

PIN CODE: 560068, STD CODE: 11, TEL

PIN CODE: 560038, STD CODE: NA , TEL NO:

PIN CODE: 560037, STD CODE: NA , TEL NO: 84763,

229

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

6999

10 - 50

3067

UTHAPPA NO943MAIN 7CROSS DOMLUR

BANGALORE ,
: N.A.

3068

MANAGER

KIVIRAJA MOTORS NO18 UMKURROAD YASWANTA PURA SUB BANGALORE PIN CODE:
560022, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3069

MANAGER

METRO MOTARS NOS UMKUR ROAD BANGALORE ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560022, STD CODE: NA , TEL

NA

10 - 50

3070

MANAGER

MANDAV MOTARS NOZ UMKUR ROAD BANGALORE ,


TEL NO: 23374130, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560022, STD CODE: NA ,

NA

10 - 50

3071

MAHENDRA UDYOG

NO23 OTH MAIN SHIVANAGAR BANGALORE 0 PIN CODE: 560010, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3072

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3073

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3074

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3075

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3076

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3077

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3078

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3079

HYUNDA CARS

RESIDENCY ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3080

CAR PLAZA (ACCESSORIES)

H 45\1, CASTLE ROAD, BRIGADE ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL
NO: 25553671, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3081

BANGALORE AOVAITH HYUNDA ADVAITH


MOIORS

N0I2 SHAMARAO COMPOUND MISSION ROAD BANGALORE PIN CODE: 560021, STD CODE: NA ,
TEL NO: 22976121, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3082

PACER YAMAHA

1NFANTRY ROAB BANGALORE ,


FAX NO: 23096743, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560071, STD CODE: NA , TEL NO: 25353000, FAX NO: NA, E-MAIL

PIN CODE: 560001, STD CODE: NA , TEL NO: 22863415,

230

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

3083

***

3084

TATA MOTORS VEHICLE SPARE PARTS

3085

DISTRICT : Bangalore

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

GEORGE OAKES LIMITED NR SQUARE BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL
NO: 22215455, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

MARUTI SERVICES

N286 IOO FT RING ROAD BSK 3 STAGE BANGALORE PIN CODE: 560085, STD CODE: 080, TEL
NO: 26699856, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3086

UDAYAKUMAR ORION MOTORS NO15I8


BUVANAPPA

LAY OU HOSUR MAIN ROAD BANGALORE PIN CODE: 560095, STD CODE: NA , TEL NO:
25524747, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3087

***

NA

10 - 50

3088

AUTO PRODUCT

KORAMANGALA ,

NA

10 - 50

3089

CITIZEN CARS

SS PROMENADE ROAD FRHZER OWN BANGALORE ,


TEL NO: 66466, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3090

RAJSHEKAR AMBAAUTO BAJAJ NO 4O


SREE NANO

BUILDING HOSUR MAIN ROAD GAREBAV PALYA BANGALORE PIN CODE: 560068, STD CODE:
080, TEL NO: 25732487, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3091

VINAYROY

ROYMOTARSANDSERVICECENTER OUTERRINGROAD HEBBALA BANGALORE PIN CODE:


560024, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3092

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3093

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3094

DINESHKUMAR

VALSALA SERVICE STATION SUMANAHALLY MAIN ROAD BANGALORE PIN CODE: 560091,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3095

***

POLICEHOSTLE VELAHANKA DEVANAHALLIROAD BANGALORE G4 PIN CODE: NA , STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3096

MICRO VISION

BASAVANAGAR MAIN ROAD HOOD BANGALORE PIN CODE: 560048, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1980

51 - 100

3097

PHILIP DIAGON

SIEMENS VDO NO 14O HOSER ROAD KORAMANGALA BANGALORE 95 PIN CODE: NA , STD
CODE: NA , TEL NO: 25531580, FAX NO: NA, E-MAIL : N.A.

1990

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 1, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.
PIN CODE: 560005, STD CODE: 98453,

231

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1990

(5)
51 - 100

1995

51 - 100

OLD MADRAS ROAD.ULSOORE BANGALORE PIN CODE: 560008, STD CODE: 1, TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

R N SWITCH GAIR

DEVASANDRA NDUSTRIALAREL SINGHYAVAPALYA MAHADEVAPURA POS PIN CODE: 56004,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3102

M N R A MA R A O U S H/A R A O

W OIW E E LA R S P A R
CIPO S S V V E KA N A G A R P O S BANGALORE PIN CODE:
560047, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1973

101 - 500

3103

C K ENGINEERING WORKS

69 6 MAIN 3 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28394027, FAX NO: NA, E-MAIL : N.A.

1985

101 - 500

3104

RAGHAVAN

NO49\17M E GARVEBHAVIPALYA HOSURROAD BANGALORE_56OOO68 PIN CODE: 560068,


STD CODE: NA , TEL NO: 5600068, FAX NO: NA, E-MAIL : N.A.

1994

101 - 500

3105

PRERANA MOTOR PRIVATE LIMITED

J K MQNSON 22 SIDDAIAH ROAD BANGALORE-2 ,


NO: 51245892, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

3106

ASHWATH NARAYANA ANS MOTORS


MARUTHI SERV

ICE CENTER 190 NEAR HOOD CIRCLE MAHADAVAPURA POS BANGALORE PIN CODE: 560048,
STD CODE: 00080, TEL NO: 28412902, FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

3107

RAVTNDU MOTORS PAIVATE LIM ED

HAVINDU MOTORS PRIVATE LIMITED N25 CHORP ROAD RAJAJTNAGAR BANGALORE 22 PIN
CODE: NA , STD CODE: NA , TEL NO: 23477895, FAX NO: 23475863, E-MAIL : N.A.

2004

101 - 500

3108

SREE SRINIVASA AUTO DIESEL AND


BODY BUILD

ERS NO81 ROOPENAAGRAHARA MADIWALA BANGALORE PIN CODE: 560068, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1986

> 500

1952

10 - 50

1955

10 - 50

3098

SUNRISE BARANDRESIORENTNEPR
RAJGOPALNAGAR

POLICE STATION 3PHASE PEGNYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3099

KOLAKARN

TVS SUNDARAM MOTORS SERVICE STATION 5CROSS RAJAJINAGARA BANGALORE PIN CODE:
560010, STD CODE: 080, TEL NO: 23873305, FAX NO: NA, E-MAIL : N.A.

3100

515 WORK SHOP

3101

PIN CODE: 560002, STD CODE: NA , TEL

NIC 2004 : 5050-Retail sale of automotive fuel


3109

K PRESTIGE LIMITED NO78 OID


MADRAS ROAD

DOORVANINAGAR BANGALORE ,
NO: NA, E-MAIL : N.A.

3110

DISEL INDIA

NO 2 LALBAGH FOR ROAD BANGALORE PIN CODE: 560004, STD CODE: 00080, TEL NO:
22237335, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX

232

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3111

AHMED ULLA KHAN THARIN

BHARAT PETROLIUM SERVICE STATION K R ROAD BANGALORE O4 PIN CODE: 560004, STD
CODE: 080, TEL NO: 26673163, FAX NO: NA, E-MAIL : N.A.

1962

10 - 50

3112

J B S REDDY COMANY PRIVATE

NO36 2 NEHARU CIRCLE BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO: 23363678,
FAX NO: NA, E-MAIL : N.A.

1968

10 - 50

3113

T.R.SHARAMA

INDIAN OIL PETROL KUMARAPARK EAS BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 2256002, FAX NO: NA, E-MAIL : N.A.

1969

10 - 50

3114

PETROL BUNK 4BLOCK

NOIO47 RAJAJINAGARENTRANCE RAJAKUMARROAD RAJAJINAGAR BANGALORE PIN CODE:


560010, STD CODE: NA , TEL NO: 23351521, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

3115

SRILAKSHMISERUICESTATION

MSRAMAIAHROADGOKULA BANGALORE PIN CODE: 560013, STD CODE: NA , TEL NO:


23450699, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

3116

AVINASH

KAVERI SERVICES BHAKATH PETROLEUM YESHWANTHPUR BANGALORE PIN CODE: 560022,


STD CODE: NA , TEL NO: 23373192, FAX NO: NA, E-MAIL : N.A.

1970

10 - 50

3117

LALBAGH TRADERS

N83 LALBAGH MAIN ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22222333, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

3118

JALAHALLISERVICESTATIONT

MSRAMAIAHROAD GOKULA BANGALORET PIN CODE: 560013, STD CODE: NA , TEL NO:
00345115, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

3119

DEVADAS PETROL BUNK

GI RALACE ROAD BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1972

10 - 50

3120

AVINASH K L

KAVERI SERVICES NO 89/1 SERVICE ROAD YESHAVANTHAPURA CIRCLE BANGALORE PIN


CODE: 560022, STD CODE: 00080, TEL NO: 22373192, FAX NO: NA, E-MAIL : N.A.

1972

10 - 50

3121

RAMCHANDRARAO HHPPETROL BUNK

59KRROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

3122

SOMASHEKAR H S

8 MILE UMKUR ROAD NAGASANDRA POS BANGALORE PIN CODE: 560073, STD CODE: NA ,
TEL NO: 28349456, FAX NO: NA, E-MAIL : N.A.

1977

10 - 50

3123

PETROL BUNK

COCKBURN ROAD BOMBOO BAZAR SHIVAJINAGAR BANGALORE 56OO5 PIN CODE: 560051,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

3124

BHARATH PETROLEUM VV ROAD


BANGALORE

1982

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: 26577945, FAX NO: NA, E-MAIL : N.A.

233

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3125

HP PETROL BUNK OID MADRAS ROAD

DOORVANINAGAR POST BANGALORE PIN CODE: 560016, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1983

10 - 50

3126

HINDUSTANPETROLEUMAUTOCARECE
NTREANDPETROL

BUNK6NEWBELROADDEVASANDRAMAINRD RAMAIAH COLLEGE AND HOSPITALSTOP


BANGALORE PIN CODE: 560094, STD CODE: NA , TEL NO: 23516327, FAX NO: NA, E-MAIL :
N.A.

1985

10 - 50

3127

MAHASAAKTI ENTERPRISES

IZ IO MAIN JAYANAGAR Z BLOCK BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
26565733, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

3128

SRIPAD BHA

ANNAPURNA SERVICE STATION RV ROAD BASAVANAGUDI BANGALORE PIN CODE: 560004,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

3129

M KRUSHNAPPA NO596 1STMAIN ST


CROSS

SUBRAHMANYA NAGARA D RAJAKUMAR ROAD BANGALORE 5600I0 PIN CODE: NA , STD


CODE: NA , TEL NO: 23320762, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

3130

B MALLEGOWDA

# 27/1, SUBRAMANYAPURA MAIN ROAD BANGALORE PIN CODE: 560070, STD CODE: NA , TEL
NO: 26669657, FAX NO: 26913959, E-MAIL : N.A.

1989

10 - 50

3131

SATISH PETROL BUNK

NO 87, RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO: 51123357,
FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3132

KENCHAPPA GOWDA

PETROL BANK OWNER YELACHENAHALLI KANAKAPURA MAIN ROAD BANGALORE PIN CODE:
560078, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3133

VANAPPA

I76SCROADSESHADARIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA , TEL NO: NA ,


FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

3134

COMMERCIAL LUBRICANTS

NO24IZ JOURNALISTCOKNNY JCROAO BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: 2678061, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3135

ARMUGAM

2S ARMUGAM PETROL BUNK BELLARY ROADGANGA NAGAR BANGALORE PIN CODE: 560032,
STD CODE: 080, TEL NO: 23331605, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3136

GANGADHAR AHARATH PETROLSUM

45/46 BASAVESHWARA NAGAR MAINROAD BANGALORE PIN CODE: 560079, STD CODE: NA ,
TEL NO: 23308899, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3137

***

1998

10 - 50

3138

IBP AUTO SERVICES

1998

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

#19 GTH BLOCK BOFT ROAD KORAMANGALA BANGALORE PIN CODE: 560095, STD CODE: 2,
TEL NO: 5521749, FAX NO: 22251920, E-MAIL : N.A.

234

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3139

IBP AUTO SERVICES NO 3O66/28

MAHAKAVI KUVEMPU ROAD I1TH CROSS 2ND STAGE CBLOCK GAYATHRINAGAR BANGALORE
PIN CODE: 560021, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3140

CITYSERVICE STATION

2PHASE JPNAGAR BANGALORE PIN CODE: 560078, STD CODE: NA , TEL NO: 26954831, FAX
NO: NA, E-MAIL : N.A.

1999

10 - 50

3141

PETROL BUNK

LALBAGH ROAD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2000

10 - 50

3142

PETROL BUNK

B2/1 R V ROAD BASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3143

BHARAT PETROLIAM LIMITED

NUMBER 120 7TH BLOCK KORAMANGALA BANGALORE.56OO95 PIN CODE: 560095, STD CODE:
NA , TEL NO: 25702544, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3144

TM KRISHNA G SHANTHOUS #1 AIR


PORT ROAD

OPP MANIPAL HOSPITEL BANGALORE 56OO1 ,


25261271, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3145

KATTASUBRANANYAMPETROLPUMP

HSRLAYOUTISECTORRINGROAD ,
NO: NA, E-MAIL : N.A.

2001

10 - 50

3146

ELF GAS

N721 CMH ROAD INDIRANAGAR BANGALORE ,


25284670, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3147

MS LAKSHMAMMA & SONS

NO 1 NARAYANAPPA GARDEN HD DEVEGOWDA ROAD R NAGAR BANGALORE 32 PIN CODE:


560032, STD CODE: 00080, TEL NO: 23548511, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3148

M P ENTERPRISES VINAYAXA BUILDING

NAGASHETTYHALL BANGALORE ,
FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560084, STD CODE: NA , TEL NO: 23511318,

2002

10 - 50

3149

OWNER

VARADHARARA PETROL BANK RAJAKUMARROAD SUBRAMANYANAGARA BANGALORE PIN


CODE: 560010, STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3150

IBP AUTO SERVICES

CA 5/B BTM LAYOU VB LAYOU BILEKAHALL BANGALORE PIN CODE: 560076, STD CODE:
00080, TEL NO: 51107377, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3151

SINDHU AUTO SERVICES NO 33/ 8O


FEETROAD

S B M COLONY SEETHA CIRCLE B S K 3 STAGE BANGALORE 56OO85 PIN CODE: 560085, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3152

KOUCHAN KNOWLEDGE
CONVERGENCIES PV LTD

#29 FLOOR MAIN SHESHADRIPURAM BANGALORE PIN CODE: 560020, STD CODE: NA , TEL
NO: 25124918, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

PIN CODE: 560017, STD CODE: 2521, TEL NO:

PIN CODE: 560034, STD CODE: NA , TEL NO: NA , FAX

PIN CODE: 560038, STD CODE: NA , TEL NO:

235

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3153

BURMA AUTOMOBILES

NO 75 1S FLOOR FARAH COMPLEX BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL
NO: 22991351, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3154

K F C S C LTD PETROL BUNK

73 KANAKAPURA ROAD BANASHANKAR BANGALORE PIN CODE: NA , STD CODE: NA , TEL


NO: 26553466, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3155

BALAJI SERVICE STATION

155 BRIAD SQARE MYSORE ROAO BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL NO:
51277210, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3156

H P AUTO SERVICE CENTER NO786 IOO


FEET

RING ROAD BSK 3 STAGE 2PHASE BANGALORE 85 ,


NO: 26422514, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3157

UDAYAGIR SERVICE STATION

#138B 100F ROAD 2PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3158

MARIHARA FILLING STATION

HEGGANAHALLI MAIN ROAD POST VISHWANEEDAM BANGALORE PIN CODE: 560091, STD
CODE: NA , TEL NO: 23586861, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3159

GANAPATH PETROL SERVICE

ANNAYAPPA COLONY NEWTHIPPASANDRA BANGALORE PIN CODE: 560073, STD CODE: NA ,


TEL NO: 25289455, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3160

DIESEIPUMP

NUMBERIZOPPOSITETOLALBAGHMAINROADBANGALOR E PIN CODE: 560004, STD CODE:


98451, TEL NO: 85872, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3161

MAHASHAKTI PETROL SERVICE STATION

,10TH MAIN MARIYAPPA ROAD 1ST BLOCK JAYANAGAR BANGALORE PIN CODE: 560011,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3162

RAJENDRA BABU

R B PETRO SERVICES BP DEALERS KORAMANGALA 8O FEE ROAD BANGALORE PIN CODE:


560047, STD CODE: NA , TEL NO: 25714799, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3163

***

NA

10 - 50

3164

BALAJI SERVICE STATION

NA

10 - 50

3165

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3166

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3167

J N PRABHAKAR SERVICE STATION NO


16/A

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

M G ROAD BANGALORE PIN CODE: 56000, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

FIATMANX AUTO THIMMAIAH ROAD VASANTHNAGAR BANGALORE PIN CODE: 560052, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

236

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

3168

***

3169

SANSAMESHWARA NOG3U 1 CROSS

3170

DISTRICT : Bangalore

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Employment
Class

(5)

NA

10 - 50

BASHF CERCLE SU A HALLE BANGHLDRE 56OOO3 PIN CODE: NA , STD CODE: NA , TEL NO:
23440992, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

EASI END SERVICE STATION

I61 WHEELER ROAD FRAZER TOWN BANGALORE ,


NO: 25552340, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 500005, STD CODE: NA , TEL

NA

10 - 50

3171

INDIANPETROLBANK

HOSURMAINROAD BOMMANAHALLI PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3172

SRIMARUTHISERVICESTATION

PANTHARPALYA NAYANDALL POST MYSOREROADBANGALORE PIN CODE: 560039, STD


CODE: NA , TEL NO: 8600632, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3173

NO34 MYSOREROAD BANGALORE26

1998

51 - 100

3174

MANAGER

PREMLUBRICATS NO347/1PEENYAINDUSTRIAL ES AT BANGALORE 56OO58 PIN CODE: 560058,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3175

SRINIVASA

RATITINAGAR MODIHOSPITAL NEAR PIN CODE: 560010, STD CODE: NA , TEL NO: 2300086,
FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3176

ADVAITA PETROL BANK

NO3 10O FEET ROAD 16 MAIN ROAD RING ROAD FIRS STAGE BTM LAYOUT BANGALORE PIN
CODE: 5600, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3177

AUTO PETROL BUNK

SLNGAYANAPALYA MAHADEVAPURA POST WHITEFIELDROAD BANUALORE PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

OEALERSBPC 76JAYACHAMARAJENDRA ROAD PIN CODE: NA , STD CODE: NA , TEL NO:


22219787, FAX NO: NA, E-MAIL : N.A.

1947

101 - 500

3178

RNGURUSWAMY

PIN CODE: 560026, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3179

INDIAN OIL CORPORATION PETROLE


BRNK

BESIOE RING ROAD NAGAVARA ARABIC COLLEGE BANGALORE URBAN DISTRICT PIN CODE:
560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

101 - 500

3180

PUJARI SERVICE STATION

WHITE FIELD ROAD B NARAYANAPURA PIN CODE: 16, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

2003

101 - 500

3181

***

FILLING STATION 5CROSS 5RLOCK KORAMANGARA BANGALORE PIN CODE: 500095, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

101 - 500

3182

BHARAT PETROL BUNK

NA

101 - 500

JEEVAN BHEEMA NAGAR BANGALORE PIN CODE: 560075, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

237

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

3183

BANGALORE INDIAN OIL CORPORATION


LIMITED

CENTRAL GOVERNMENT NO29 SR NAGAR BANGALORE PIN CODE: 560027, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3184

LOKESH

FAUVARIT ORDER SERVICE HOUSE MATN ROAD KORAMANGALA BANGALORE 95 PIN CODE:
NA , STD CODE: NA , TEL NO: 25504035, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

(4)
NA

Employment
Class

(5)
101 - 500

1975

> 500

2002

10 - 50

NIC 2004 : 5110-Wholesale on a fee or contract basis.


3185

VTSHWANAJH B.N

DISTRIBUTQRS 27CROSS 7BLOCK JAYANAGAR BANGALORE PIN CODE: 560082, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3186

PRAKASH PAPER MART

NO 54/1 6TH CROSS SRIRAMPURA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3187

NARASIPUR AUTO COMPONENTS PV


LTD

SURVEY NO 1O3/3 AYYAPPA GARDEN BILEKAHAL BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1995

10 - 50

NIC 2004 : 5121-Wholesale of agricultural raw materials and live animals


3188

VISHAKA ENTERPRISES

RSHINPUSIAN LEVER LID 92 JCROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL
NO: 22226339, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 5122-Wholesale of food, beverages and tobacco


3189

MYSORE BRENERIES

SG5A MYSORE BREWERIES LTD JALAHALLY LAMP ROAD YESHAVATPUR BANGALORE PIN
CODE: 560022, STD CODE: 080, TEL NO: 22198800, FAX NO: NA, E-MAIL : N.A.

1974

10 - 50

3190

FLAVORCHEM NDIA PRIVATE LTD J

NO 321-A 1 A MAIN JAYANAGAR 7 BLOCK WEST BANGALORE


TI PIN CODE:
560082, STD CODE: NA , TEL NO: 26769705, FAX NO: 26764257, E-MAIL : N.A.

1975

10 - 50

3191

DRUTHI DISTRIBUTORS

27O 9 MAIN 2 BLOCK JAYANAQAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3192

SRI DINESH DUTCHFOODHOUSE NO


816 12THMAIN

HAL INDIRANAGAR BANGALORE 560OO8 ,


FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3193

C M MILK KHOVA DAIRTTY

NO 53TTIRD MAIN ROAD GANGANAGAR EXT BANGALORET PIN CODE: 560032, STD CODE:
080, TEL NO: 23436889, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

238

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

Year of start of
Operation

Employment
Class

(3)

(4)

(5)

PIN CODE: 560027, STD CODE: NA , TEL NO: NA

2003

10 - 50

3194

ARCO SONS

ZZ CROSS LALRHAGH ROAD BAGA OR ,


, FAX NO: NA, E-MAIL : N.A.

3195

NAVODAYA FOOD PRODUCTS

NAGADEVI NDUSTRIAL ESTATE KACHARARANAHALLI POS


BANGALORE-84 PIN CODE:
560084, STD CODE: NA , TEL NO: 25431647, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3196

P N MANJUNATHA

DO NO 4 GGNIGARA C LANE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
33173899, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3197

MECO AGEN Y

NOS ZND CROSS LALBHAG ROAD BANGALOR ,


NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

51 - 100

3198

JYOTHI KRISHNA PVT LTD

NOI VIVIAN ROAD BEHIND CLARENCE SCHOOL BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

51 - 100

PIN CODE: 560027, STD CODE: NA , TEL

NIC 2004 : 5131-Wholesale of textiles, clothing and footwear


3199

PATH SILK KENDRA

N4&5 SANJEEVAPPA LANE AVENUE ROAD CROSS BANGALORE PIN CODE: 560002, STD CODE:
00080, TEL NO: 22270980, FAX NO: 22105589, E-MAIL : N.A.

1975

10 - 50

3200

ROJA SILKS MADESH

NO 51 MALLIKARJUNAPPA LANE AVENUE ROAD CROSS BANGALORE PIN CODE: 560002, STD
CODE: 00080, TEL NO: 22100596, FAX NO: 22100598, E-MAIL : N.A.

1992

10 - 50

3201

DWARKANATH

NO 771 34TH CROSS 10TH MAIN ROAD JAYANAGAR BANGALORE PIN CODE: 560011, STD
CODE: NA , TEL NO: 26346298, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

NIC 2004 : 5139-Wholesale of other household goods


3202

HIND AGENCIES

NOI02 HOSPITAL ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: 22260711,
FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3203

MAHESH PHARMA

NO5O 11TH CROSS BASAVANNATEMPLE ROAD BANGALORE PIN CODE: 560053, STD CODE:
NA , TEL NO: 22257385, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3204

SUBRAMANYA NANDTNIBADAVANF
NANDINI LAYOU

BANGALORE ,

NA

10 - 50

3205

HINDAL CO INDUSTRIES LIMITED

INDUSTRY HOUSE V FLOOR AS RACE COURSE ROAD BANGALORE PIN CODE: 560001, STD
CODE: NA , TEL NO: 22267106, FAX NO: 22253086, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

239

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

3206

SUMUKA DTSTZIBUTION NA 3416 4 TH


BLOCK

PG TH CROSS JAYANABAR BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

3207

NO6I62RA1ASUNFRMADISTBUTRES6TH
CROSS

2NDMAIN CHAMARAJAPET BANGALOAE 8 ,


NA , FAX NO: NA, E-MAIL : N.A.

3208

K PRESTIGE

VENKATESHWARA LAYOUT BANGALORE ,


, FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

PIN CODE: 560041, STD CODE: NA , TEL NO: NA

2005

51 - 100

PIN CODE: 560018, STD CODE: NA , TEL NO:

2003

101 - 500

NA

101 - 500

PIN CODE: 560029, STD CODE: NA , TEL NO: NA

NIC 2004 : 5141-Wholesale of solid, liquid and gaseous fuels and related products.
3209

INDANE GAS PRIVATE LIMITTED

FIFTH CROSS MATHIKERE MAIN ROAD YASHAVANTAPURA BANGALORF PIN CODE: 560022,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3210

SANJAY UTSAV SPEEDWAYS

NO6430 4TH CROSS 8TH MAIN W C ROAD 3PHASE BASAVESHWARANAGAR BANGALORE PIN
CODE: 560079, STD CODE: NA , TEL NO: 23228839, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3211

PKL LCMITED CLIX POWERING HOME JAI


KUMAR

ANMOL2ND FLOOR NO 8911 GANOHL BAZAR MAIN ROAD BASAVANA GUDI BANGALORE PIN
CODE: 560004, STD CODE: NA , TEL NO: 26603639, FAX NO: 26604434, E-MAIL : N.A.

1998

10 - 50

3212

INDIAN OIL

AIRPOR MAIN ROAD BANGALORE PIN CODE: 560017, STD CODE: NA , TEL NO: 25270200, FAX
NO: NA, E-MAIL : N.A.

2000

10 - 50

3213

D P ANANPH

#3RD CROSS ST MAIN MOUHTJAY BADAVANE SRINAGAR BANGALORE 560019 PIN CODE:
560019, STD CODE: NA , TEL NO: 26609044, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

IO5 HARSHA HOUSE KARAM PURA COMPLEX NEWDELHIBANGALORE PIN CODE: 560002, STD
CODE: NA , TEL NO: 22484157, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

NA

10 - 50

NA

10 - 50

1974

10 - 50

3214

MEERU AGROCHEMICAL

3215

***

3216

SARDHANA

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

SARDHANA GAS ENTERPRISE 3RD CROSS NEAR VIDYAPEETHA BSK 3RD STAGE PIN CODE:
560028, STD CODE: NA , TEL NO: 26679193, FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 5143-Wholesale of construction materials, hardware, plumbing and heating equipment and supplies
3217

GLAND CHEMICALS PV LTD

B-1O- JAIBHARATH INDUSTRIES YASHWANTHPUA BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: 23371971, FAX NO: NA, E-MAIL : N.A.

240

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Employment
Class

(4)
1976

(5)
10 - 50

DEVELOPERS NO957 12CROSS VBV BUILDINGS VYALIKAVAL BANGALORE PIN CODE: 560003,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

STEEL HOUSE

KALASIPALYAM NEW EXTENSION BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL NO:
51140808, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

TILEITALIA

PBLOCK SARGAPURROAD AKKASANDRA EXTENSION KORMANGALA BANGALORE PIN CODE:


560034, STD CODE: NA , TEL NO: 25534542, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

1/2 NAAZ COMPLEX 3RD CROJS NR ROAD BANGALORE-2 PIN CODE: 560002, STD CODE: NA ,
TEL NO: 22224831, FAX NO: NA, E-MAIL : N.A.

1988

10 - 50

3218

SHAH

ORIENTAL SELEC GRANITES PVT LTD 7O/16 2N D MAIN ROAD VYALIKVAL BANGALORE SC PIN
CODE: 560003, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3219

MONTRIAL ENGINEERING COMP


BUILDERS AND

3220

3221

3222

Year of start of
Operation

ALFA SIEEL

3223

PRAKKSH

RAMAMOHANPVRAM DAVAIYPARK BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO:
23327758, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3224

TSSHASHAH

SUNRISE SALES CORPN 23/26 C INDUSTRIAL 1STMAINROADRAJAJINAGAR BANGALORE


56OO44 PIN CODE: 560044, STD CODE: 0836, TEL NO: 5250145, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3225

CEMENT GODOWN

WHITE FIELD ROAD NDUSTRIAL AREA HOODI BANGALORE PIN CODE: 560048, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3226

VELUGOPAL

3FLOORROADCONSTRUCTIONOFFICE BANGALORE PIN CODE: 560020, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

3227

BUILDING CONTRACTOR RAMANAGAR,

NO. 12, 6TH MAIN, 18TH CROSS, MALLESWARAM BANGALORE PIN CODE: 560055, STD CODE:
NA , TEL NO: NA , FAX NO: 70110712, E-MAIL : N.A.

1994

10 - 50

3228

BALAJI ENTERPRISES

NO31/A, GU AHALLI, ND MAIN ROAD MALLESHWARAM, BANGALORE PIN CODE: 560003, STD
CODE: NA , TEL NO: 23366343, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3229

GO AVARI OLYMERS PR ATE LIMITED

NO B R SS SU HAMAN GAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO:
22277427, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3230

KHANDALA WALA PIPE RADER

N 199FIRST FLR KSGARDEN LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA
, TEL NO: 22237003, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3231

B K RAJENDRAN

MYTHREYI PROMOTERS AND BUILDERS PRIVATE LTD SI AG CROSS S BLOCK JAYANAGAR


BANGLR PIN CODE: 560041, STD CODE: 080, TEL NO: 26631955, FAX NO: 26631956, E-MAIL :
N.A.

2000

10 - 50

241

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

3232

PARAMOUN CONSTRUCTIONS NO 19/1

3233

Year of start of
Operation

Employment
Class

(4)

(5)

1ST FLOOR 9TH CROSS MARGOSA ROAD MALLESWARAM BANGALORE PIN CODE: 560003,
STD CODE: NA , TEL NO: 23441687, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

ANNAPURNESHWAR ENTERPRISES

NO342/43 32CROSS 4THBLOCK TILAKNAGAR JAYANAGAR BANGALORE 41 PIN CODE:


560041, STD CODE: NA , TEL NO: 26557772, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3234

BIRLA READYIMIX CONCRETE

OPPOSITE BHEL MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3235

ALIED PAIN DIS

NO-147-7 NEAR SIRS CIRCLE MYSORE ROAD BANGALOR PIN CODE: 560018, STD CODE: NA ,
TEL NO: 26751701, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3236

HOLLAND GRANITES TI PRIVATE


LIMITED

5TH MAIN ROAD 1ITH CROSS M C LAYOU VIJAYANAGAR BANGALORE PIN CODE: 560040, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3237

MADHU

MADHU INDUSTRIES N S PALYA BANNERGHA A ROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3238

***

NA

10 - 50

3239

KIRAN CONSTRUCTION

CHURCH STREE BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3240

FIZA DEVELOPERS

RESIDENCY ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3241

ROFFE CONSTRUCTIONS CHEMICALS

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3242

M S KUPPUSWAMY BUILDERS

M G ROAO BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3243

HINDUSTHAN STEEL WORK


CONSTRUCTED LTD

M G ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3244

RAJARAJESHWARI BUILDERS

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3245

MADRAS CEMENTS LTD

RANKA APPARTMENT LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3246

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

242

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)
,

Year of start of
Operation

(4)

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3247

***

3248

BELL SIRAMIX LIMITER

BHEL OPPOSITE MYSORE ZMAD BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

3249

CORPORATTON WARD OFFICE

3250

***

3251

ACC&RMCASSOCIATEDCEMENTCOMPA
NIES LTD

WHITEFIELDMAINROAO MAHADEVADURADOS BANGALORESOUTH DISTRIC PIN CODE: 560048,


STD CODE: NA , TEL NO: 28410277, FAX NO: 28411757, E-MAIL : N.A.

3252

RAM CERAMICS

MG ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

Employment
Class

(5)

NA

10 - 50

PIN CODE: 560026, STD CODE: NA , TEL NO:

1988

51 - 100

ASSISTENTEXECUTIVEENGENEERHOMBEGOWDANAGAR ARA SUB DIVISION H SIDDAIAH ROAD


BANGAORE PIN CODE: 560027, STD CODE: NA , TEL NO: 22975719, FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

NA

51 - 100

1990

101 - 500

NA

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NIC 2004 : 5149-Wholesale of other intermediate products, waste and scrap


3253

SRILAKSHMI NDUSTRIAL EZNGINRERS


LTD

89/I JILIROAD ,
: N.A.

PIN CODE: 560002, STD CODE: NA , TEL NO: 51224100, FAX NO: NA, E-MAIL

1995

10 - 50

NIC 2004 : 5151-Wholesale of computers, computer peripheral equipment and software


3254

SILVER LINE INFORMATION SYSTEM

11TH CROSS, MALLESHWARAM BANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3255

COMPUTOR SYSTMS SALE 17TH A


CROSS 8THMAIN

MALLESWARAM 560055 ,
NA, E-MAIL : N.A.

1988

10 - 50

3256

CHANDRAKVMAR ACE NFOSYS

TGII ZND MAINFLOOR 2ND MAIN SHESHDRLPURAM BANGALORE PIN CODE: 560020, STD CODE:
NA , TEL NO: 23466618, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3257

INDANE SHEELA AGENCY

ISI MAIN RD PHASE SARAKKL LAYOUT J P NAGAR BANGALORE PIN CODE: 560078, STD
CODE: NA , TEL NO: 26491076, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3258

GLOBLE AVTO MESHION

CROSS BLOCK JAYANAGAR BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3259

HARICHAN ECHNOLOGIES

68 SHRIKANTA NIVAS 6CROSS ROAD SAMPIGE ROAD MALLESWARAM BANGALORE PIN CODE:
560003, STD CODE: 98800, TEL NO: NA , FAX NO: 23348121, E-MAIL : N.A.

1997

10 - 50

PIN CODE: 560055, STD CODE: NA , TEL NO: 23469441, FAX NO:

PIN CODE: 500011, STD CODE: NA , TEL NO:

243

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3260

ARENA MULTI MEDIA

NOGO BETWEEN7& 8TH CROSS 4TH MAINRDAD 4TH MAIN ROAD, MALLESHWARAM
BANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO: 23463574, FAX NO: NA, E-MAIL :
N.A.

1999

10 - 50

3261

M MOHADEEP AKRAM

NO.4/14TH MAIN 9TH CROSS MALLESWARAM BANGALORE_03 PIN CODE: 566003, STD CODE:
NA , TEL NO: 23343880, FAX NO: 23343860, E-MAIL : N.A.

2001

10 - 50

3262

COMPULEESE NETWORK PRIVATE LTD

NO. 153, 4 9TH CROSS, 7TH MAIN MALLESHWARAM PIN CODE: 560003, STD CODE: NA , TEL
NO: 23311570, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3263

PRAMPT COMPUTER SERVICE

NO 346 2ND CROSS BLOCK JAYANAGAR RANGAL ORE 11 PIN CODE: 500011, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3264

SUJAY ESS SELUTION MOHAM


NFOTECH

NO 10 1O CROSS HOMBE GOWDA NAGARA BANGALORE 27 PIN CODE: 560027, STD CODE:
9180, TEL NO: 26492353, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3265

BOVIS LAND LEASE NDIA PVT LTD

IOS EMBASSY SQUARE 4B NFANTRY ROAD BANGALORE PIN CODE: 560011, STD CODE: NA ,
TEL NO: 22099777, FAX NO: NA, E-MAIL : N.A.

1996

51 - 100

3266

ANDRITZ TECHNOLOGIES PRIVATE


LIMITED

G33 2FLOOR MAKAM PLAZA MARGOSA ROAD MALLESHWARAM BANGALORE PIN CODE:
560055, STD CODE: NA , TEL NO: 23465995, FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3267

***

ACCESSTECHNOLOGIESPRIVATELIMITED #9/7 HOSURROAD OPPTOCHRISTCOLLEGE


BANGALORE PIN CODE: 560029, STD CODE: NA , TEL NO: 25539232, FAX NO: 25539231,
E-MAIL : N.A.

1995

101 - 500

3268

ORACLE NDIA PRIVATE LIMITED

PRESTIGE BLUE CHIP BUILDING NO 9 HOSUR ROAD BANGALORE 29 PIN CODE: NA , STD CODE:
NA , TEL NO: 51083000, FAX NO: NA, E-MAIL : N.A.

2002

> 500

3269

SOFTWARE DEVELOPMENT HANDL


INFORMATION

ECHNOLOGY PRESTIGE BLUECHIP BUILDING NO 9 HOSUR ROAD BANGALORE PIN CODE:


560029, STD CODE: NA , TEL NO: 51114012, FAX NO: NA, E-MAIL : N.A.

2003

> 500

2 FIOOR JCROAD BANGALORE SGOOOZ PIN CODE: NA , STD CODE: NA , TEL NO: 2222314,
FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

NO 73 RAMACHANDRA AGRAHARA O CROSS NEAR R MILLS CHAMARAJPE BANGALORE I8


PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

NIC 2004 : 5152-Wholesale of electronic parts and equipments


3270

NO6B FARAH COMMERCLAL CDMPLEX

3271

PRAKASH H A NSTRUMENTATIONS

244

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1992

(5)
10 - 50

8/2ISURESH KUMAR BELLAYY AIN ROAD GANGFN AGAR BANGALORE PIN CODE: 560032,
STD CODE: 00080, TEL NO: 23436392, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

NAVEEN ELECTRIC COMPANY


RAJAJINAGAR

NO248/A STAGE 5TH PHASE 4TH MAIN SHIVANAGAR NDUSTRIAL TOWN BANGALORE PIN
CODE: 560044, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3275

ELECTRICAL GOODS DEALERS

NO 108/1 GROUND FLOOR OPP KANNADA BHAVAN JC ROAD BANGALORE PIN CODE: 560002,
STD CODE: 00080, TEL NO: 22274488, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3276

SATISH

NO 16116 4 MAIN TATA SILK FARM KRROAD BANGALORE PIN CODE: 560082, STD CODE: NA ,
TEL NO: 26769143, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3277

A B S INDIA

49 OO FEE ROAD UKK BLOCK KORMANGALA BANGALORE PIN CODE: 560034, STD CODE:
NA , TEL NO: 25536114, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3278

HYNETIC ELECTRONICS

N 3RD CROSS GAVIPURAM BANGALORE 19 PIN CODE: 560019, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3279

AKAI CONSUMER ELECTRONICS INDIA


LTD

NO 16 2ND FLOOR APPLE VILLA LALBAGH ROAD BANGALORE PIN CODE: 560027, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3280

SHANTH ELECTRO MAINRFNTANGE

4O3O 19TH MAIN HAL STAGE RPNGALORE PIN CODE: 560008, STD CODE: 98450, TEL NO:
40192, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3281

PG NAMBIYAR ELECTRONICS

181 2 STAGE BTMLAYOU 30 MAIN LAKESHOWROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: 26688724, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3282

RAJA

JYOTHI ENTERPRISES RTNAGAR MAIN ROAD BANGALORE PIN CODE: 560032, STD CODE: NA ,
TEL NO: 23542661, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3283

GOVINDAPPA POWER LOOMS

NO 64 7TH CROSS SRIRAMPURA BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3284

PARAS ELECTRLCAL CORPORATION

NO7 14TH CROSS KILARI ROAD BANGALORE PIN CODE: 560053, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3285

TITAN MARKETING UCM IN MKTF


SOLUTIONSIPL

41 R V ROAD BASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: 080, TEL NO:
05128536, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3272

ANCHOR ELECTRONICS AND


ELECIRICAL PV LTD

NO 196/2 SECOND MAIN ROAD ANANTHARAMAIAH COMPOUND MYSORE ROAD BANGALORE


PIN CODE: 560018, STD CODE: NA , TEL NO: 26705720, FAX NO: NA, E-MAIL : N.A.

3273

SORESH KUMUR

3274

245

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

3286

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3287

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3288

MORDERN RADIO ENGNEERS CJ

NA

10 - 50

3289

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3290

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3291

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3292

RAHUVEER N

NO 41/1 S C ROAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO:
26670824, FAX NO: NA, E-MAIL : N.A.

1995

51 - 100

3293

EASUN REYROOLLER LIMITED

I7/3 ARAKERE VILLAGE BANNERGHA A ROAD BANGALORE PIN CODE: 560076, STD CODE: NA
, TEL NO: 26581023, FAX NO: NA, E-MAIL : N.A.

1996

51 - 100

3294

S MICRO ELECTRONICS

31 MILLAR2S ROAD BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 52235484, FAX
NO: NA, E-MAIL : N.A.

2004

51 - 100

3295

APOLO POWER SYSTEMS PRIVATE LTD

NO47 3RD MAIN ROAD MARGOSAROAD MALLESHWARAM BANGALORE PIN CODE: 560003,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

3296

D B POWER ELECTRONICS PRIVATE


LTD

NO BOI NEAR RAILWAY STATION MALLESHWARAM BANGALORE PIN CODE: 560003, STD
CODE: NA , TEL NO: 23445516, FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

3297

THE PACE ELECTRONICS

NO 55,11TH CROSS, VYALIKAVAL MALLESHWARAM BANGALORE PIN CODE: 500003, STD


CODE: NA , TEL NO: 23310961, FAX NO: 23448842, E-MAIL : N.A.

2000

101 - 500

3298

IND AIR CON

NO.14, MARKAM ROAD, ASHOK NAGAR BANGALORE PIN CODE: 560025, STD CODE: 080, TEL
NO: NA , FAX NO: 51128177, E-MAIL : N.A.

2001

101 - 500

3299

FINOLIGH ELECTROHEA PV LTD

NO 10 YASHAWANTHPURCIRCLE YASHAWANTHPUR BANGALORE PIN CODE: 560022, STD


CODE: NA , TEL NO: 23371467, FAX NO: NA, E-MAIL : N.A.

1980

> 500

1990

10 - 50

RESIDENCY ROAD BANGALORE PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NIC 2004 : 5159-Wholesale of other machinery, equipment and supplies


3300

BBLAKRISHNA

JUEL NCEC ON PUM SGL Q CROSS H SIDDIAH OAD B NGALO F ZGOOZ PIN CODE: NA , STD
CODE: 22233, TEL NO: 785, FAX NO: NA, E-MAIL : N.A.

246

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3301

KRISHNA

AIE RIS B CRO S SIDD H R AD BA GALORF SGO Z PIN CODE: 560027, STD CODE: 22230, TEL
NO: 0901, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3302

YATHIVRLUR

STCEL 7BBQR ELECTRUAL WORK PVT LIM HONO7TCROSS H SIDDIRH ROAD BANGALORES6O27
PIN CODE: 560027, STD CODE: 51146, TEL NO: 952, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3303

G ANWER ELECTRICAL PARTS SUPPLYS

NO12 5TH CROSS H SIDDAIAH ROAD BANGALDRE PIN CODE: 560027, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3304

***

NA

10 - 50

3305

BASE ERMINAL CORP P LTD

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

848 15TH MAIN 3RD BLOCK KORAMANGALA BANGALORE PIN CODE: 560034, STD CODE: NA ,
TEL NO: 25529003, FAX NO: 1111111, E-MAIL : N.A.

NIC 2004 : 5190-Other wholesale


3306

BHARAT RUBBER CNDUSTRIES

B-IT BEL INDUSTRIAL ESTATE JALAHALL BANGALORE PIN CODE: 560013, STD CODE: NA ,
TEL NO: 23452786, FAX NO: NA, E-MAIL : N.A.

1986

10 - 50

3307

AJAY ARCADE VANIVILAS ROAD SUSHIL


MANDRA

NO171 BASAVANA GUD VANLUILAS ROAD BPNGALORE PIN CODE: 560004, STD CODE: NA ,
TEL NO: 26607697, FAX NO: 26607568, E-MAIL : N.A.

1987

10 - 50

3308

G KRJSHNAMURTHY RAO

RAO CONCEL AGENCY N0_91 5 CROSS 5 MAIN KORAMANGALA BANGALORE.95 PIN CODE: NA
, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3309

SRI GANESH MARUTHI MARKETING NO


5

3RD CROSS MODULE HOUSE STREE BASAVANAGUDI BANGALORE-4 PIN CODE: 560004, STD
CODE: NA , TEL NO: 26771507, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3310

MANAGER ALKEM LAB LIMITED

MAGADI MAIN ROAD BANGALORE PIN CODE: 560023, STD CODE: 00080, TEL NO: 23309970,
FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

3311

MANJUNATHA

MANJUNATHA RON IND DEEPANJALINAGARA BANGALORE 3 CROSS PIN CODE: NA , STD


CODE: NA , TEL NO: 23492698, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3312

DROSS AUTO MATION

FIFTH CROSS MATHIKERE MAIN ROAD YASHAVANTAPURA BANGALORE PIN CODE: 560022,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3313

CHANDRASHEKAR

1 FLOORVIVEK COMPLES SM RDAD ,


FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

PIN CODE: 560058, STD CODE: 000, TEL NO: 28376154,

247

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2000

(5)
10 - 50

N109 CROSS RAJARAM MOHAN ROY EXTENSION K H ROAD BANGALORE PIN CODE: 560027,
STD CODE: NA , TEL NO: 22123390, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

GOPALA KRISHNA SHE Y

SAPTHAGIRI PHARMA DISTRIBUTORS NO43 2CRS RAMACHANDRA ARRAHARA BANGALORIB


PIN CODE: 560018, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

FLOORKOTES PVT LTD

G-H FLOORKOTES PLAZA NO 348 IS MAIN BTH BLOCK KORAMANGALA BANGALORE PIN
CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: 51217743, E-MAIL : N.A.

2002

10 - 50

NO7/1ZND FLOOR ARUNA COMPLEX JC ROAD BANGALORE SGOOOZ PIN CODE: NA , STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3314

B R MURTHY SUJAY FEEDS

NO 8O I3TH CROSS LAKSHMIAH BLOCK GANGANAGAR BANGALORE PIN CODE: 560032, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3315

SAUMITHA CONTROLS

3316

3317

3318

NONDUSTAN DRUG HOVSE

3319

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3320

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3321

AGSAR PAINTS

NA

10 - 50

3322

***

NA

10 - 50

3323

BHARTHIYA VEDHYA BHAVAN

NA

10 - 50

3324

***

NA

10 - 50

3325

COLD AIR NC

NA

10 - 50

3326

***

NA

10 - 50

3327

SURANGASWAMY AND COMPANY PV


LTD

NO2 3RD CROSSKALASSPALYAM NEW FXXEWS BANGALORE O2 PIN CODE: NA , STD CODE:
NA , TEL NO: 22222301, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3328

DESHPANDY DRUGS

# 22/7 MGK LAYOU CHAMARAJPE BANGALORE PIN CODE: 560018, STD CODE: 00080, TEL NO:
26522995, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

1966

51 - 100

3329

SUKRUIA AGENCIES

VISWKSWARAPURAM BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

RACE COURS ROAD BANGALOR PIN CODE: 460001, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NO 305 4 MAIN RMV EXTENTION BANGALORE PIN CODE: 560080, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3 FLOOR FAAAM COMPLEX NCTS JC ROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL
NO: 22273453, FAX NO: NA, E-MAIL : N.A.

248

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

Name of Establishment

(1)
3330

STATE : KARNATAKA

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

NOI6 3FLOOR NEW RAJA BUILDING

Year of start of
Operation

Employment
Class

(4)

(5)

NARANG CHAMBERS NR ROAD BANGALORE 2 PIN CODE: 560002, STD CODE: NA , TEL NO:
22227474, FAX NO: NA, E-MAIL : N.A.

1975

51 - 100

1990

51 - 100

NA

101 - 500

3331

MR SURESH UNIFIEM ELECTRO


TECHNIC LIMITED

DOOR NO JZ Z FLOOR KOMAL MENSION MINFRVA CIRCLE BANGALORE PIN CODE: 560002, STD
CODE: 080, TEL NO: 26706677, FAX NO: NA, E-MAIL : N.A.

3332

VALDEL RETAIL PRIVATE LIMITED

FAMILY MAR KANAKAPURA MAIN ROAD J P NAGAR POST BANGALORE PIN CODE: 560078,
STD CODE: NA , TEL NO: NA , FAX NO: 56226944, E-MAIL : N.A.

3333

HARSHABHAHADUR NO 26/3 METRO


CASH AND

CARRY SUBRAMANYA NAGAR A BLOCK NO-9 BANGALORE PIN CODE: 560055, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

> 500

NIC 2004 : 5211-Retail sale in non-specialized stores with food, beverages or tobacco predominating
3334

RAILWAY STATION

O H E DEPO WHITE FIELD KADUGUDT BANGALORE PIN CODE: 580067, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1895

10 - 50

3335

P K K ABDULLA P K FRESH N BAKE

MARKET ROAD KADUGUDI BANGALORE EAST TALUK, BANGALORE URBAN PIN CODE:
560067, STD CODE: NA , TEL NO: 28452475, FAX NO: NA, E-MAIL : N.A.

1980

10 - 50

3336

ARIESI

PLOTINO15610MAIN 3PHASE PEENYA INDUSTRIAL AREAIBANGAZORE 58 PIN CODE: 111111,


STD CODE: 11111, TEL NO: 11111111, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3337

IYENGARSHOMEPROUUCTS NO I6
ANDERHALLI MA

INROAD PEENYA 1STAGE BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1995

10 - 50

3338

EVI AUDIO INDIA PRIVATE LTD

82/83 BOREWELL ROAD WHITEFIELD BANQALORE PIN CODE: 560066, STD CODE: 080, TEL NO:
51903000, FAX NO: 28456467, E-MAIL : N.A.

1997

10 - 50

3339

JAGADISH

VJSVESKARSVAROAD BOMMANAHALLI BANGALORE PIN CODE: 560068, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3340

G S ENTERPRISES

NO325 PEENYA INDUSTRIAL AREA 4 PHASE BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28363505, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3341

RAJKUMARPALL

694KPTCLBUILDINGHOSURMAINROAD BOMMANAHALLIBANGALORE PIN CODE: 560068, STD


CODE: 25730, TEL NO: 442 43, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3342

MANJUNATHACNDUSTRIES

DORESANZPALVA BANGAWORE BANNERGHATTAROAD PIN CODE: 560076, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

249

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3343

COCOCOLA SUPPLIERS RAMANNA


COMPLEX

MANGAMMANAPALYA MAIN ROAD BOMMANAHALLI BANGALORE PIN CODE: 560068, STD


CODE: NA , TEL NO: 56901520, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3344

COMMON POWER LOOM ZNDUSTRY

10CROSS 4 MAIN BEGUR ROAD BOMMANAHALLI BANGALORE-68 PIN CODE: NA , STD CODE:
NA , TEL NO: 25731989, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3345

JUICE JUNCTION

TECK PARKIMALL NNAOATION BUILDING WHITEFIELD ROAD BANGALORE PIN CODE: 560066,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3346

NEW ARYA BHAVAN

#65 5 MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3347

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3348

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3349

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3350

SHREENIVASA CHARLES

SRI SAW KNITS NO 4 VIRAT NAQAR BEGURRJAD BOMMANAHALLJ CROSS BBNGBLORE G8 PIN
CODE: NA , STD CODE: NA , TEL NO: 25730687, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3351

S NARAYANAN DIVIYABASHOKIBUILDING

KAMMAGONDANAHALL JALAHALLIWES BANGALORE ,


, TEL NO: 28388514, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560015, STD CODE: NA

NA

10 - 50

3352

P V PALACE BAKERY SWEETS

IZ AMBIKA NILAYA ST MAIN ROAD DASRRAHALLY PIN CODE: 560057, STD CODE: NA , TEL
NO: 28371918, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3353

ARCHANA VARMA GROUND FLOOR

SHRI SHAKT SOCIETY CO-OPERATIVE LIMITED SPORTS CLUB BUILDING, BANGALORE PIN
CODE: 560016, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3354

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3355

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3356

B RAMESH

SHANTHAHAR CONDIMENTS NO 27PATELCHENNAPP INDUSTRIAL ESTATE HEGGANALLI ESTATE


PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

101 - 500

3357

SRI BALAJI EASTAR STAMP SHOELAY


AND SOMA

PPA FACTORY LIMITED BEST QUALIITY SPRING MANUFACTURER GHARVEBHAVIPALYA


BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

250

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

Address / Telephone / Fax / E-mail

(1)
(2)
NIC 2004 : 5219-Other retail sale in non-specialized stores

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

3358

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3359

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3360

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NIC 2004 : 5220-Retail sale of food, beverages and tobacco in specialized stores
3361

P M Z MAWD

61 B BLOCF SJR MARXET NEW KALASIPALYA BANGALORE PIN CODE: 560002, STD CODE: NA
, TEL NO: 2691732, FAX NO: NA, E-MAIL : N.A.

1932

10 - 50

3362

JAR MAND NO8 A BLOCK N P MARKET

BANGALORE ,

PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3363

BANKHALL NOI5 NEW KALASIPALYA


MARKET

BANGALORE ,

PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3364

A SHANKARAPPA MAND NO10


NEWKALASIPALYA

MARKET BANGALORE ,
NA, E-MAIL : N.A.

PIN CODE: 560002, STD CODE: NA , TEL NO: 26702781, FAX NO:

1975

10 - 50

3365

BANGALORE GINGER RADING


COMPANY

NO A/6 NEW KALASIPALYA MARKE BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL
NO: 26703812, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3366

NAIDU MAND VEGETARLE MERCHANTS

9BASE A SRIJAYACHAMARAJENDRA APMC MARKET KALASIPALYA BANGALORE PIN CODE:


560002, STD CODE: NA , TEL NO: 26703507, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3367

BM RAMANNA & SONS TOMATO &


VEGLTABLE MERC

HANTS NO 5 BASE A SR JAYACHAMARAJENDRA APMC MARKE KALASIPALYAM BANGALORE


PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3368

MHMAGERT

33CASJNDBARTAJNLESTERENTTGANDHINAAGA BANJGALORT
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1979

10 - 50

3369

G K TRADERS

ZJ SOFTROAD HANUMANTHANAGAR BANGALORE ,


TEL NO: 26527868, FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560019, STD CODE: NA ,

1980

10 - 50

3370

G GIRIJADEVI DEPUTY DIRECTOR

# 2, C CROSS VYALIKAVAL BANGALORE NORTH PIN CODE: 560003, STD CODE: NA , TEL
NO: 23445702, FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

251

TE PIN CODE: 560009, STD

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1983

(5)
10 - 50

RAMDAS AND SONS NO 6A K R ROAD BASAVANAGU DI BANGALORE PIN CODE: 560004, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1983

10 - 50

M R NARAYAN

NO659 2MAIN 2PHASE HOSAKEREHALLT BSK3STAGE BANGALORE PIN CODE: 560085, STD
CODE: NA , TEL NO: 26720384, FAX NO: NA, E-MAIL : N.A.

1984

10 - 50

3374

RAGAM BAR AND RESTAURANT

35/1 5TH CROSS MALLESWARAM BANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3375

AMC OFFICE NO 14 NEW KALASIPALYA


MARKE

BANGALORE ,

PIN CODE: 527002, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3376

P DHANALAKSHMI MANDI

#3O1 B BLOCK 1FLOOR JC ROAD MARKET NEW KALASIPALYA PIN CODE: 560002, STD CODE:
NA , TEL NO: 6709832, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3377

MRK MAND NO N/4 A BLOCK

NEW KALASIPALYAM MARKE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3378

K K ABDUL REHAMAN PROVISION


STORE

MARKET ROAD KADUGUDI BANGALORE EAS TALUK BANGALORE URBAN PIN CODE: 560067,
STD CODE: NA , TEL NO: 28452475, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3379

SRI KRISHNA SWEETS UNI

SRI KRISHNA SWEETS PRODVCTS NO 194 MAIN MAHALAKSHMIPVRUM ENTRANCE


BANGALORE SG PIN CODE: 560086, STD CODE: NA , TEL NO: 23494125, FAX NO: NA, E-MAIL :
N.A.

1987

10 - 50

3380

SAGAR FAST FOOD 16TH MAIN RDAD

BTM IS STAGE BANGALORE PIN CODE: 560079, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

1988

10 - 50

3381

SYFD SMAIL

52 B BLOCK BASEMEN S J R MARKET NEW KALASIBALYA


CODE: NA , TEL NO: 26707989, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3382

SMT MUNIYAMMA9AND JHARISH MAND


NO17

ABLOCK NEW KALASIPALYA MARKE BANGALORE ,


TEL NO: 26706997, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3383

ARMANELECTRONICSPRIVATELIMITED

4MARKETROADNEARNETKALLAPPACIRCLE ,
NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3384

AISHWARYADEPARTMENTAL

NO 168 7MAIN 1BLOCK KORMANGALA BANGALORE PIN CODE: 560034, STD CODE: NA , TEL
NO: 25531345, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3371

RUP RUBBER ENTERPRISES

27 KAMAKASPALAYAINDSTRILILAND 2MAIN ROAD MAGADI MAIN ROAD PIN CODE: 560079,


STD CODE: NA , TEL NO: 23486461, FAX NO: NA, E-MAIL : N.A.

3372

S V S PRODUCTS

3373

A PIN CODE: 560002, STD

PIN CODE: 560002, STD CODE: NA ,

PIN CODE: 560004, STD CODE: NA , TEL NO:

252

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3385

SHREE KRISHNA INDUSTARIES

#2OO 9MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28392044, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3386

MADUDHAR AUTO PRDDUCTS

NO79/I3 14THCROSS A D HALL BANGALORE 79 PIN CODE: 560079, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3387

IRAAVATHA BAR AND RESTAURANT

36-37 5TH CROSS MALLSHWARAM BANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

LL7TH 3RD FLOOR NEAR BHARATHPETROLBANK LLJCROAD BANGALORE560002 PIN CODE:


NA , STD CODE: NA , TEL NO: 57665213, FAX NO: NA, E-MAIL : N.A.

1993

10 - 50

3388

SATHYAJYOTHICOLLEGE

3389

SANJAYAKUMAR

NO 5 SANJAYKUMAR BELLARY ROAD GANGANAGAR BANGALORE PIN CODE: 560032, STD


CODE: 080, TEL NO: 23545588, FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3390

NEW SHNTHT SAGAR NO I6O9/24


KUVEMPU ROAD

OPPOSITE O DEVAYA PARK BANGALORE 21 ,


NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3391

GURUKRUPA BAR AND RESTAURANT

1458 1MAINROAD VIDYARANYANAGAR CHOLARAPALYA MAGAI ROAD BANGALORE 23 PIN


CODE: 560023, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3392

BANGALORE MISHRA PEDA SWEE


STALL

RAJARAM MOHAN ROY ROAD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3393

GENERAL TRADERS

22/2 AR ROAD SHIVAJI ALKIES BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL NO:
22873484, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3394

AVM MAND NO 3/A BASEMEN BLOCK

NEW KALASIPALYAM MARKE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3395

CLEARING AND FORWARDING AGENCY

NO 41/2A 2B NITHYANANDA NAGAR NAYANDANAHALLI MYSORE ROAD BANGALORE PIN


CODE: 560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3396

SUPER MARKET

ORANGE CASH AND CARRY A N COMPLEX SANJAYNAGER MAIN RD BANGALRE PIN CODE: NA
, STD CODE: NA , TEL NO: 23415794, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3397

K S MAND NO 147 B BLOCK SJR


MARKE

NEWKALAS PALYA BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: 20703849, FAX
NO: NA, E-MAIL : N.A.

1997

10 - 50

3398

BHAT FOODS N08 8TH MAINROAD


GANESHA BLOCK

NANDIN LAYOUT BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

PIN CODE: 560021, STD CODE: NA , TEL NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA ,

PIN CODE: 560096, STD CODE: NA , TEL NO: 23490959,

253

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3399

JODHPUR SWEETS

NO 7 1 6TH CROSS BASAVANNA TEMPLE STREE BANGALORE PIN CODE: 560053, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3400

NILGIRIS

27 CROSS 3 BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
26341692, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3401

FOOD WORLD SUPER MARKE

GANDHI BAZAR MAIN RDAD BASAVANAGUD BANGALORE PIN CODE: 560004, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3402

CPT SUBRAMANYA MAYSON AND


SUMERS

NO777/C2 100 FEE ROAD H A L 2 STAGE DHUPANAHALLI BANGALORE PIN CODE: 560038, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3403

K ANATHA RAMAYIAH NO 100

JEWELERS STREE SHIVAJINAGAR BANGALORE 560001 PIN CODE: 560001, STD CODE: NA ,
TEL NO: 25592523, FAX NO: 25592523, E-MAIL : N.A.

1999

10 - 50

3404

SQLMS

NOI7TH CROSS NDIRANAGAR ZMD STAGE ,


NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3405

FUNN WORLD

CMH ROAD NDIRANAGAR ST S AGE BANGALORE PIN CODE: 56003, STD CODE: NA , TEL NO:
51153003, FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3406

L BALAJI S V LINGAREDDY

NO 15ARAYANAMMA NILAYA 6TH CROSS HOSAPALYA BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3407

FOOD WORLD

INDIRA NAGAR 2STAGE 100 FEET ROAD BANGALORE PIN CODE: 560038, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3408

ASHOKRAN CONSUMAR SALE

CMH ROAD NDIRANAGAR BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3409

GREENS & GRAINS PV LTD

252/ RAJGOPAL ROAD RMV 2 STAGE SANJAY- NAGAR BANGALORE PIN CODE: NA , STD
CODE: NA , TEL NO: 30943580, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3410

HARISH SHA NO 576 3RD STAGE 4TH


BLOCK

PADMA SUPER STORES PVT LTD BASAVESHWARANAGAR BANGALORE PIN CODE: 560079,
STD CODE: 00080, TEL NO: 23234227, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3411

MATCM PALKAGINGI

NO40VEERAJ BASEMFNTICAVVERY NAGAR NHCSLAYOUT KAMAXIMALXA PIN CODE: 560079,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3412

***

ON 123&4IS FLOOR 17TH CROSS NDIRA NAGAR BANGALORE PIN CODE: 560038, STD CODE:
NA , TEL NO: 57603209, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

PIN CODE: 560038, STD CODE: NA , TEL NO:

PIN CODE: 560038, STD CODE: NA , TEL NO: NA ,

254

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3413

FOOD WORLD SUPER MARKE LTD

NDI3 SANJAY NAGAR MAIN ROAD BANGALORE PIN CODE: 560094, STD CODE: NA , TEL NO:
23511365, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3414

JAGADISH CONDIMENDS

JAGADISH KARA CONDIMENDS PURNADURA VILLAG E GOKULA BANGALORE PIN CODE:


560054, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3415

SRINJDHISAGAR

KIMSHOSPITALBUILDINGINSIDE LALBAUGHFORTROADBANGALORE PIN CODE: 560004, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3416

FOODWORLD

1OO FT ROAD BTM LAYOUT BANGALORE 76 PIN CODE: 560076, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3417

GANAPATI PRABHU NO7 24 CROSS

SRINIVAGELU MAIN ROAD EGIPURA BANGALORE PIN CODE: 560047, STD CODE: NA , TEL NO:
25700733, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3418

PIZZA CORNER

NO 87 RESIDENCY RDAD BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO: 25596000,
FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3419

FAB MALL SUPER MARKE

GANDHI BAZAR BASAVANAGUD BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3420

SRIKRISHNASWEETP

IZIDUGROADRASAVANACNPI ,
NA, E-MAIL : N.A.

2002

10 - 50

3421

SHREERAJU

KABAB CENTRE PORVA NAGAR R NAGAR MAIN BANGALORE PIN CODE: 560032, STD CODE:
080, TEL NO: 30951231, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3422

MANEGER FOOD WORLD S MAIN ROAD


EAST OF

CHORD ROAD NO 2937 VIJAYANAGAR D STAGE BANGALORE PIN CODE: 560040, STD CODE:
302, TEL NO: 51270301, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3423

JP GNTERPRICESS

GS 3CR SS LALRMA OAD BANGLDRC ,


22223137, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3424

MONDAY O SUNDAY

NO 948 24 TH MAIN ROAD MARENAHALLI J P NAGARA 2 ND PHASE BANGALO PIN CODE:


560078, STD CODE: NA , TEL NO: 51214121, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3425

SOGUNACHIKKENCENTRE

AMCROADAREBICCOLLEGEPOSTBASAVANAGARKADUGO NDANAHALLIBANGALORE PIN


CODE: 560045, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3426

ADYAR ANAND BHAVAN

GANDHI BAZAR BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

2003

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: 1,

PIN CODE: 560004, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: 560027, STD CODE: NA , TEL NO:

255

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3427

FOODWORLD

KANAKAPURAMAINROAD 7BLOCK JAYANAGAR BANGALORE PIN CODE: 560082, STD CODE:


NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3428

KAMANDAR RAJAN

MONDAY SUNDDY 7 BZOCK KORAMANGALA BANGLORE PIN CODE: NA , STD CODE: NA , TEL
NO: 25630168, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3429

OVEN FRESH

40 5TH CROSS MALLESWARAM BANGALORE PIN CODE: 560003, STD CODE: NA , TEL NO:
23446173, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3430

KANT SWEETS NO83 SOUNDARYA


PARAMOUN

5CROSS MALLESWARAMCIRCLE BANGALORE ,


23448343, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3431

USPIZZA

NO52 1CROSS SARAKKIVILLAGE 2PHASE JPNAGAR BANGALORE PIN CODE: 560078, STD
CODE: NA , TEL NO: 56787171, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3432

FOOD WORLD SUPERMARKETS LTD

42/2 22 CROSS 3 BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL
NO: 51211268, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3433

***

FABMALL BANGLORE tips @fabmall.com PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

2004

10 - 50

3434

HOME STORES SHOPPING CENTRE

642 MAIN JAYANAGAR 5 BLOCK BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
51214295, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3435

K K UMMER P K DEPARTMENTAL STORE

MARKET ROAD KADUGUDI BANGALORE EAS TALUK BANGALORE URBAN PIN CODE: 560067,
STD CODE: NA , TEL NO: 28452475, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3436

PILSTOP

NO 39, MAGRATH ROAD BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

2005

10 - 50

3437

MANAGER

MAHAVEER PALITHIG PIPE ENTER PVT LTD BB78 PEENYAIDUSTRILARIA BANGALORE PIN CODE:
560058, STD CODE: NA , TEL NO: 28396544, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3438

LAXMINARAYANA

FOODWORD RAJAJINAGAR MODI HOSPITAL ROAD PIN CODE: NA , STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3439

DILIP POWERTRANICS SXSTEM PU


LTD

NO 63 4CROSS 6MAIN 6PHASE1STAGE WOC ROAD IMDUSTRIAL OWN BANGALORE 44 PIN


CODE: 560044, STD CODE: NA , TEL NO: 23308883, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3440

PRABHA RADERS

NO2 RAMANNAPET CHICKPET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22241723, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: 560003, STD CODE: NA , TEL NO:

256

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

3441

B N PRABHAKAR

3442

***

3443

***

3444

***

3445

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3446

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3447

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3448

SUNILCHANDRAN

NO 95I 24 TH MAIN RDAD MARENAHALLI J P NAGARA 2 ND PHASE BANGALORE PIN CODE:


560078, STD CODE: NA , TEL NO: 51214003, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3449

KANTHI SNEETS

BRIGED ROAD BANGALORE ,


NA, E-MAIL : N.A.

NA

10 - 50

3450

***

NA

10 - 50

3451

FAR MALL

CRESEN ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3452

KASHMIR CO AGE EMPORIUM

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3453

LA BLUE BUGS SHOP

RRIGADE ROAD ANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3454

NILGIRIS SUPER MARKE

RRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3455

FIFTH AVENUE SHOPPING

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3456

SHIVANANDA GENERAL STORES

SHIVANANDA COMPLEX KUMARA KRUPA EAS BANGALORE PIN CODE: 560001, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

BANGALORE SWEETS DASAPPA BUILDING DR CM MAIN ROAD BANGALORE PIN CODE:


560053, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO:

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

257

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

3457

ARVINIL MIYA

3458

SKGUPTHA

DISTRICT : Bangalore

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

#6 SNS PLAZA KUMARA KRUPA ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL
NO: 22207761, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO10/PAIACEROAD NARAYANACOMPLEX VASANTHANAGARA BANGALORE 56OO52 PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

CMH ROAD NDIRANAGAR ST STAGE BANGALORE PIN CODE: 560038, STD CODE: NA , TEL
NO: 51152754, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3459

MOHAMAD MKRETAIL

3460

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3461

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3462

MAHALASADARSHAN

HMTMAINROAD BANGALORE PIN CODE: 560013, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3463

***

NOSL PORTOF PELSNION BAR RESTEREN AANDHINAGAR BA GALORE PIN CODE: 560009, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3464

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3465

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3466

BOSCO MANE

NO ZAZ ATH MAIN CHAMRAJPET BANGALORE PIN CODE: 560018, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3467

JASWATH KUMAR

I4 8 H CROSS CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22213161, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3468

R R ENTERPRIZES

NO 52 H M S COMPLEX CUBBON PET BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3469

***

NO IIOI/ OTC ROAD BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

3470

***

NA

10 - 50

3471

FABMALL SUPERMARKE

NA

10 - 50

3472

***

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

# 294, OO F RINGROAD, BSK 3 STAGE BANGALORE PIN CODE: 560085, STD CODE: 080, TEL
NO: 26694788, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

258

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

3473

HERITAGE MILK

3474

***

3475

***

3476

***

3477

NARAYANREDDY M C RADERS
COUNTRYCLUBROAD

BANGALORE ,

3478

FOOD NET SUPER MARKE NO 1O58

SOBHA ARCADE VIJAYA BANK COLONY DEVARACHIKKANAHALL ROAD BANGALORE PIN


CODE: 560076, STD CODE: NA , TEL NO: 51305601, FAX NO: NA, E-MAIL : N.A.

3479

***

3480

***

3481

SRINIVASA ENTERPRISES
DDY

3482

***

3483

Employment
Class

(5)

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

SOURTHIENTERPRISES

N015NEXTTDVIJAYALAKSHMIKALAYANAMANTAP VISHNANEEDAMPOSTBANGALORE PIN


CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3484

VINAYAKA NDUSTRIAL ENTERPRISFS

DFVASANDRA NDUSTRIAL ARLA MANKDEVARURA POST SINGHYANAPALYA BANMALORE


PIN CODE: 560047, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3485

HANSH ENTERPRLSES

DEVASANDRA NDUSTRIAL ESTATE MAMADEJAPURA POS STNGHYANAPALYA PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3486

TRISHIES ENTERPRISES

DEVASANDRA NDUSTRIES MAHEDEVAPURA POSF SINGHYANAPALYA BANGALORE PIN


CODE: 560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3487

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3488

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

NO540/1GM COMPLEX 9THCROSS JAYANAGAR 7TH BLOCK WEST OF KANAKAPURA ROAD


BANGALORE PIN CODE: 560082, STD CODE: NA , TEL NO: 26763300, FAX NO: NA, E-MAIL :
N.A.

S NAGAR

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NEARHMTINDUSTRIALESTATEBEHINOSDAHIGHSCHOO KAMMANGONDANAHALLIJALAHALLIWES
BANGALORE PIN CODE: 560015, STD CODE: 28387, TEL NO: 47, FAX NO: 28388572, E-MAIL :
N.A.
,

259

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

3489

THRIMULA DHABHA

3490

***

3491

BHUWALKA GROUP OF COMPANILS

3492

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

NA

10 - 50

NA

10 - 50

NO 7 RESIDENCY RDAD 3CRROSS BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO:
25599797, FAX NO: 25596030, E-MAIL : N.A.

1992

51 - 100

SHASHIDHAR

SHASHI NDUSTRIES 3CROSS RAJAJINAGARA BANGALORE PIN CODE: 560010, STD CODE:
1080, TEL NO: 22300154, FAX NO: NA, E-MAIL : N.A.

1997

51 - 100

3493

ANILKUMAR

NO138/3 MUNIVENKATAPPA GARDEN N S PALYA BANNERGHATTAROAD BANGALORE PIN


CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

51 - 100

3494

CHANDRA SHEKAR GOLDEN PRAVJSION


CENTRE

8 BLOCK KORAMANGALA BANGALORE PIN CODE: 560095, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2000

51 - 100

3495

FOOD WORLD

NO 4I4 4TH MAIN 3 BLOCK HRBR LAYOU BANGALORE PIN CODE: 560043, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3496

SIRAGO ENTERPRISES

DEVASENDRA NDUSTRIES ESTATE SINGHYRNAPAL YA MAHADENAPURA POST PIN CODE:


560049, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3497

JO ENTERPRISES

DEVASANDRA NDUSTRIAL AREA WHIEFIELDROAD MEHADEVAPURA POS PIN CODE: 560048,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

51 - 100

3498

MANAGER

KHODAY BUILDING SHESHADR ROAD BANGALORE PIN CODE: 560009, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1982

101 - 500

3499

NEEKAGIR DAIRY PRODUCTS

NO 748 RESIDENCY ROAD 3 CROSS BANGALORE PIN CODE: 560025, STD CODE: 080, TEL NO:
25597077, FAX NO: NA, E-MAIL : N.A.

1985

101 - 500

3500

COTHAS COFFEE COMPANY NO 4 JP


MASAA

3RD PHASE ISTUMAIN BANSALORE ,


65864841, FAX NO: NA, E-MAIL : N.A.

1990

101 - 500

3501

FOOD WORLD SUPERMARKETS LTD

74O EASWAR INDUSTRIAL ESTATE GATE NO 2 HULIMAVU BANNERGHA A ROAD PIN CODE:
560076, STD CODE: 080, TEL NO: 51109702, FAX NO: 51109710, E-MAIL : N.A.

1996

101 - 500

3502

H A L GRINDINGMILL

NOIB4AZIZSAITJNDUSTRIALTOWN NAYNDAHALL MYSOREROAD BANGALDRE PIN CODE:


560039, STD CODE: 1, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

101 - 500

BALARAJ THRIMULAPPA NAGAR ATTUR ZMD STAHE ,


TEL NO: 28460109, FAX NO: NA, E-MAIL : N.A.
,

PIN CODE: 560064, STD CODE: NA ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

PIN CODE: 560078, STD CODE: NA , TEL NO:

260

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1998

(5)
101 - 500

NUMBER 363 FIRST MAIN 7TH BLOCK KORAMANGALA BANGALORE PIN CODE: 560095, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

DHARAN PRECISION

58/59 DORESANIPALYAIBILEKAHALL BANNERGA A ROAD BANGALORE PIN CODE: 560076,


STD CODE: NA , TEL NO: 51507435, FAX NO: NA, E-MAIL : N.A.

2005

101 - 500

3506

GOVT FAIR PRICE SHOP

SR NAGAR BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

101 - 500

3507

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3508

SALOGANESH

A82 8O FEE ROAD H M LAYOU R NAGARA BANQALORE PIN CODE: 560032, STD CODE:
080, TEL NO: 23577157, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3509

KARNATAKA TEXSPERE KTSPL

NO 22 PEENVA NDUSTRIAL ESTATE 2 PHASE BANGALORE NORTH PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3510

2 SHRINIVASA

SURESWARA ENTERPRISES PV LTD NO229/5 HCR OSS OEVACHIKKANAHALL ROAD


BOMMANAHALL PIN CODE: NA , STD CODE: NA , TEL NO: 51110447, FAX NO: NA, E-MAIL : N.A.

2000

> 500

3511

SHIZPA ENTERPRISES

NO C_B & H B KSSIDC Y N K NEWTOWN BANGALBRE PIN CODE: 560064, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

> 500

3512

TURBO INDIA

NO52 S4IAOFEETROAD SUNKADAKA E BANGALORE 9I PIN CODE: 560091, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

3503

SRINATH COTHAS COFFEE NO 5 JP


NAGAR

3RDPHASE STMAIN BANGALORE ,


FAX NO: NA, E-MAIL : N.A.

3504

KANNADA CE CREEM DRIVATEILIMITED

3505

PIN CODE: 560070, STD CODE: NA , TEL NO: 6586484,

NIC 2004 : 5231-Retail sale of pharmaceutical and medical goods, cosmetic and toilet articles
3513

MICRO LABS LTD ADMINISTRATION


DEPARTMENT

QUEENS CORNER APARTMENTS NO 3 QUEENS ROAD BANGALORE PIN CODE: 560001, STD
CODE: NA , TEL NO: 22269609, FAX NO: NA, E-MAIL : N.A.

1971

10 - 50

3514

DOCTOR P NAVEEN

SIGMA HOIS COMPANY PTPE LINE CIRCLE VISHWANEEDAM POS SUNKADAKATTE BANGALORF
PIN CODE: 560091, STD CODE: 23285, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

3515

GLDBAL CALCIUM P LTD

74I 6TH B CROSS 3RD BLOCK KORMANGALA BANGALORE PIN CODE: 560034, STD CODE: NA
, TEL NO: 25530831, FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3516

VINTAC PRIVATE LIMITED


DISTRIBUTORS

I64/1O RESORVOIR STREE BASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

261

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3517

KAJSERSPOOLS PVT LTD NO 53


KOTTIGEPALYA

MAGADI ROAD BANGALORE ,


PIN CODE: 560079, STD CODE: 91080, TEL NO: 23483773,
FAX NO: 23481116, E-MAIL : N.A.

1990

10 - 50

3518

NS SURYAPRAKASH

NO8 HOSUR ROAD BOMNANAHALL BANGALORE PIN CODE: 560068, STD CODE: NA , TEL NO:
25635616, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3519

NASRIN, NO 2558, MIG, 1ST MAIN ROAD

YELAHANKA NEW TOWN BANGALORE NORTH PIN CODE: 560064, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3520

BIO MEDICA KAMALNIVAS 9 CROSS

ANDRAHALLI MAINROAD BANGALORE PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1997

10 - 50

3521

AYARVEDIFARMACY

HAL 2 STAGE 12 CROSS ROAD INDIRANAGARA BANGALORE PIN CODE: NA , STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3522

NIKAN TELETRAK PRIVATE LIMITED

TELETRAK COMPLEX CHELKERE RING ROAD BANASWAD POST BANGALORE PIN CODE:
560043, STD CODE: NA , TEL NO: 25444451, FAX NO: 25442167, E-MAIL : N.A.

1998

10 - 50

3523

BRITISH BIOHOGICALS THE PROTEIN


PEOPLE

MARKETING DIVISION JAYANAGAR 127 ELEPHANT ROCK ROAD 3RDBLOCK BANGALORE PIN
CODE: 56011, STD CODE: NA , TEL NO: 26635242, FAX NO: 26632414, E-MAIL : N.A.

1999

10 - 50

3524

FORE RANSCRIPTIONS REHAN SHAIK

93 WHEELERS ROAD COX OWN BANGALORE PIN CODE: 560005, STD CODE: NA , TEL NO:
25482976, FAX NO: 25482945, E-MAIL : N.A.

2000

10 - 50

3525

PROPRETOR NANJUNDESWARA
POLYMARS PRODUCT

P&T COLONY CHOLUR PALYA BANGALORE ,


NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3526

R P G GUARDIAN PRIVA LIMITED


PRABHAKAR

G KORAMANGALANINDUSTRIAL/LAYOU BANGALORE PIN CODE: 560095, STD CODE: 51104,


TEL NO: 40 5, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3527

KESHAV ANJUPHYTOCHEMICHLS PV
LTD

SINGASANDRA HOSURMAINROAD BANGALORE ,


NO: 05731527, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3528

SUNPHARAMA

UNIMEDTECHNOLGIES NO200 TF5208 YELAHANKA NEWTOWN BANGALORE PIN CODE: 560065,


STD CODE: NA , TEL NO: 28566836, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3529

GODREJ HICARE CHEMICAL HAIRDYE


AGENCY

7TH CROSS MALLESHWARAM BANGALORE KARNATAKA PIN CODE: 560003, STD CODE: NA ,
TEL NO: 23449031, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3530

SONA AUDIO SYSTEM

NOI8 AZIZSAIT NDUSTRIAL TOWN NAYNDAHALL MYSORE ROAD BANGALORE PIN CODE:
560039, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

PIN CODE: 560023, STD CODE: NA , TEL NO:

PIN CODE: 560068, STD CODE: NA , TEL

262

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3531

MEDICAL TRANSCRIPTION COMPANY

NO14/6 3CROSS 2MAIN ROAD NANJAPPA LAYOUT ADUGOD BANGALORE PIN CODE: 560030,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3532

APOLLO PHARMA STORE

NO297 I5 CROSS 14 MAIN S PHASE JP NAGAR BANGALORE PIN CODE: 560078, STD CODE: NA
, TEL NO: 51210599, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3533

SHREE MARUTH MEDICALS MARUTHI


BUINDIG

SERCICE ROAD REMCO LAYOU VIJAYANAGARA BANGARORE PIN CODE: 560040, STD CODE:
080, TEL NO: 23301807, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3534

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3535

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3536

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3537

ASTRE MEDISTO PRIVATE LTMITED

NO 83/4-I25 DODDMA LAYOU HULIMAVU B G ROAD BANGALORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3538

RAJANNA

CLINIC NTEAL MEDICAL SYSTEM MAGAD MAIN ROAD VISHWANEEDAM POST SUNKADAKA E
BANGA PIN CODE: 560091, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3539

SHANKARANARAYAN

PANTHARAPALYA NAYANDAHALLI MYSORE ROAD BANGALORE 39 PIN CODE: 560039, STD


CODE: NA , TEL NO: 22805041, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3540

HEALTH AND GLOW PRIVATE COMPANY


LIMITED

NO 950 24TH MAIN ROAD MARENAHALL J P NAGARA 2ND PHASE BANGALORE PIN CODE:
560078, STD CODE: NA , TEL NO: 51214002, FAX NO: NA, E-MAIL : N.A.

2004

51 - 100

NA

51 - 100

1985

101 - 500

NA

101 - 500

3541

SHALAYSSHREE

NOS LAKSHMINARAYANACOMPLEX 11PALACEROADVASANTHANAGAR BANGALORE 5Z PIN


CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3542

VARDHAMAN PHARMA AND PILLS AND


POWDER

NO 3 LALBAGH GATE KH CIRCLE BANGALORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

3543

LIDKAR LETHEREMPORIAM

KARIYAPDA ROAD BANGALORE ,


NO: NA, E-MAIL : N.A.

3544

LOREAL NDIA P LTD COSMETIC GOODS


SALES

4/6MILLAR,S ROAD BANGALORE PIN CODE: 560052, STD CODE: NA , TEL NO: 22383697, FAX
NO: NA, E-MAIL : N.A.

1987

> 500

3545

MAHENDRAVP TES

SYNDICATEBANKCOLONY BANNERUGHA AROAD ARAKERE BANGALORE 76 PIN CODE: NA ,


STD CODE: NA , TEL NO: 65871201, FAX NO: NA, E-MAIL : N.A.

2000

> 500

PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX

263

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

NIC 2004 : 5232-Retail sale of textiles, clothing, footwear and leather goods
3546

KIDSKEMP

MGROAD BANGALORE PIN CODE: 1, STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

3547

SHOW OFF

452 RAJMANSION 22 CROSS 3 BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD
CODE: NA , TEL NO: 26650379, FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

3548

THA THA GARMENTS

NEHRU STREET 3MAIN UDAYANAGAR BANGALORE 16 PIN CODE: 560016, STD CODE: NA , TEL
NO: 28518403, FAX NO: NA, E-MAIL : N.A.

1991

10 - 50

3549

THE TEXTILE CO OP SOCIETY LTD

DEVANRA MARKET JUMMA MASJID ROAD AVENUE ROAD BANGALORE PIN CODE: 560002, STD
CODE: 00080, TEL NO: 22217905, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3550

LIFE STYLE

VICRORIA ROAD RICHNOND CIRCLE BANGALORE PIN CODE: 560047, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3551

HARSHITA NFEX

#47 4 MAIN 3 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3552

VISWAS EXTAIL

NO59 METRO FACTRY NAYANDAHALLI MYSORE ROAD BANGALORE PIN CODE: 560039, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3553

M M P SHIVIM

NOIAUTHORISED DEALERA SHOWROOM A GOVT KARNATAK PIN CODE: 560002, STD CODE:
080, TEL NO: 22239983, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3554

REEBOK MEGA STORE WAZEER

#2016 100F ROAD HAL2STAGE NDIRANAGAR BANGALORE PIN CODE: 560008, STD CODE: NA
, TEL NO: 51521295, FAX NO: 51521294, E-MAIL : N.A.

1996

10 - 50

3555

MOHAN LAL NO11 COMMERCIAL STREE

PRIENT ROAD SHIVAJ NAGAR BANGALORE 56000 PIN CODE: 111, STD CODE: NA , TEL NO:
25580343, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3556

JOHANSON MANAGER NO120 MAIN


STREET

SHIVAJINAGAR BANGALORE 560001 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
45549545, E-MAIL : N.A.

1996

10 - 50

3557

J K FABRLCS EXPORT

NO 28/1 25TH CROSS SANJEEVAPPA LANE CUBBONPE BANGALORE PIN CODE: 560002, STD
CODE: 00080, TEL NO: 22480101, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3558

KRUSHANA MANHGER N0TE

COMMERITAL STREE BANGALORE 5GOOOI PIN CODE: NA , STD CODE: NA , TEL NO: 25550869,
FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

264

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
1997

(5)
10 - 50

NO2342 MANIVILAS GARDEN KAMALANAGAR BEML LAYOU BANGALORE 79 PIN CODE:


560079, STD CODE: NA , TEL NO: 23480956, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

CHESLIND EXTILES

NO 8 8TH MAIN 4TH BLOCK KORAMANGALA BANGALORE 34 PIN CODE: 560034, STD CODE:
NA , TEL NO: 25538622, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3562

BANGALORE SMIRTS COMPANY PRIVATE


LIMITED

NO12A 6MAIN3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3563

SUBHASH SAREES

NOKB ANJANEYA TEMPLE STREE CHICKPET BANGALORE PIN CODE: 560002, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3564

CO OPTEX HANDLOOMS

NO 138 GOVINDAPPA ROAD BASAVANAGUD BANGALORE PIN CODE: 500004, STD CODE: NA
, TEL NO: 65250006, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3565

MUNIESHWARAENTERPRISESGARMEN

NO471S FIOORMUNIESHWARATEMPLE VITTALNAGAR BANGALORE PIN CODE: 560026, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3566

TERTILE SHOP

153 OLD MADRS ROAD


D ULSOOR BANGALORE PIN CODE: 560008, STD CODE: NA ,
TEL NO: 25544933, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3567

INDREJH N04T COMMERCIBL STREE

SHIXDINAGAR BANGALORETGOO01 PIN CODE: NA , STD CODE: NA , TEL NO: 25583882, FAX
NO: NA, E-MAIL : N.A.

2000

10 - 50

3568

RAJZNIBOPAZAH

AACHNATEXTILEPRINTERSI IGBEGURROADKO ZCHIRKANAHALLIBANGALORE PIN CODE:


560068, STD CODE: 67324, TEL NO: 6311, FAX NO: 1, E-MAIL : N.A.

2000

10 - 50

3569

VIJAYALAKSHM SILK CENTRE

ADC COMPLEX JUMMA MAAJID ROAD AVENUE ROAD CROSS BANGALORE PIN CODE: 560002,
STD CODE: 00080, TEL NO: 22124807, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3570

ABHUSHAN APPARELS TERMINALIF

178/5 8 MAIN 3 BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO:
26539180, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3571

MONDAY O SUNDAY

CMH ROAD NDIRANAGAR ST STAGE BANGALORE PIN CODE: 560038, STD CODE: NA , TEL
NO: 25201164, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3572

INFOMARK MARKETING PRIVATE LIMITED

NO 323 2CROSS 2BLOCK R M V 2 STAGE BANGALORE PIN CODE: 560090, STD CODE: NA , TEL
NO: 23410377, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3559

Y-C.CHANDRASHEKAR

NO. 567, SUMANGAL SEVASHRAM ROAD, BANGALORE PIN CODE: 560032, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3560

SATISH KUMAR

3561

265

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
2001

(5)
10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :

2001

10 - 50

LISA APERELS GARMENTS NO

NO-83/4/1O DODDAAMMA DEVASTHANA HULIMAVU B G ROAD BANGLORE PIN CODE: 560076,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3576

VENKATESHWARA CLOTHING CO

ND C K H B KSSIDC YELAHANKA NEWTOWN BANGALORE PIN CODE: 560064, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3577

MY TEXTZLES PRTVATE LIMITED

#I9ZXIMAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28393592, FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3578

TEXPOR GARMENTS

#82/1 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

10 - 50

3579

ANGADIISILKS

514/39 4G CROSS S BLOCK JAYANAGAR BANGALORE PIN CODE: 560041, STD CODE: NA ,
TEL NO: 26638034, FAX NO: 26653256, E-MAIL : N.A.

2002

10 - 50

3580

ANGADI SILKS

514/89 46TH CROSS 5TH MAIN JAYANAGAR BANGALORE PIN CODE: 560041, STD CODE: NA ,
TEL NO: 26638034, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3581

TEX STYLES NTERNATIONAL UNIT-3 NO


9212

MUNIREDDY LAYOUT YELLUKUNTE HOSUR ROAD MANGAMMANAPALYA BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3582

SPICE ISLAND APPARELS LIMITED

193 B11MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28370562, FAX NO: NA, E-MAIL : N.A.

2002

10 - 50

3583

KGNIPASTIONS

IR SGARDEN R SS LAL MAGH OAD B LORE PIN CODE: 560027, STD CODE: NA , TEL NO: NA
, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3584

FAUVOURATE SHOP

NUJ8Z SANDEEP COMPLEX 11THMAIN 22ND CROSS 3RDBLOCK JAYANAGAR BANGALORE PIN
CODE: NA , STD CODE: NA , TEL NO: 51239837, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3585

WERNER FINLEY PV LIMITED


CAVVERXNAGAR

NO9SWAYAMPRABHAIKALYANAMANTAN ROAD KAMAA IPALYA MAGAD MAIN ROAD PIN


CODE: 560079, STD CODE: NA , TEL NO: 23288369, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3586

***

NESS CLOTHING N17 SECONO CROSS KODICHIKKA NAHALL ROAD BHALL BLORE 68 PIN
CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3573

MEGHA MALT SHOW ROOM

NWMBER 14 BDFEE RQAD KORAMANGALA BANGALORE PIN CODE: 560095, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3574

GARMENTS FACTORY
GHARVEBHAVIPALYA HOSUR

ROAD BANGALORE-68 ,
N.A.

3575

266

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3587

M/S GITANJAL LIFESTYLE PRODUCTS


PVT LTD

394/7 GATE NO 2 ESHWAR INDUSTRIAL ESTATE HULIMAVU BANNERGHA A ROAD BANGALORE


76 PIN CODE: 560076, STD CODE: 00080, TEL NO: 51305657, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3588

MEMORYFASHION KALANAGAR
KALATHEATRE

KAMMAGONDANAHALL BANGALORE PIN CODE: 560015, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

2003

10 - 50

3589

AWESOME SPORTSWEAR

#I1B 9MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 28293551, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3590

M/S SUNITHA IMPEX PV LTD

NO/93/3 OUTER RING ROAD MULTIPLEX THEATRE MARATHAHALLI BANGALORE PIN CODE:
560037, STD CODE: NA , TEL NO: 56969851, FAX NO: NA, E-MAIL : N.A.

2003

10 - 50

3591

MEGA MAR

JAYANAGAR SV ARCADE NO 1355-1358-25SOUTH END MAIN ROAD 9BLOCK JAYANAGAR


BANGALORE PIN CODE: 560069, STD CODE: NA , TEL NO: 22973153, FAX NO: NA, E-MAIL :
N.A.

2004

10 - 50

3592

ROOP SANGAM KIDS &LADIES WEAR NO


69/9 11

TH MAIN 29TH A CROSS 4TH BLOCK JAYANAGAR BANAGALORE PIN CODE: 560011, STD
CODE: NA , TEL NO: 51211278, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3593

PRAKASH RICHCHAR BOMBAY HOUSE

CMHROAD INDIRANAGAR BANGALORE ,


51113377, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3594

STYLE CRAF APPARELS

#92 93 7MAIN 2PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: 56748050, FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3595

SONAL GARMENTS UNI 4

#163 10MAIN 3HASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2004

10 - 50

3596

SIDDIQU

HEBBAL BANGALORE NORTH BANGALORE PIN CODE: 560024, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3597

M G BROTHERS GARMENTS
MUNIREDDY LAYOUT

OLD MANGAMMANAPALYA ROAD MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3598

A S CLOTHING

NO-I5/I6 THMAIN RAJAGOPAL NAGAR OPPISHWA RATEMPLE PEENYAZNDSTAGE BANGALORE


PIN CODE: 560058, STD CODE: 08094, TEL NO: 48222092, FAX NO: NA, E-MAIL : N.A.

2005

10 - 50

3599

NAGARAJ MA CHAITANYA
CREATIONSI89 MAIN

BEGURROADCROSSBEHINDALPINEAPTS BOMMANAHALLI BANGALORE 68 PIN CODE: 560068,


STD CODE: 56962, TEL NO: 650, FAX NO: NA, E-MAIL : N.A.

2009

10 - 50

PIN CODE: 560038, STD CODE: NA , TEL NO:

267

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3605

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3606

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3607

JAI SHANKAR SAREES PALACE

VASAVI EMPLE STREET BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

3608

RADHA RAMAN ANGADISIIKKS 514 39 46


CROSS

5TH BLOCK JAYANAGI BANGALORE PIN CODE: 560041, STD CODE: 00080, TEL NO: 26638034,
FAX NO: 26653256, E-MAIL : N.A.

NA

10 - 50

3609

LIFE STYLE

VICTORIA ROAO BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3610

***

NA

10 - 50

3611

VAN HEUSEN PARK AVENUE

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3612

COOL COTTONS

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3613

WILLS LIFE STYLE FAHION

M G ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3614

ASWAN LIFE STYLE

BRIGADE ROAD BANGALDRE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3615

BRIGADES GARMENTS

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3600

SAGAR AUTOMOBILE

3601

***

3602

***

3603

***

3604

MODI HOSPITAL ROAD RAJAJINAGAR PIN CODE: 560010, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

268

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

3616

VACALE EXPORTS SERVICE GARMENTS

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

3617

FINCH SOFTWEAR NDIA LTD

3618

ADCDAS

3619

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

CHURCH STREE BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

INTEGER SOFT WEAR SOCUTITN

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3620

SCULLERS SHIRTJ

BRIGADE RDAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3621

GOPURAM HAND CRAF

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3622

PROVOGUE SHIRTS

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3623

DESYGNER CASUAL WEAR

FRESEN ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3624

SADAWANI SAREES

M G ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3625

SF THESANFRANG SCO JEANS CO

BRIGADE BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

3626

PROSPERO FASHION

M G ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3627

VALENTINE FASHION

BRIGADE ROAD BANGALOREI PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3628

COTTON PLANE

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3629

THE GAZZAZ

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

269

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

(2)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

BRIGADE ROAD BANGALORE PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

WOOD LAND

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3633

GEETHA EXPORTS

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3634

VIJAYALAKSHM SAREES

BIGROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

3635

WONDER LAND

M G ROOD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3636

DEEPAM SILKS

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3637

NATIONAL EXTILE

M ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL :
N.A.

NA

10 - 50

3638

THE WEAR HOUSE

BRIGADE ROAD BANGALORE PIN CODE: 560001, STD CODE: 1, TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3639

KSIC SHOWROOY

BANGALORE M G ROAD PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3640

ASHOK SILK

M G RDAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3641

SHANTALA SILK HOUSE

M G ROAD BANGALORK PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3642

BINNY SHOW ROOM

RESIDENCYIROAD BANGALORE PIN CODE: 560021, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3643

RATHANIJDEEKP GARD

M G ROAD BAMGALOREI PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3630

ZODIAC SHIRTS

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

3631

TODAYS BAZZAR GARMENTS

3632

270

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
NA

(5)
10 - 50

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

CROCODILE RAYRU APPARELS

M E ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3647

KARNATAKA SILK NDUSTRY

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3648

KALPATHARD

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3649

THE HANDLOOM HOUSE

BANGACORE RESIDENCY RDAD PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO: NA,
E-MAIL : N.A.

NA

10 - 50

3650

KARISHMA SILK SAREES

M G ROAD RANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3651

SHIVA MAHESHWARISILKS

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3652

NAVRANG TEXTILE

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3653

ALLEN SDLLY DRESS CENTRE

RESIDENCV ROAD BANGALORC PIN CODE: 560025, STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

NA

10 - 50

3654

CAUVERY SILK SAREES

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3655

MEGASILK UDYOG

M G ROAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

NA

10 - 50

3656

RATH SILKS PV LTD

BATARIA CHAMBERS ST FLOOR HIGN GROUNDS KUMARA KRUPA ROAD BANGALORE PIN
CODE: 560001, STD CODE: NA , TEL NO: 22267808, FAX NO: 22257601, E-MAIL : N.A.

NA

10 - 50

3657

***

NA

10 - 50

3658

HEERAZ EMPEX

NA

10 - 50

3644

DOLPAIN KIDS WEAR

M G RUAD BANGALORE PIN CODE: 560001, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

3645

TWINKLE SHIRTS

3646

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

KAREKALLU KAMAKSHIPALYA B HGALO/E PIN CODE: 560079, STD CODE: NA , TEL NO: NA ,
FAX NO: NA, E-MAIL : N.A.

271

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

(4)

Employment
Class

(5)

3659

ANURAG SHOW ROOM

NOI 5TH MAIN ROAD CHAMRAJPET BANGALORE PIN CODE: 560018, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3660

G S SUBRAMANIYAPPA

#25 8 TH CROSS CUBBON PE BANGALORE PIN CODE: 560002, STD CODE: NA , TEL NO:
22224456, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3661

MEGHDOOT EXTILES PV LTD

NO 9 GANIGARA A LANE NAGARTHPE CROSS BANGALORE PIN CODE: 560002, STD CODE: NA
, TEL NO: 22243620, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3662

MAHALAKSHM SILK HEAVING FACTORY

NO IZ GANIGARA A LANE SUNKALPE CROSS BANGALORE 56OOO2 PIN CODE: 560002, STD
CODE: NA , TEL NO: 22212987, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3663

SOWDARYA SILK SUPPLIERS

NO 3 GANIGARA C LANE CUBBON PET BANGALORE - Z PIN CODE: 560002, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3664

***

NA

10 - 50

3665

PANCHRVATI DESIGNS

NYANAPPANAHALL MAIN ROAD DEVARACHIKKANAHALL BANGALORE PIN CODE: 560076,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3666

ALPHA GARMEN

NO 55/56 7TH CROSS PAI LAYOU HULIMAVU D B G ROAD BANGLORE PIN CODE: 560076, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3667

MOHANDHAS

S9IZ CHOKKASANDRA MAINROCD DASARAHAZL BANGALORE SGOO5T PIN CODE: 560057,


STD CODE: NA , TEL NO: 23729405, FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3668

HANUMANTRAJU

162 CHOKKASANDAA MAIN ROAD D BANGALORE 56OO57 PIN CODE: 560057, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3669

APPOLO ENGLISH SCHOOL PREMA

OZ MAINROAD GAJANANANAGARA HEGGANAMALLICROSS BANGALORE PIN CODE: 560091,


STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

10 - 50

3670

SATH NARRXAN JANARDHANA

NO5I SILLK HOUSE UNITEED BUILDING CALLING ROAD BANGLORE 27 PIN CODE: 560027, STD
CODE: 080, TEL NO: 22237826, FAX NO: 27237826, E-MAIL : N.A.

1972

51 - 100

3671

METROSTYLE

NO 2008 100 FEET ROAD INDIRANAGAR BANGALORE PIN CODE: 560008, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1972

51 - 100

3672

VIJAYA SEEMLESS CONIAINER PRIVATE


LIMIICD

189 9MAIN 3PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 28395203, FAX NO: NA, E-MAIL : N.A.

1985

51 - 100

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

272

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1997

(5)
51 - 100

1998

51 - 100

RINGROAD AGARA 34 BANGALORE 34 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO:
NA, E-MAIL : N.A.

1998

51 - 100

K R NAVEEN KUMAR

CHAITANYA FABRICS NO WEST OF CHORD ROAD RAJAJINAGAR BANGALORE PIN CODE:


560044, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2002

51 - 100

HAREEHAHUJA GARMENT
MANUFACTURING

SHAH EXPORT HOUSE 37/1B 43/2 43/3 ARAKERE BANNERUGATTA ROAD BANGALORE PIN
CODE: 560076, STD CODE: 00080, TEL NO: 26583371, FAX NO: NA, E-MAIL : N.A.

2002

51 - 100

MOIN COMMRICIAL OPP NANDITOYATA GRVEBHVE PALYA HOSUR ROAD BAGALORE PIN
CODE: 560068, STD CODE: NA , TEL NO: 56649250, FAX NO: NA, E-MAIL : N.A.

2004

51 - 100

NO 5 72 MAHADESHWERA LAYOU CHOLANAYAKANAHALLI R NAGARA PO BANGALOR PIN


CODE: 560032, STD CODE: NA , TEL NO: 23338837, FAX NO: NA, E-MAIL : N.A.

2005

51 - 100

NA

51 - 100

NA

51 - 100

3673

FAREAS FASHION GEAR 38/3 LAXM


INDUSTRIA

L COMPLEX HOSUR MAIN ROAD HONGASANDRA VILLAGEGARVEDHAVIPALYA BANGALORE 68


PIN CODE: 560068, STD CODE: NA , TEL NO: 25733678, FAX NO: NA, E-MAIL : N.A.

3674

VIJAY #80 SHOLLE PADARA INDUSTRIAL


ESTATE

MAGADI MAIN ROAD KAMAKGHIPALYA BANGALORE ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3675

SHEIMOR GARMENTS

3676

3677

3678

FOOD BAZAR NO56 17

PIN CODE: 560079, STD CODE: NA ,

3679

LIZO FASHION GARMENTS

3680

***

3681

N N PRAKASH

COMPUTECH STTCHES &FASHION GARWEBHAVI PALYA HOSORE MAIN ROAD BANGLOR PIN
CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

3682

K R M INTERNATIONAL LIMITED

NO 9 B PEENYA INDUSIRIAL AREA BANGALORE 58 PIN CODE: 560058, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1983

101 - 500

3683

GARMENTS FACTORY KUDLU HOSUR


ROAD BANGALO

RE-6B ,

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

101 - 500

3684

***

KEMPOR AIRPOR ROAD BANGALORE PIN CODE: 560017, STD CODE: NA , TEL NO: NA , FAX
NO: NA, E-MAIL : N.A.

1995

101 - 500

3685

COLORLINES NC

RAJAPALYA WHITEFIELD MAIN ROAOMADEPURA PO BANGALORE SOUTH OISTRICT PIN CODE:


560048, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

101 - 500

3686

RBADY MADE GARMENTS

AGARA SARJAPURA ROAD PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL
: N.A.

1996

101 - 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

273

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

DISTRICT : Bangalore

Name of Establishment

(1)

Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)
1999

(5)
101 - 500

25O2 8F MAIN 3 BLOCK JAYANAGAR BANGALORE PIN CODE: 560011, STD CODE: NA , TEL
NO: 26641931, FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

SRI MYLARA CLOTHING COMPANY


OPPOSITE

MUNIYAPPA COMPLEX MUNIREDDY LAYOUT MANGAMMANAPALYA BANSALORE PIN CODE:


560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

3690

PRETIK GARMENT FACTORY KUDLU


HOSUR ROAD

BANGALORE 68 ,

2000

101 - 500

3691

DESIGN CREATIONS

58 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

101 - 500

3692

CLASSIC SILK CREAIIONS JOIA


MUNIREDDY LAY

OUT MANGAMMANAPALYA BOMMANAHALLI BANGALORE PIN CODE: 560068, STD CODE: NA ,


TEL NO: 25730704, FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

3693

GARDEN CITY CLOTHING

57/ A 2CROSS 3 PHASE PEENYA INDUSTRIAL BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: 28371832, FAX NO: NA, E-MAIL : N.A.

2003

101 - 500

3694

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3695

***

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3696

MARUTH GARMENTS KUNACAHALLI


MAIN ROAD

DODDANEKUNDI ROAD MAHADEVAPURA POST BANGALORE PIN CODE: 560048, STD CODE:
NA , TEL NO: 28524009, FAX NO: NA, E-MAIL : N.A.

NA

101 - 500

3697

GARMENTS PACTORY
GHARUEBHAVIPALYA HOSUR

ROAD BRNGALORE-GB ,
: N.A.

3698

COLORLINESINC

3699

3687

CHANDRASHEKAR MANEGER

S A EXPORTS ARAKERE BANNERUGHA A ROAD BANGALORE PIN CODE: 560076, STD CODE:
NA , TEL NO: 55347465, FAX NO: NA, E-MAIL : N.A.

3688

DUGGARS PODNAM

3689

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

> 500

8TH MILE HODDY VILLAGE WHITEFIELD ROAD MAHADEVPURA BANGALORE PIN CODE: 560048,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1993

> 500

GARMENTS FACTORY KUDLU HOSUR


ROAD

BANGALORE ,

PIN CODE: 560068, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

> 500

3700

K MOHAN AND CO EXPORTS PRIVATE


LIMITED

NO 394/2 GATE NO 2 ESHWARI NDUSTRIAL ESTATE HOLIMAVU B G ROAD BANGALORE 560076


PIN CODE: 560076, STD CODE: 080, TEL NO: 26583314, FAX NO: 26583317, E-MAIL : N.A.

1994

> 500

3701

GARMEN FACTORY KUDLU HOSUR


ROAD BANGALOR

E_68 ,

1996

> 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

274

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3702

BIRDYFASHION PVT LTD

224, 2ND CROSS, 2ND STAGE, 40TH MAIN BTMLAYOV BANGALORE PIN CODE: 560068, STD
CODE: NA , TEL NO: 26680901, FAX NO: NA, E-MAIL : N.A.

1998

> 500

3703

MANJAPPA FABRITEXEXPORTS PVTLTD

MANIPALCOUNTRYCROSS ADTECENT O PE OFFICE SINGASANDRA HOSURROAD BANGALORE


PIN CODE: 560068, STD CODE: NA , TEL NO: 25730891, FAX NO: NA, E-MAIL : N.A.

2001

> 500

3704

MERINA CREATIONS

NO 25 3 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2001

> 500

3705

INTERNATIONAL CLOTHING COMPANY


KUDLU HOSU

R ROAD BANGALORE 68 ,
E-MAIL : N.A.

2003

> 500

3706

GOKUL DAAS EXPORTS

NO 24 PEENYA NDUSTRIAL ESTATE 2 PHASE BANGALORE NORTH N F ROAD PIN CODE:


560058, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

NA

> 500

PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA,

NIC 2004 : 5233-Retail sale of household appliances, articles and equipment


3707

HIICO TOOLS LIMITED

782PHASE PEENYAINDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL
NO: NA , FAX NO: NA, E-MAIL : N.A.

1964

10 - 50

3708

STANDARD ELECTRICALS LTD

5O4 5TH FLOOR A-WING QUEENS CORNER APTS 3 QUEENS ROAD BANGALORE PIN CODE:
560001, STD CODE: NA , TEL NO: 22207233, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3709

AIRTRON

NO 334 2NDFLOOR 41STCROSS 1STMAIN 8THBLOCK JAYANAGAR BANGALORE 560082 PIN


CODE: 560082, STD CODE: NA , TEL NO: 26633782, FAX NO: NA, E-MAIL : N.A.

1975

10 - 50

3710

FINE PLASTICS

53/1 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

3711

PARVVT WOOD PROCESSING


INDUSTRIES

28 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: 83952199, FAX NO: NA, E-MAIL : N.A.

1981

10 - 50

3712

SNS ELECTRIAL INDUSTRIES

3 PHASE PEENYA NDUSTRIAL AREA BANGALORE SB PIN CODE: NA , STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1982

10 - 50

3713

SHOE APPS122NEROSSRAJ MANSION


CROSS

JAYANAGAR BLOCK BANGALORE PIN CODE: 560011, STD CODE: NA , TEL NO: 26650379,
FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

3714

GUPTA ELECTRICAL FADRICATION

NO1S8 1MAIN 3PHASE PEENYA ITDUSTRIAL AREA BANGALORE S8 PIN CODE: NA , STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1985

10 - 50

275

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)
PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

Year of start of
Operation

Employment
Class

(4)

(5)

1986

10 - 50

3715

NO9 DHONDOSA COMPLEX RICHMOND


CIRCLE

BANGALORE ,

3716

MARUDHARINDUSIRIESPROPEIIRRRAJE
NDARKUMAR

ZTO BOMMANAHALLIBANGALORE PIN CODE: 560068, STD CODE: 25732, TEL NO: 01 2, FAX
NO: 1, E-MAIL : N.A.

1986

10 - 50

3717

V SWITCHGEAR AND RANSFORM PVT


LIMITED

433 4MAIN 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA
, TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1987

10 - 50

3718

PPLARINTERNATIONALLIMITED

NOZOIJRDMAIN5THCROSSCHAMARAJPE BANGALORE PIN CODE: 560018, STD CODE: NA , TEL


NO: NA , FAX NO: NA, E-MAIL : N.A.

1989

10 - 50

3719

R N A C INDIA LIMITED

NO 5 SARASWATH NIVAS APARTMENTS CHANAL ROAD HALASUR BANGALORE PIN CODE:


560008, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3720

TELEVISION SALES DEPOT

108 EFG BUILDING JC ROAD BANGALORE PIN CODE: 560002, STD CODE: 00080, TEL NO:
51149706, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3721

LIFE LINE SYSTEMS

NO 18 KAVERINAGAR KODICHICKNAHALLI ROAD BEGUR BOMMANAHALLI BANGALORE PIN


CODE: 560068, STD CODE: NA , TEL NO: 25732504, FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3722

SANKALA INDUSTRIES

UNIT 11 9-D 2 PHASE PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1990

10 - 50

3723

SRIDHAR MURTHY

NO65EATSTREE BASAVANGUD ,
NO: NA, E-MAIL : N.A.

PIN CODE: 560004, STD CODE: NA , TEL NO: NA , FAX

1991

10 - 50

3724

NAG ASSOCTATES DESIGN OF


ELECTRICAL CIRCU

IT L CONTROL PLANS 12-16 2ND CROSS 4TH CROSS NAGAPPA BLOCK PIN CODE: 560021,
STD CODE: NA , TEL NO: 23327210, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3725

CHANNA BASAVAIAH

JYOTHIS HG ZRD BLOCK 3RD STAGE BASAVESHW ARNAGAR BANGALORE PIN CODE:
560079, STD CODE: NA , TEL NO: 23225490, FAX NO: NA, E-MAIL : N.A.

1992

10 - 50

3726

BANGALORE ELECTRICITY SUPPLY


COMPANY

#66/2 5 MAIN 3 PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1994

10 - 50

3727

INDRADEV SHARMA D FURNITURES

#161 MAIN CHANNAL ROAD SARASWATHIPURAM ULSOOR BANGALORE PIN CODE: 560008,
STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3728

KIM ASSOCIATES AGENCIES

3/1CHANDANA POLICE STATION ROAD BASAVANA GUDI B 4 PIN CODE: 560004, STD CODE: NA
, TEL NO: 26527694, FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

276

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3729

SWARNA CLECTRTCAES

I4SUBBAMACHE Y ROADBASAVANAGUDI BANGALORE PIN CODE: 560004, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3730

MANOJKUMAR CHETAK LOGTSTIC


COMPANY NO 65

1024 MUNISWAMY LAYOU J MAIN HDSUR ROAD BANGALORE 68 PIN CODE: 560068, STD
CODE: 00080, TEL NO: 25737605, FAX NO: 25737621, E-MAIL : N.A.

1995

10 - 50

3731

TRANSTEEESEATINGTECHNOLOGIESPN
TLIMITED

A PEEMXAINDUSTRIAUAREA SGCONDPHASE BANGALORE PIN CODE: 560058, STD CODE: 080,


TEL NO: 23723117, FAX NO: 23723117, E-MAIL : N.A.

1995

10 - 50

3732

SATRAC ENGINEERING PRTVATE


LIMITED

#193/A 10MAIN PHASE PEENYA INDUSTRIAL AREA BANGALORE 58 PIN CODE: 560058, STD
CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1995

10 - 50

3733

BLUE VOL SERVIEES

NOBS 32HAINROAD KAHAKSHIPALYA VRUSHABHAVATHINAGAR BANUALORE PIN CODE:


560079, STD CODE: NA , TEL NO: 1, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3734

VIGNESWARA CONTROLS

NO 343 PEENYA NDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE: NA , TEL NO:
51171690, FAX NO: NA, E-MAIL : N.A.

1996

10 - 50

3735

BA KODANDARAM SHETTY

CMH ROAD MDIRANAGAR ST STAGE BANGALORE PIN CODE: 560038, STD CODE: NA , TEL
NO: 25286240, FAX NO: NA, E-MAIL : N.A.

1997

10 - 50

3736

R ELECTRICALS CHANDRA SEKHAR


13TH MAIN

SARAKK ANJINEYA EMPLE ROAD ,


NO: NA, E-MAIL : N.A.

PIN CODE: 560078, STD CODE: NA , TEL NO: NA , FAX

1998

10 - 50

3737

CHAKRADHAR

TWENTYFIRSTCENTURYOFFICE PRIVATELTD NO51 CHIKKABEGURGATE BANGALORE-68 PIN


CODE: 560068, STD CODE: NA , TEL NO: 51110789, FAX NO: 369, E-MAIL : N.A.

1998

10 - 50

3738

SOIELTROM CENTUM ELFCTRDNIC LTD

NO ZS K H R Y N K NEWTOWN BANGALORE PIN CODE: 560004, STD CODE: NA , TEL NO: NA ,


FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3739

SHREE VENKATESHWARA
ELECTRICALS PV LTD

#068 PEENYA 3PHASE PEENYA INDUSTRIAL AREA BANGALORE PIN CODE: 560058, STD CODE:
NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3740

ARAVINDA PACKAGING

NO KO 4I NADAKERAPPA NDUSTRIEAL ESTATE ,


NO: 28365462, FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3741

JAVIARNIKSON
ELECTRICALPARTSWORK

RAJAPALYA MAHADEVPURA POST BANGALORESOUTH DISTRICT PIN CODE: 560048, STD


CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

3742

DHANALAKSHMI BASAVANAGARROAP
HOODI

MAHAOEVAPURA POS BANGALORE SOUTH KARNATAKA PIN CODE: 560048, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1998

10 - 50

PIN CODE: 560091, STD CODE: NA , TEL

277

DIRECTORY ESTABLISHMENT
SECTOR :URBAN
Sl No

STATE : KARNATAKA

Name of Establishment

(1)

DISTRICT : Bangalore
Address / Telephone / Fax / E-mail

(2)

(3)

Year of start of
Operation

Employment
Class

(4)

(5)

3743

WHIRLPOOL OF NDIA LTD NO 3/3 PV


SETTYWAR

HOUSING COMPLEX PA ANGERE R.R.NAGAR BANGALORE PIN CODE: 560098, STD CODE: NA ,
TEL NO: 28603392, FAX NO: 28603393, E-MAIL : N.A.

1998

10 - 50

3744

MANGER UNIVERSAL NDUSTRIES

NO 8/1, D STREET, MAGAD ROAD BANGALORE PIN CODE: 560023, STD CODE: NA , TEL NO:
NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3745

KALYAN

FO I MAGAD ROAD KAMAKSHIPALYAI BANGLLORE 79 PIN CODE: 560079, STD CODE: NA ,


TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

1999

10 - 50

3746

SAMPATH LAL OTHARIA SH HAM


ONSUMER

DURA LES P LTD


N BLOCK A ATINAGA R ANGALORE IO PIN CODE: 560010, STD CODE:
NA , TEL NO: 23470346, FAX NO: 23470347, E-MAIL : N.A.

2000

10 - 50

3747

SRI SHIVASUBRAHAHAIAH F A GLOBAL


ELRCTRON

IC INDIA PVT LTD NO 831 2NDCROSS 7THMAIN INDIRANAGAR HAL 2ND STAGE
BANGALORE560008 PIN CODE: NA , STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3748

M N C LOGISTICS

OPPOSITE BHEL KAIE NO Z MYSORE ROAD BANGALORE PIN CODE: 560026, STD CODE: NA ,
TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3749

AKASHKUMARBATIN

ARLHANTENTERPRISES NO249/2OLNO2702SIRMVROADZNDCROSSBOMMANAHA PIN CODE:


560068, STD CODE: 83917, TEL NO: 61, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3750

MALLIKARJUN

ORIGIN MOULDINGS PVT LTD #36/81S NAGAR BILEKAHALL BANNERUGATTA ROAD


BANGALORE PIN CODE: 560076, STD CODE: NA , TEL NO: NA , FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3751

SAFAR DESIGNS

NO I83 DORESANIPALYA BILEKAHALLI BANGALORE PIN CODE: 560076, STD CODE: 26581, TEL
NO: 168, FAX NO: NA, E-MAIL : N.A.

2000

10 - 50

3752

***

ROA ,

2001

10 - 50

3753

KARTHIK DISTRIBUTORS

NO 681 1ST FLOOR 10TH MAIN 36TH CROSS 4TH BLOCK JAYANAGAR BANGALORE PIN CODE:
560011, STD CODE: N