Anda di halaman 1dari 18

Catatan Yos Sutiyoso

https://www.facebook.com/yos.sutiyoso

disusunolehhttps://www.facebook.com/fadjar.nurswanto

HIDROPONIK,Hidro=air,ponos=daya,hidroponik=memberdayakanair.

JanganditulisdandiucapkansebagaiHIDROPHONIK,karenaphonos=suara,sehingga
menjadisuaraair.Ngilumendengarnya!

Definisi=nyaruparupa!Soillessculture,Budidayadalamgreenhouse,Budidayaanorganik,
accchhh,peduliamat,sich,yangpentinghasilnyaungguldalamkualitasdankuantitas,hemat
air,hematenergi,versatility/kelincahannyatinggi,bersahabatdenganlingkungan,tidakada
pencemaranolehbakteriE.Coli,danmenghasilkanprodukyangsehat,hygienis,aromatis,
denganproteindanvitaminyangmelimpah,danberpenampilanyangmenarikdanmenimbulkan
selerauntukmengkonsumsinya.
Memangdiakuimemerlukanpemodalanyangbesar,managerialskillyangtinggi,marketing
networkyangcanggih,dansumberdayamanusiayanghandal!Kerjakan!

BEBERAPASISTEMBUDIDAYAHIDROPONIK.

1.Menggunakanmedia,misalnya:
a)Tanah.Kelemahannyaialahbanyakmengandungbibitpenyakitcendawandanbakteriatau
cyste/kistanya,yangsetelahbeberapabulanakanmeledakpenyakitnya.Jugabanyak
mengandungbenihgulma,yangsewaktuwaktuakanmuncul.Kadangmengandungbibithama,
misalnyaulattanahAgrotis,danbeberapajenisnematoda,a.l.Meloidogyne.
b)Pasir.Sudahditinggalkan,karenamahal,sukardidapat,mahaltransportasinya,tinggibiaya
penyebarannyadikebun,berat,padat,kecilronggaudaranya,kompakpadatmenyulitkan
pertumbuhanakar.
c)Humus,Kompos.Hanyabaikbagitanamanyangditumbuhkansecaravegetatifsaja,misalnya
sayurandaun:bayam,caysim,kangkung,pakchoy,kailan,selada.
d)Cocopeat,gambutbubuksabutkelapa.Kandungansaponinnyatinggi,kadang2>EC3,0
mS/cm,sehinggakurangpeluanguntukmemberipupuk,tanpamelampauibatas
phytotoksisitas.Harusdicucidgnairmengalir,hinggaECsaponinnya0,00,5,tergantung
tanamanyangakanditanamapakahtanamannyasukulenatauberkayu.

e).Arangsekam.Bilatidakmusimpanenpadi,makasekamsukardidapat.Biladibuatsendiri,
karenateknologipe,buatannyamudah.

2.Menggunakanmediaair.
a)NFTNutrientFilmTechnicHidroponikTalangLandai.MenyontekNFTdangreenhouse,
buatanBelgia,yangdiimporsiappakai,milikalmarhumIrSunartodiJlnSemboja,Margonda,
Depok,thn1983,sayamembuatversilokaldenganmenggunakantalanghujanrumahtangga.
Talangdengankelandaiantangens5%,larutannutrisimengalirdenganketebalan34mm,
menjadikannyakayaoksigenterlarut,karenariakyangbergulunggulungberhubunganlangsung
denganudara.SistemNFTinisangatpopuler!
b)DFTDeepFlowTechnicHidroponikTalangDatar.Kedalamanairdipertahankanpada
kedalamantidaklebihdari8cm,supayabebantidakterlampauberatbagitalang.Airmasuk
padaujungyangsatudankeluarmelaluilubangpadaketinggian8cmpadaujungyanglain.
Aerasipadasisteminikurangsempurna,sehinggasulituntukmencapaiproduksiyangtinggi.
Antarastyrofoamyangdipasangpadaketinggian10cm,denganpermukaanairpadaketinggian
8cm,adaronggaudarasetebal2cm,untukaerasi.
c).FloatingRaftTechnicHidroponikRakitApung.Kolamdengankedalaman40cm,diisi
larutannutrisisetebal30cm,diapungistyrofoamtebal3cm,diberiberpuluhlubangtanam,
ditanamianaksemaisayurandaun,denganakarnyamenjuntaikedalamlarutannutrisi.Dengan
blowerditambahkanudarakedalamtandon,untukmeningkatkankadaroksigenterlarut.
Pengelolaaninstalasisangatmudah.

3.Menggunakanmediaairdantanah/lumpur.
a)HidroponikPasangSurutEbbandFlood.Biasanyadigunakandalamproduksitanamanhias
dalampot.Potdiletakkandalambakdankakipotdigenangolehlarutannutrisisetinggi48cm,
selamabeberapamenit,kemudianlarutandialirkankeluarkembalisecaragravitasi,dilakukan
sekalidalambeberapahari.Potberisimedia,biasanyatanahbercampurbahanorganis.Tinggi
larutanperendamanharusdibatasi,untukmencegahmediamengapungdanmerubuhkan
tanaman.
b)Hidroponikperendaman.Sawahadalahsuatusistemhidroponikperendaman,denganair
mengalirlambatlambat,didorongolehdebitairpadainletsebesar1liter/hektar/detik,suatu
jumlahyangbesar.(Dikecualikan:Sawahtadahhujan,yangmendapatpasokanairdarihujan,
danairdipertahankandilahanituselamamungkin.)

4.Menggunakanudarasebagaimedia
Aeroponik.Anaksemaiyangditancapkankedalamlubangtanam,yangdibuatpadasehelai
styrofoam,akarnyabergelayutanbebaskebawah.Diliputolehkabutbutiranhaluslarutannutrisi,
melaluisprinklersyangdigerakkanolehpompatekanantinggi,secaraterusmenerustanpa

henti,akarbermandikanbutiranhalus,yangkandunganoksigenterlarutnyasangattinggi,yang
sangatmenunjangprosesrespirasi.Larutanyangtidakmengenaiakardikumpulkandan
dialirkankembaliketandon/reservoirlarutannutrisi,untukresirkulasi.Diharidepansistem
aeroponikakanbanyakditerapkanunukmemproduksibibitindukkentang,dankarenanyakita
sudahharusmulaifokuspadateknikaeroponik.Percobaanyangberhasilbaiktelahpula
dilakukanterhadapaeroponikproduksibungapotongChrysanthemum/krisandanLily.Umur
tanamandapatdireduksidari12minggumenjadi8minggu.Jumlahkuntumbungayangmekar
serempakdapatditingkatkandariduamenjaditigakuntum.Kecerahanwarnadanaromadapat
puladitingkatkansedikit.

GARAMANORGANISUNTUKMERAMUPUPUKHIDROPONIK.

Garamanorganisyangdipakaidalammeramupupukhidroponikdipilihyangmengandungunsur
haramakroN,P,K,Ca,Mg,S,yangesensial,mutlakdibutuhkandalamjumlahbanyak,untuk
membentuktubuhtanaman,dalamrangkaproduksiyangtinggikuantitasdankualitasnya.
DiperlukanpulaunsurharamikroFe,Mn,Cu,Zn,B,Mo,yangjugaesensial,mutlakdibutuhkan
walaudalamjumlahkecil,dankebanyakanberperansebagaienzym.
DeretanunsurituditambahNa,Si,danCl,dandianggapsebagaibeneficialelements,unsur
yangmenguntungkan.NadapatmenjadipenggantiK,padalahanyangmiskinK,dengangejala
pelepahdaunkelapaterkulai.PetanimemupuknyadengangaramdapurNaCl,supayapelepah
yangberikutnyategak.Si,silikat,memperkuatjaringantumbuhan,sehinggapenyakitcendawan
tidakbisamenyerang.Cl,chlor,patutditakutidandihindari,karenadapatmengganggu
rumahtanggaairjaringantanaman,terbentuknyaselselraksasa,penuhdenganair,merusak
konsistensisel,menyebabkanprodukhambartanparasa.
Unsurunsurharaitusetelahmasukkedalamtubuhtanaman,selaluberubahbentuk,menjadi
protein,lemak,dsbnya,danjangandisangkamerekabergentayanganlepassebagaiunsur
individual.Biasanyaunsurunsuritudikumpulkandivakuoladidalamsel,menantidiprosesoleh
ribosomyangjugaberadadalamsel,untukmenjadiprotein,jaringan/tissue,organ/alattubuh,
dsbnya.

JENISBAHANKIMIAYANGDIPAKAISEBAGAISUMBERUNSURHARAMAKRO

YangpalingpopulerialahkonsepABmix,denganmembuatpekatan/konsentratAdanB,untuk
kemudiandiencerkandenganperbandingan1:100,untukmenjadilarutanpupukABmixyang
siappakai.DigrupAadaunsurkationkalsiumCa++,dandigrupBadaanionsulfatSO4
dananionfosfatPO4.DalamkeadaanpekatCatidakbolehbertemudengansulfat,karena
terbentuknyagipsCaSO4,yangmengendapdanpraktistidaklarut,sehinggaunsurCa,maupun
sulfatnya,tidakdapatdiserapolehakar.JugadalamkeadaanpekatCatidakbolehbertemu
denganfosfat,karenaterbentuknyatriplesuperfosfatTSP,yangmengendapdanpraktistidak

larut,sehinggaunsurCamaupunfosfatnya,tidakdapatdiserapolahakar.Tetapidalamkeadaan
diencerkan,misalnya1:100,makaCa+sulfat,maupunCa+fosfat,bisalarutdenganbaik.
KemudianCa,sulfat,danfosfat,bisadiserapdenganleluasaolehakar.GipsCaSO4walau
rendahsekali,masihmempunyaidayalarut,walauhanyasebesar1.25%.TSPCa3(PO4)2
walaurendahsekali,jugamasihmempunyaidayalarut,walauhanyasebesar1,75%.Itulah
sebabnya,dalamkeadaanencer,Cabolehbertemudengansulfat,maupunfosfat,tanpa
kekhawatiranakanterjadiendapan.InilahsiasatuntukmemasukkanunsurCadalamramuan
pupukhidroponik,mengingatpentingnyaperanCadalampercaturanpemupukanhidroponik.

BAHANKIMIAKOMPONENPUPUKHIDROPONIKABMIX

Garamgaram,bahankimiakomponenpupukhidroponik,semuanyaanorganisyangmerupakan
elektrolit,yangbiladilarutkanakanteruraimenjadikationdananion,seinggabisadiserapoleh
tanaman.

Dipilihkanbahankimiayangmudahdidapat,secaraumumbanyakdipakai,miringharganya,
gradenyateknis,tidakterlaluhygroskopis,dansebaiknyaeasytohandle.
AngkapersenkandunganunsurunsurutamadinyatakansebagaiN,danP,K,Ca,Mg,S.Halini
harusdibedakandenganpupuktaburuntukpertaniankonvensional,yangmenggunakansebutan
P2O5,K2O,CaO,MgO,SO2.Parapelakuhidroponikmemerlukanmentalswitchdalam
perhitunganmembuatformulapupukhidroponik.

Digunakankonsepkerjapekatan/konsentratAdanB,untukkemudiandisatukanmenjadiAB
mix.Untukmenjadikannyalarutansiappakai,dilakukanpengenceran1:100.Sebagaicontoh
ialahgroupA,yangterdiriatas3komponen,jumlahbobot1250g.GroupB,yangterdiriatas4
komponen,jumlahbobotdibuatjugasama,yaitu1250g,sehinggajumlahbobottotalA+B=
2.500g.NantisemuakomponengroupAdimasukkankedalamkontainerAkapasitas5literdan
ditambahiair,hinggavolumenyamencapai5liter.Halyangsamadiperlakukanterhadapgroup
B,hinggatercapaipekatanByangjuga5liter.

Dalammempersiapkanlarutansiappakai,makasediakanlahkontaineryangdiisi1.000literair
bersih,dituangi5literpekatanA,diaduksemenithinggarata,danditambahilagi5literpekatanB,
diaduklagi.Tersiapkanlahsekitar1.000literlarutansiappakaiABmix,dengankepekatan
sesuaidenganEC(electroconductivity)sekitar2,5mS/cm.

ISIPEKATANGROUPADANGROUPB

SudahditerangkandiatasbahwapupukhidroponikABmix,terdiriatasgroupAdengan
kandunganCa++,dangroupBdengankandunganSO4danPO4,dantidakboleh
dipertemukandalamkeadaanpekat,karenakekhawatiranterjadinyaendapankalsiumsulfat,
gips,CaSO4,dantripplesuperfosfat,TSP,Ca3(PO4)2.

KandungangroupA,a.l.ialahkalsiumnitrat5Ca(NO3)2.NH4NO3.10H2O,danmerupakan
sumberCasebesar19%,yangmudahlarutdanmudahdiserapolehtanaman.Dikandungpula
Nnitratsebesar14,4%danNamonium1,1%.KarenakecilnyaNamonium,makakomponini
disebutkalsiumnitratsaja,dankataamoniumditelan,karenaukurannyakecil.

GroupAjugamengandungkomponkaliumnitrat,KNO3,dengankandunganKsebesar38%
danNnitrat13%.GroupAjugadimuatiunsurunsurmikroesensial,yangsebagiandalam
bentukchelate/kelat,yaituFeEDTA,MnEDTA,CuEDTA,ZnEDTA,danasamboratH3BO3,serta
Namolybdat,yangterutamaberperansebagaienzym.

KandungangroupBialahmonokaliumphosphat,MKP,KH2PO4,denganKsebesar28%dan
P23%.MKPinidapatberperansebagaibuffer,untukmenstabilkanpHpadasuatuangka
tertentu,denganbersifatasamdalamkondisibasa,danbersifatbasadalamkondisiasam.Juda
adaamoniumsulfat,ZA(zwavelamonicus,bahasaBelanda),(NH4)2SO4,dengankandungan
Namoniumsebesar21%dansulfurS24%.Yangketigaadalahkaliumsulfat,ZK,K2SO4,
dengankandungaK45%dansulfurS18%.Yangkeempatialahmagnesiumsulfat,garam
Inggris,Epsomsalt(Inggris),bitterzout(Belanda),bittersalz(Jerman)MgSO4.7H2O.

FORMULAPUPUKHIDROPONIKABMIXUNTUKSEMUASTADIA

Menurutteori,persemaianmemerlukanformulayangberbedadenganmasa
vegetatif/pertumbuhandanberdedapuladenganmasageneratif/pembungaan/pembuahan.
Dalampraktekdilapangan,halinisulitdilaksanakan,karenalahanberproduksidantandon
larutanpupuknyahanyasebuah,jaditidakbisadibedabedakan.

Diambillahkebijaksanaanuntukmenggunakansatuformulasaja,danmembedakankepekatan
danvolumepemberiannyauntukstadiastadiapersemaian,vegetatif,dangeneratif.Misalnya,
untukpersemaiandigunakanEC1,0mS/cm,untukmasavegetatif2,0mS,danuntukgeneratif
3,0.YangdimaksudECialahElectroConductivity,pengantaranlistrik,dandatuannyauntuk
berhidroponikialahmS/cm,karenakatodadananodanyaberjarak1cm,sedangkanmS
dibacanyamilliSiemens,milliberartiseribu,denganSditulisdenganhurufbesar.


Kalaumelakukanfertigasi,misalnyamenanammelonpadapolybagdengankapasitasarang
sekam5liter,dengansistemirigasitetes/dripirrigation,ketikakecilaplikasiadalah2X200=400
ml/harimediumbesar3X300=900ml/haristadiaproduksi4X300=1.200ml/hari.Kalau
satutanamandijadikanduacabang,makapadastadiaproduksiharus4X400=1.600ml/hari.
Kalaumenggunakanpolybagberkapasitas7literarangsekam,diisi2tanaman/polybag,satu
tanamandiduacabangkan,sehinggaada4cabang,makadiperlukan5X400=2.000
ml/polybag/hari.

FORMULAPUPUKHIDROPONIKUNTUKTIAPGROUPTANAMAN

Diyakiniformulapupukuntuktanamanyangdibudidayakanuntukmendapatkanhasilpanen
berupadaun,misalnyabayam,akanberbedadenganformulauntuktanamandenganhasil
panenberupabuah,misalnyatomat.

Kalaudibulakbalik,akanmendapatkanhasilyangmengecewakan.Bilapupukbayamdigunakan
padatanamantomat,makaakanterciptadauntomatyangpanjangdanlebar,melengkung
karenaberatnyayangbesar.Tetapimanabunga,pentil,danbuahtomatnya?Terbuktitanaman
terusmenerustumbuhsecaravegetatif,dantidakadatandatandaberalihkefasegeneratif.
Sebaliknyamenanambayamdenganpupukkhusustomat,makaakanmenghasilkantanaman
yangserbapendekdankompak,kecilkecilsudahmulaiberbunga,dandaunyangdiharapkan
hijaurimbun,terbuktitidakbanyakterlihat.

Tidakterlampausulituntukmengaturperumusanformulapupukhidroponik,bilakitakuasai
fisiologitumbuhan.Tentunyabeberapailmudanketrampilanlainnyaharusdiketahuipula,
terutamakimiaanorganis.Untukmemudahkankerja,makatanamanyangdihidroponikkandibagi
dalam5gugusan,yaitu:
1.Sayurandaun:Bayam,Caysim,dsbnya.
2.Sayurandaundanbatang:Kangkung,Kailan,dsbnya.
3.Sayuranbunga:Brocolli,Bloemkool,dsbnya.
4.Sayuranbuah:Tomat,Cabai,dsbnya,dimasukkanjugaMelon.
5.Sayuranumbi:Biet,Radishdsbnya.

Formulauntukno.1,tidakbanyakberbedadenganno.2.Formulano.3,tidakbanyakberbeda
denganno.4.Masingmasingjenistanamandapatpuladibuatkanformulakhasuntukjenis
tanamantersebutsaja.

REKAYASAFORMULASIPUPUKHIDROPONIKKHASTANAMANTERTENTU.

Ambilcontohtanamantomat.Disampingpersyaratanumumbahwaproduksinyatinggi,
penampilannyabaik,rasanyanikmat,diinginkanpulasyarattambahanseebagaiberikut:

1. BebasgejalaBER(blossomendrot),gejaladefisiensikalsium,Ca.Disebabkanpasokan
Camemangkurang,beratatomCayangmemangtinggi,sehinggamobilitasnyapayah,
tanamankurangmempunyaipower,karenaselamasemingguintensitascahaya
mataharirendah,exposuretimenyapendek,sehinggaasimilasikarbohidratnyahanya
sekedarnya
2. Disyaratkan,tanamantidakmenunjukkangejalaseranganpenyakitcendawanAlternaria,
Phytophthora,Fusarium,yangdapatmenghancurkanproduksi.
3. Karenajenistomatiniadalahtomatbuahdanbukantomatsayur,makaderajat
sweetness/kemanisannyaharuslebihmenonjoldariderajat
accidityfreshness/kesegarannya.

Untukmenjawabtantanganitu,makakegiatantambahandalammeramupupukhidroponikAB
mix,adalah:
1. MeningkatkankadarCa>150ppm,sehinggaBERdapattercegah.Peranmatahari
ditingkatkanuntukmenambahenergibagitanaman,supayaCadapatterangkatdan
terangkutkepentilbuah.
2. MeningkatkankadarCa>150ppm(sepertidiatas),untukmemperkuatdindingsel,
supayalebihtoleranterhadapseranganpenyakitcendawan.DisampingCa,jugaasupan
Pditingkatkan,untukmeningkatkandanmemperkuatcrudefiber/seratkasarnyapada
indingsel.
3. Manisdisenafaskandengankarbohidrat,denganfotosintesa,dengankesanggupanP
merubahgelombangcahayamenjadienergikimiadalambentukkarbohidrat,gulayang
manis.AsupanharaPperluditingkatkan,danpalingcocokialahdenganpeningkatan
MKP,monokaliumphosphat,KH2PO4,dimanapenambahanunsurKdapatmembantu
perbaikandistribusi,transportasidanpenumpukanhasilasimilat.

Komentarselanjutnyaadalah:Literaturluarnegeri,entahmengapa,jarangberanimembahas
interaksiantarapupuk/meramupupuk,ECdenganangkayangbesar,volumeyangtinggi,
denganpencegahanseranganpenyakitcendawan.Interaksinyakuat,sehinggadapatdigunakan
untukmengatasibanyakmasalahyangditimbulkanolehpenyakitcendawan.

PENTINGNYANILAIAMBANGPHYTOTOKSISITASTIAPJENISTANAMAN

KitabernafsuuntukmenggunakanECyangtinggiuntukpunjulnyaproduksi,kualitas,dan
penampilanhasilpanen.Dilainfihakkitadihadangbatasambangkeracunantanaman,
phytotoksisitas,yangseringmunculdalambentukmalformasi,ngaconyabentuktanaman
sehinggalaindaribiasanya,gosongdaunnyasebelah,terlalulamaberadadalamfasevegetatif
tanpamemperlihatkanakanberalihnyakefasegeneratif,dsbnya.

Padasayuranyangsukulen/berairbanyak,misalnyaBayem,Caysim,Pakchoy,batasnyapada
budidayahidroponikialahEC3,0mS/cm.JadikitaberoperasinyasampaiEC2,5saja.Bila
tibatibatemperaturudaranaik,realativehumidity/kelembabannisbahudaraturun,tanaman
berkeringatdanmenguaplebihbanyak,sehinggaEClarutanmeningkat,adakeleluasaan
sebesarEC0,5untukmeredamgejolakEC,hinggaterhindarlahtanamandarikeracunan.
Dilainfihak,perludisadaribahwabilakitamenaikkanEC,makasemakintinggiECyangdicapai,
semakinberkuranglahefisiensipenyerapannyaolehtanaman,karenafaktorjenuhkemudian
muncul.HukumLawofdeminishingreturnmuncul,danderajatpertumbuhantanaman
mendekatistagnasi/mandek!

Memangakanaman,bilakitamaindiangkarendah,jauhdarinilaiambangphytotoksisitas,
tetapitanamantumbuhnyalambat,rasadanaromaprodukmenurun,shelflifependek,berada
difasevegetatifterlalulamatanpaadatandatandaakanberalihkefasegeneratif,dansayuran
timbangannyaenteng,sehinggausahakurangmenguntungkan.

MENGUKURKEPEKATANLARUTANPUPUKHIDROPONIK

Mengukurkepekatanlarutanpupuk,dilakukandenganmengukurpengantaranlistrikdiantaradua
kutub,yaituKatodadanAnoda,yangberjaraksatucm,darisuatualatyangdisebutECmeter,
ElectroConductivitymeter,alatukurpengantaranlistrik.SatuannyaialahmS/cm,dituliskannya
mkecil,danSbesar,milliSiemenspercm,karenajarakkatodadananodaialahsatucm.
Beberapapabrikmenambahkansuatualatkecildidalamnya,yangmembacasatuan
pengantaranlistrikitu,mengkonversinyauntukmenjadippm(partspermillion),pengukurannya
terhadapTDS,totaldissolvedsolids,jumlahbahanpadatyangterlarutkan.Penambahanalat
kecilinitentunyameningkatkanbiayaproduksisedikit.

Rumitnyaialahbahwatiappabrikmemakaiangkafaktorkonversisendirisendiri,dantidakada
yangmaumengalahuntukhanyamemakaisatuangkasaja.Angkafaktorkonversiyangpernah
terlihatialah500,630,640,650,670,700.Halinimembingungkan,dankadangmenimbulkan
prasangkadanpertentangan,karenasetiappemakaibebasmemakaiangkakonversiyang
diinginkannya.SayapribadimemilihmenggunakanEC,yangangkasatuannyahanyasemacam,
jaditidakmembingungkan.

KETRAMPILANMENGGUNAKANECMETER.

Kalaumenanamcabemerahbesardengansistemhidroponik,makadigunakanpetunjuk:
Persemaian:menggunakanEC1,0mS/cm.Fasevegetatif:EC2,0mS.Fasegeneratif:EC
3,0.(Caramenulistanpamenyebutkanlagisatuannya,kawankawansudahdapatmengerti
kepekatanpupukyangdimaksud).

ECmeterbertenagabatereikancing,bilasudahlamadanbanyakdipakai,tenaganyaberkurang,
menunjukkanangkasecaraerratik,naikturunterusmenerus,seolahtidakadahentinya.
Batereiyangsudahlemah,harusdigantidenganyangsegar.
Setelahmembukatutupnya,ujungECmeterdicelupkedalamlarutanyangakandiukur
kepekatannya,sedalamgarisbatas.Setelahselesai,hendaknyadioffkansesegeramungkin
untukmenghematbatereinya.

ECmeterjugasangatbergunauntukmencegahkitamelampauinilaiambangphytotoksisitas,
misalnyabilakitamelihatpadamonitor,bahwaangkaECsudahsangattinggi,sehinggabesar
kemungkinanbataskeracunanakanterlewati,makadengansegerakitabisabertindak
menurunkankepekatanlarutanpupuk.Terhindarlahkitadarigejalagosongpadatanaman,
karenaECyangterlampautinggiitu.

PunECmeterbisadipakaiuntukmensegerakanperalihanfasevegetatifkegeneratif,dengan
menaikkanangkaEC,tetapitetapjangannyerempetrempetnilaiambangphytotoksisitas,
karenaterkandungbahayajatuhnyaproduksi.

PENTINGNYAPENGERTIANMENGENAIpHDANPEMILIKANpHMETER.

pHdigunakanuntukmenggambarkanderajatkeasamansuatularutan,dankisarannyaadalah
dariangka0hingga14,denganangka7sebagaiderajatasamyangnetral.Padatitikitu,kationH
+adasatu,dandifihaklainanionOHjugaadasatu,sehinggamuatanlistriknyaseri.Dibawah
angka7,jumlahkationH+bertambahbanyaksemakinkitabergerakkekiri,angkapHsemakin

mengecil,dandinamakanasamsekali.Diatasangka7,jumlahanionOHbertambahbanyak,
semakinkitabergerakkekanan,angkapHsemakinmembesar,dandinamakanalkalisatau
basasekali.
BiasanyakitaberhidroponikdengankisaranpHantaraminimum5,5maksimum6,5,dengan
optimum6,0.DibawahpH5,5beberapaunsurmulaimengendap,tidakdapatdiserapolehakar,
menunjukkangejaladefisiensiunsurtertentu.DiataspH6,5,beberapaunsurmulaipula
mengendap,tidakdapatdiserapolehakar,menunjukkangejaladefisiensiunsurtertentupula.
SebaiknyakitaberadapadapHoptimum,dimanasemuaunsurberadadalamkelarutanyang
sempurna,semuaunsurmudahdiserapolehakar,dantidakakanterlihatgejaladefisiensiunsur
yangmanapun.

Kisarantetapdiperlukan,karenamisalnyaolehpeningkatantemperaturudara,makapHlarutan
akannaik,tetapimasihdapatdiliputolehkisarantersebut.Apalagikitaselalumemasukkan
bahankimiaanorganisyangbersifatbuffer,semisalMKP,monokaliumphosphat,KH2PO4,
yangdapatmenstabilkanpHlarutan,jadibersifatbasadalamkondisiasam,danbersifatasam
dalamkondisibasa.Semuaunsurberadadalamkeadaanlarutsempurna,tidakakan
menunjukkangejaladefisiensiunsurharamanapun,sehinggaproduksitinggikuantitasdan
kualitasnya.

BAHANKIMIAUNTUKMENURUNKANDANMENAIKKANpH.

Pertumbuhantanamanpadabudidayahidroponikyangbaikdapatdicapaibilaairataularutan
derajatasamnya,ataupH,beradaantarapH5,56,5,denganoptimalpH6,0.KisaranpHialah
antara0hingga14,denganangkanetral7,0.Dibawahangka7,0disebutasam.Diatasangka
7,0disebutbasaataualkalis.

UntukmenurunkanpHairdiperlukanasamanorganiskuat,sedangkanuntukmenaikkan
diperlukanbasaataualkalikuat.

UntukmenurunkanpHtidakdianjurkanmenggunakanasamorganis,misalnyacukaCH3COOH,
atauasamsemutHCOOH,karenaasamorganisadalahasamlemah,yangdiperlukandalam
jumlahbesaruntukmenurunkanpHsedikit,jadijatuhnyamahal.Lagipuladayakerjanyatidak
lama,dalambeberapajampHsudahnaikkembali,seolaholahasamorganistersebuttidak
pernahditambahkan.

Pilihanberkisarantaraasamasamanorganiskuat.AmbilcontohasamnitratHNO3,yang
digunakanpadabudidayasayurandaun,mengingatunsurNnya,walauhanyasedikit,lumayan

dapatmenyumbanguntukpertumbuhansayurandaun.AsamfosfatH3PO4digunakanpada
budidayasayuranbuah,mengingatunsurPnya,walauhanyasedikit,lumayandapat
menyumbanguntukperkembangangeneratifsayuranbuah.Dapatpulamenggunakanasam
sulfatH2SO4,yangdapatdibelidipompabensinSBPU,dalambotolplastikwarnamerah.Unsur
Snya,walaupunhanyasedikit,lumayanuntukmenunjangpembentukanprotein.
Bahayamengancam,misalnyauapasamnitrat,yangdapatmembutakanmata.Untuk
mengurangibahayanya,asamnitratharusdiencerkanmenjadihanya10%.Begitupuladengan
asamfosfat.Bajubolong,kulitmelepuh,kerongkongankering,seringdialamipekerjayang
kecipratanataumenghirupuapasamkuat.

PENGUKURANEC,ElectroConductivity,PENGANTARANLISTRIK.

KepekatanlarutannutrisidiukurdenganmenggunakanECmeter,yangmengukurelectro
conductivity,pengantaranlistrik,dengansatuanmS/cm,karenakatodadananodanyaberjarak
1cm.

BeberapapabrikECmetermenambahkanpadanyasuatualattambahankecilyang
menterjemahkanmS/cmmenjadisatuanppm(partspermillion),danalatnyaberubahnama
menjadiTDSmeter(TotalDissolvedSolids).Penambahanalatitutentunyameningkatkanbiaya
produksialat.Digunakanlahfaktorkonversi,dansetiappabrikmenggunakanfaktorkonversinya
sendirisendiri,a.l.500,630,640,650,670,dan700ppm,untuktiapmS/cm.Halini
membingungkan,hinggadiambilkeputusanuntukmenggunakanECsaja,dengansatusatuan,
yaitumS/cm.

UntukpersemaiandigunakanEC1,0mS/cm,fasepertumbuhanvegetatifEC2,0mS,danfase
generatifEC3,0.TigacaramenulissatuanECini,seringkitadapatidalamtulisandimajalah
ataudiFacebook.Dilainfihak,angkaECjugadigunakanuntukmembatasikitasupayatidak
semenamenamenaikkanEC,karenaadabatasphytotoksisitas,kebanyakandengangejala
gosong.Misalnyacaysim,bayam,danbeberapasayurandaaunlainnyaterlihatmulaigosong
bila>EC3,0,tetapiuntukkangkung,kailan,yangsedikitlebihkuat,mungkinangkakeracunan>
EC3.5.Untuktomat,terong,paprika,yangbisadianggaptanamanperennial,tahunan,dan
berkayu,phytotoxicityleveldiduga>EC7,0.Halinimembukakemungkinanuntuk
menggunakanECyangtinggi,yangbanyakberpengaruhpadapertumbuhantanaman,a.l.
perpendekanumurhinggalayakpanen,perpanjanganumurshelflifedisupermarket,
meningkatkanproduktivitas,penampilan,rasa,aroma,kadarproteindanvitamin.

KEBUTUHANNUTRISISESUAIPERTUMBUHANTANAMAN.

Tanamantumbuhmakinlamamakinbesar,danpertumbuhannyamengikutideretukurdan
bukanderethitung.Pemupukanhendaknyajugamengikutiderettersebut,supayasemua
kebutuhannyadapatterpenuhi,produksitinggi,hasilpanenberkualitas,hargajualtinggi,
menempatimarketshareyangunggul.
Sayuranbuah,misalnyatomat,ketimun,terong,mengalami3masapertumbuhan,yaitu:
persemaian,masavegetatif/pertumbuhan,danmasageneratif/pembungaan&pembuahan.
FormulapupukhidroponikABmixnya,menurutteori,seyogyanyaberbedauntuk
masingmasingstadia.

Dalamprakteknya,kebunhanyasatublok,satuinstalasiNFT,satutandon/reservoirlarutan
pupuk,satusistemirigasi,sehinggatidakmemungkinkanmembuat3sistemsebagaimana
disyaratkan.Maka"dimainkan"lahEC,electroconductivity,dandipilihangkayangbisa"all
round"melayaniketigasistem,tanpa"melukai"ketigaanggotasistemtersebut.Dipilihlahangka
EC2,5mS/cm,yangsebenarnya"makananorangtua",tetapimenurutpengalamanmasih
ditolerirolehpersemaianatautanamanyuvenil/kecil,muda.Dengandalih:"Lebihbaiksianak
kecildiberimakananorangtua,daripadakakeknenekdiberimakanananakkecil,lalutidak
beranak!".

Akhirnyatercapailahsuatustadiakerja,dimanapersemaian,tanamankecilbarupindahtanam,
tanamanyangsedangtumbuhpesat,tanamanyangmulaiberalihdarimasavegetatifke
generatif,atausedangberbuahlebat,semuanyahanyamemakaisatuformulageneratifsaja,
dengansatuukurankepekatansaja,yaitudenganEC21/2mS/cm.Titik!Padaawalnya
memangketarketir,apakahtanamanakanphytotoxic,atautidak?Terbukti:Tidak!Kemudian
halitumenjadiSOP,standardoperatingproceduredankebiasaan,hinggasekarang,tanpa
pernahmengalamikegagalansecuilpun.

KEBUTUHANAIROLEHTANAMAN.

Hidroponikterkenalsebagaipenggunaairyangsangatefisien,Hanyasebatasyangdibutuhkan
untukproseshiduptanamandanyangdiuapkanolehtanaman.Ditambahdenganyangdibuang
sedikit,ketikasebulansekalitandonlarutanpupukdikuras.Itupuntidakdibuangpercuma,tetapi
disiramkanketanamanhias,tanamanbuahbuahanyangtumbuhdipekarangan,ataudialirkan
kesawah,untukpenambahanpupukmenanampadi.
Penggunaanairtergantungpada:

Jenistanamanyangdibudidayakan.

Ukurantanaman,persemaianmembutuhkanairsedikit,tanamandewasamembutuhkan
airsangatbanyak.

Radiasimataharisemakinterik,semakinbanyakairdibutuhkan.

Temperatursemakintinggi,semakinbanyakmembutuhkanair.

KelembabannisbisemakinrendahRH,relativehumidity,semakinbanyakdiperlukanair.

Anginsemakinkerastiupanangin,semakinbanyakdiperlukanair.

EBBANDFLOOD,HIDROPONIKPASANGSURUT,

Hidroponikpasangsurutjarangdisebut,padahalmempunyaibeberapasifatyangbaik,a.l.
oksigenasiyanglancar,denganmengalirnyaudarasegarkeronggaronggayangditinggaloleh
larutanABmix,yangsebelumnyamenggenangpotbesertamediatanamnyasedalam48cm,
selama520menit,14hari/12X,sesuaidenganketinggiandanumurtanaman,yang
ditanamdalambakbakdatarwaterpas,dalammediatanamyangtidakmengambang.

Satuhalyangdikhawatirkan,adalahbilasatutanamanakarnyasakitterserangsuatupenyakit
cendawan,penyakitituakanmenyebarmeluas,dengandisirkulasilarutanhara,daribaktanam
ketangki/tandon/reservoir,bolakbalik.Dalamkenyataannyahalinijarangterjadi,karena
ramuanABmixyangjitu,denganECyangtinggi,meningkatkanketahanantanamanterhadap
seranganpenyakitcendawanyangmenyebarmelaluialiranair.

Bakbaktanamyangdiletakkanlebihtinggidaripompadantandonlarutanhara,bilalarutanyang
menggenangnyasecaragravitasidialirkankembaliketandon,makaudarasegarakan
memasukironggaronggaudaradalammedia,membawaoksigensegaruntukrespirasiakar.

PENYERBUKANTEPUNGSARIKEBAKALBUAHDALAMGREENHOUSE.

Karenaketiadaanlebahpenyerbukdalamgreenhouseyangtertutup,makapadapertanaman
tomatdilakukanpemukulandengantongkatkecilpadabatangtomat,dangetaranyang
ditimbulkannyasudahcukupuntukmenyebabkantepungsaridarikepalasariberterbangandan
mendaratdikepalaputik.

PadaCucurbitaceae,misalnyamelon,ketimun,bungajantanterpisahdaribungabetina,
sehinggaketukanpadabatangbelumtentumenjaminsetiapbungabetinaakanterpolinasioleh
tepungsariyangterlepasdaribungajantan.

Biasanyadisewaneneknenekyangsetiappagiberkelilingdandengankwaskecilyang
dicocolkanketepungsaridibungajantan,danmencocolkannyakembalikekepalaputikpada
bungabetina.Bungabetinayangsudahdiserbukkemudiandirusakhelaibungamahkotanya,
sebagaipertandasudahdiserbuki.

Tanpakwaspunbisamengadakanpolinasi,yaitudenganmemetikbungajantandan
mencocolkankepalasarinyakekepalaputikbungabetina.Satubungajantandapatdigunakan
untukmenyerbuk23bungabetina.Perbandingannyabolehpuladijadikan1:1,karenabunga
jantanbanyakjumlahnya.

Tetapihati2!.Bilatemperaturgreenhouseterlampautinggi,kadangyangkeluarbungajantan
melulu,dantidaksatupunadabungabetina!Itumemangsalahurus,membuatgreenhouse
tanpamemikirkantemperaturtinggiyangbisatimbuluntukwaktulama.

REKAYASAPEMUPUKANDAPATMERUBAHWARNABUAH.

Tanamanmelonyangwarnaaslibuahnyamerah,dapatdibuatberwarnapucatpasi,biladiberi
pupukamoniumyangbanyak,misalnyayangberasaldaripupukZA,amoniumsulfat,
(NH4)2SO4,ataudaripupukUrea,CO(NH2)2.

Bilabanyakdiberifosfat,misalnyadalambentukMKP,monokaliumphosphat,KH2PO4,yang
jugakayaakankandunganK,kalium,makawarnamerahmelonakansemakinsemarakdan
menarik.

Jumlahpemberianharusbenarbenarbanyak,supayaperubahanwarnaitusemakinkontras.

AMONIUMBERLEBIHMEMUDARKANWARNAMERAHMELON.
Amonium,NH4+,adalahkationyangringan,dankarenanyadiserapbanyaksekaliolehakar,
besertamantelairyangmenyelimutitiapiondarielektrolityangterurai.

BeratatomN=14,danH=1,menyebabkankationNH4+bobotnyamenjadi14+(4X1)=18.
Lho,beratnyasamadenganmolekulairH2O,yang(2X1)+16=18juga.

Pantaslah,bahwaringannyakationNH4+menyebabkaniadiserapbanyakbanyakolehakar
melon.Airjugaturutterserapsangatbanyak,sehinggaterjadiselselraksasa,danbuahmelon

terlihatbesar.Tetapi,yahtetapi,selraksasakonsistensiselnyaamburadul,rasamanisbuah
melonmenjadiencer,sehinggahambarrasanya.

Warnamerahyangseyogyanyaberwarnapekat,karenasekarangbanyakdiencerkanolehair,
warnamerahnyaakanmemudar,hilangdayatariknya,danturunhargajualnya.

Solusinya?NNH4+gunakansedikitsaja.KebutuhantanamanakanNdialihkandengan
memberiNNO3,Nnitrat,misalnyadarikaliumnitratKNO3,Canitrat,kalsiumnitrat
Ca(NO3)2.4H2Oataukalauiaterlaluhygroskopis,alihkankekalsiumamoniumnitrat,dengan
namadagangCalcinit,danrumuskimia5Ca(NO3)2.NH4NO3.10H2O.

AMBANGKERACUNANPHYTOTOXICITYLEVEL.

Diawalperkembanganperhidroponikan,banyakyangmenggunakanmediadanfertigasi.
Nutrisiyangtidakterserapolehakarakanberakumulasi,fertigasiyangdilakukanbeberapakali
perhariakanmenyebabkanakumulasidengancepat.ECmasukbiasanya1,5mS/cm,tetapiEC
hasilakumulasibisamencapaiangka5,0.Padahal,misalnyauntuktanamanmelonyang
sukulen,nilaiambangkeracunanadalahEC3,5,diatasangkatersebutdaunakanmulai
gosong!Untukmenghindariterlampauinyanilaiambangkeracunanbiasanyadigunakanpatokan
kerjaEC2,5,cukupamanterhadapkegosongan.Memangadayangberanimeningkathingga
EC2,8,tetapisemakintinggi,semakinmendekatikejenuhan,sehinggakitaharusingat"lawof
deminishingreturn",semakinmendekatititikjenuh,semakintidakefisienpenyerapanhara.Lagi
pulakitaharusingat,bahwabilatibatibaRH(relativehumidity)turun,evapotranspirasi
meningkatpesat,tanamanbanyakkehilanganair,ECtibatibamelonjak,melampauinilai
ambangphytotoksisitas,dantanamangosongseparuhdaunnya.Jadi,berhatihatilah!Karena
denganEC2,5,kemungkinanterlampauinyanilaiambangkeracunan,akanlebihcepattercapai
dibandingkanpadaEC1,5.Sebentar2dicheckEC,bilamatahariterik,danbersiapsiap
membukakranair,untukmenurunkanEClarutannutrisiditandon.

KELAT/CHELATEEDTA,DTPA,EDDHA.

Ferrum,dengankodeFe,dapathadirsebagaiFe++,ferro,dapatpulaterdapatsebagaiFe+++,
ferri,yangmengendap.Ferroseringjahil,colakcolekunsurmikrolainnya,danmengfiksasinya
denganmengendapkannya,denganakibattanamanmenjadikorban,akanmenunjukkkangejala
"chlorosis",pucat.
Untukmengurangikejahilannya,muatandua++itudiberangusdengansuatu"chelatingagent",
bernamaEDTA,ethylenediamintetraaceticacid.SetelahterjinakkanunsurFetersebut,untuk

pertamakalinyapetanidapatberproduksidenganbaik,tanpaharusadagejalaklorosis.Tetapi
keadaanyangmembahagiakanituberlangsungmulaipH5,5.
Kesulitantimbul,ketikaangkapHnaikkarenapertumbuhanyangpesat,yangmenyebabkan
persentasekelattidaklagi100%,terjadipresipitasiatauendapan,yangmenghasilkangejala
klorosis,disusuldengantersumbatnyadripperpenetes.
Denganperkembanganteknologi,sekarangdiciptakanFeEDTAyangdapatstabilantarapH4
9.BeberapapekebunBelandamenggunakankelatferrumyangnilaibiologisnyalebihunggul,
danstabilpadapHyangtinggi,yangbernamaDTPA,dancukupmenggunakan12ppm,dan
bukan35ppm,untuktiap1.000llarutanABmix.Tetapihargakelatnyadobel.
Dimasapertumbuhansangatpesat,dimanapHkadangnaikdanmencapaiangka7,0,maka30
50%dariDTPAdigantidengankelatEDDHA,yanglebihcanggihlagi,misalnyauntuk
menghadapipH10,tetapisayangnyatidakdisebutkanuntukbudidayamacamdanjenis
tanamanapa!Danhargakelatnya,alaMak!

ECMETERdenganmS/cmatauTDSMETERdenganppm?
(SadurandariCatatanKecilno.7,Revisededition)

Duaduanyabisadigunakan!Yaituuntukmengukurkepekatannutrisimelaluipenghantaran
listrik,antarakatoda+dananoda,dandipasangdenganjarak1cm.Parameternyaialah
mS/cm,yangdapatdibacapadamonitornya.Alatnyabernama"electroconductivitymeter","EC
meter",daankeduahurufditulisdenganhurufbesar.
AdapabrikyangmenambahkansuatumekanismedidalamECmeteritu,yangmenterjemahkan
parametermS/cmmenjadippm,dandapatdibacapadamonitornya.AlatinidiberinamaTDS
meter,"Totaldissolvedsolids"meter.Tetapibedapabrik,bedaangkakonversinya,a.l.500,630,
640,650,670,700.SatularutanABmixsaya,bisaterbacadenganberbagaiangkappm!
Terpaksasayamengadakanpilihan.SayakemudianmenganutmashabECdenganmS/cm,dan
meninggalkanTDSdenganppmnya!Boleh,dong!

PENGGUNAANpHDANECYANGMANTAPSEPANJANGWAKTU.
(SadurandariCatatanKecilno.8,RevisedEdition).

Budidayahidroponikdenganmedia,misalnyapolybagkapasitas5literarangsekam,diisi
dengantanamanmelon,dijajarkansepanjangkirikananslangpolyethylene19mm,dengan
jaraktanam60cm,ditancapi"nipple",yangdisambungdengan"spaghettytube"ke"regulating
stick",dansecarairigasitetesditeteskanlahlarutanABmixdenganEC3,0mS/cm,pH5,8,dan
curah,"flowrate"1liter/jam,dijalankanpompa"submersible"beberapakali/hari,dengantotal
pemberian1liter/polybag/hari.TandonABmixnyadipendamdidalamtanah,supayaairnya

tetapdingin25oC,dilengkapipompasub,danlarutanditeteskankedalampolybagyang
ditanamimelon.Satucmdiatasdasarpolybagdilubangi,untukmengeluarkankelebihanlarutan
yangditeteskan,dandinamakan"throwtowaste",limbahataukelebihanlarutandibuang!Jadiair
yangditeteskanselamanyaberEC3,0,danberpH5,8,tanpaberubah.
Apadipolybagadaperubahan?Ada!YaituAKUMULASI,penumpukanlarutanyangberlebihan
haridemihari.Malahaninibisamenjadi"blessing",karenasemakintanamanberumur,ia
memerlukanpupukyangextrabanyak,untukberbunga,berpentil,pembesaranbuah,
pemasakanbuah.PuntanamansemakinkuatterhadapECyangtinggi,tidakakanterjadi
gosong.PokoknyatanamanselalumendapattetesanlarutanABmixyangmantapECdan
pHnya!

AKUMULASIEKSUDATTANAMANYANGMENJADITOKSIN

Topikyangakandibicarakaninibelumsayatemuidibukufisiologitumbuhanmanapun
karenanyahanyamerupakanteoremadarisayayanghanyaberdasarkanlogika,dantidakdilatar
belakangiangkaangkahasilpenelitian,sehinggaterserahpadaAndauntukmempercayainya!

Manusiatiaphariberakdankencing,dantoilet/kakusitudi"flush",disebor,hilanglenyaplah
"eksudat"tadikedalamseptiktank.Beres!
Tanamandihidroponik(ataupunditanah)tiapwaktujugaberakdankencing,tetapipadaNFT
(NutrientFilmTechnic,HidroponikTalangLandai),adasirkulasi,yaitularutanituberulang
kembalidisuapkanpadatanamanitujuga,dengantiapkaliadapeningkatankadareksudat.Ada
yangmengatakansirkulasiituberlangsungtiap15menit,danadayangmengatakandiperlukan
waktu2jamuntuklarutanitudijejalkankembalipadatanamanyangsama.
Pokoknya,dalamwaktusatuminggusajaakumulasieksudattelahmencapaisuatukonsentrasi
yangamattinggi,danyangsudahmerupakanracunbagipertumbuhantanamanpokok.
Tanamanstagnanderajatpertumbuhannya,bentukdanpenampakannyaamorf(tanpabentuk),
ataumalformasi(bentuknyamenyimpangdariseharusnya),berlekukdankeriting,kerdil,dan
akhirnyagagaljual.
Kalautandonataureservoirlarutanpupuknyakecil,makahanyadalamseminggusudahharus
dibuanglarutanpupukitudanharusdigantidenganyangbaru.Kalautandonnyabesar,mungkin
baruduabulankemudianpengurasanharusdilakukan.Singkatnya:Tandonharusbesar.
Pengurasanharusdilakukanseseringmungkin.Limbahlarutanpupukitumasihbisa
dimanfaatkanuntukmenyiramsawahataupohonpisangyangtumbuhdidekatnya.

USAHAMENETRALKANEKSUDAT.

Ketikakecil,kalauIbumelihatsayagarukgaruk,Ibulangsungmenanyaapakahgatal?Kemudian
dengancepatmembukalemariobatdanmengambil"kalktablet",tabletkapur/kalsium,dansaya
disuruhmenelannyasebutir.Tidaklamakemudianrasagatalitulenyap.Ruparupanyakalsium
mengikatracun/toksin,ataumenetralkannya,sehinggarasagatallangsunghilang.
Suatuliteraturpernahsayajumpaiyangmenyatakan,bahwasalahsatuperanCa,kapur,dalam
fisiologitumbuhan,ialahmenetralkantoksin/eksudatyangberadadalamtanaman,sehingga
tidakbisalagimengganggupertumbuhantanaman.Andaikatapendapatitubenar,makakita
pakaisajaCalciumammoniumnitrate,5Ca(NO3)2.NH4NO3.10H2O,yangkandunganunsur
Canya19%,misalnyasebanyak1.000guntuktiap1.000llarutanABmix,sehingga
kandunganCanyamenjadi190ppm,dandianggapcukupuntukmenetralkanracun/toksinyang
beradadalamlarutanABmixyangAndasedanggunakan.Itukalauteoriinibenaradanya!Patut
dicoba,untukmemperpanjangumurpakailarutanABmixdalamtandonlarutanpupuk.