Anda di halaman 1dari 74

LAPORANMAGANG

DIPT.INDOFOODSUKSESMAKMURTbk
SEMARANGJAWATENGAH
(PENGENDALIANMUTUMIEINSTAN)

DiajukanUntukMemenuhiSebagianPersyaratan
GunaMencapaiGelarAhliMadya
ProgramStudiTeknologiHasilPertanian
FakultasPertanian
UniversitasSebelasMaretSurakarta
OLEH:
TeresiaIsmianik
H.3106066
PROGRAMSTUDIDIPLOMAIIITEKNOLOGIHASILPERTANIAN
FAKULTASPERTANIAN
UNIVERSITASSEBELASMARET
SURAKARTA
2009

LEMBARPENGESAHAN

LAPORANMAGANG

DIPT.INDOFOODSUKSESMAKMURTBK
SEMARANGJAWATENGAH
(PENGUJIANMUTUMIEINSTAN)
OLEH:
TERESIAISMIANIK
H3106066

Telahdipertahankandihadapandosenpenguji
Padatanggal.............
Dandinyatakanmemenuhisyarat
Menyetujui,

Pembimbing/PengujiI

PengujiII

RohulaUtami,STP.MP

NIP.132327427

Ir.Kawiji,MP
NIP.131.570.295

DekanFakultasPertanian

KATAPENGANTAR
Prof.Dr.Ir.H.SuntoroW,MS
NIP.131.124.609

Moto
Pembicaraan yang terarah dapat membangun serta
membina pandangan, pertumbuhan dan kesatuan.
Seorang sahabat menaruh kasih setiap waktu dan
menjadi saudara di dalam kesukaan.
Kehidupan akan begitu kejam ketika manusia
merasakan kegelapan, hidup suram tiada arti? Hadapi
rintangan, karena tuhan mempunyai rahasia.
Pantang di ucap kata terlambat untuk sebuah sukses
bila masih ada keyakinan didada balut dengan
emangat dan kemauan, pastikan melalui keberanian
untuk mencoba sukses pasti teraih.
Seseorang meraskan kebahagiaan dan arti cinta
sesungguhnya apabila dia masih mau menghargai
kasih sayang orang lain yang diberikan padanya,
tanpa itu kekecewaan yang akan dirasakan.
^ TERE ^

PERSEMBAHAN
Tuhan yang Maha Esa Yang telah melimpahkan segala
rahmat dan karunianya sehingga laporan ini dapat
terselesaikan.
Bapak dan ibukq yang tercinta terima kasih atas
pengorbanan dan kasih sayang serta bimbingan dan
doa yang engkau berikan dalam kelangsungan hidup
yang penuh dengan rintangan ini.
Kakak2 q(mbak Maria, mbak Punden, mbak Nunik,
mas Handho, mas Tejo, mas Aris, )trima kasih atas
dorongan serta Doanya.
Bapak dan Ibu Dosen yang telah membimbing selama
study di Universitas Sebelas Maret Surakarta.
Konco2 q Thp006 (Neng yang pualing baik,, Tri si
sipit, Nurul endut, Ratih, Widi, dll ) yang tidak bias
saya sebutkan satu persatu, trima kasih atas
kebersamaannya, memberi semangat untuk
melangkah kedepan dan selalu menghibur dan
mendengar keluh kesahq, yang memberikan kenangan
terindah yang tak mungkin terlupakan.
Sebo q terima kasih atas kasih sayang dan perhatian
yang kamu berikan sehingga memberi semangat buat
q selama ini.
Kawan2 q seperjuangan semoga tetap semangat dan
selalu meneriakkan kata Merdeka

KATAPENGANTAR
Dengan mengucap puji syukur alhamdullilah kepada Tuhan Yang Maha Esa yang telah
memberikanrahmatdanhidayahNyakepadapenulis,sehinggapenulisdapatmenyelesaikantugasini
denganbaik.
LaporanMagangyangberjudulQualityControldiPT.IndofoodSuksesMakmurTbk,cabang
Semarang,inidibuatuntukmemenuhisalahsatusyaratdalammendapatkangelarAhliMadya.
DidalampenulisanLaporanMaganginiternyatatidakdapatterlepasbantuandariberbagai
pihakuntukitupenulismenyampaikanrasaterimakasihkepada:
1.

Prof.Dr.Ir.H.Suntoro,MSselakuDekanFakultasPertanianUniversitasSebelasMaretSurakarta
yangtelahmemberikanijinmagang.

2.

BapakIr.BambangSigitA,M.SiselakuketuaProgramStudyDIIITeknologiHasilPertanian
FakultasPertanianUniversitasSebelasMaret

3.

RohulaUtami,STP.MP.DosenPembimbingyangtelahberkenanmembimbingpenulisdalam
menyusunlaporanini.

4.

Ir.Kawiji,MPselakuDosenPengujiIITugasAkhir.

5.

DosendanStafDIIITeknologiHasilPertanianUniversitasSebelasMaretyangtelahmemberi
petunjukdanpengarahandalammenyusunlaporaninihinggaselesai.

6.

Ibu Kartika Rini selaku PD Quality Control di PT. Indofood Sukses Makmur Tbk, cabang
semarangselakupembimbinglapanganyangmengijinkanpalaksanaan

7.

SemuastafdibagianQC(QualityControl),bahanbaku,prosesproduksi,danbarangjadidiPT.
IndofoodSuksesMakmurTbk,yangtelahbanyakmembantumagang.

8.

Semua pihak yang tidak dapat penulis sebutkan satu persatu yang telah membantu dalam
penulisanLaporanMagangini.
Namun demikian, penulis menyadari bahwa dalam penulisan Laporan Magang ini masih

terdapatkekurangan.Olehkarenaitupenulisberharapkritikdansaranyangmengarahketingkatyang
lebihbaik.
Sebagaiakhirkata,mudahmudahanLaporanMaganginibermanfaatbagipenuliskhususnya
danpembacapadaumumnya.
Surakarta,Juli2009
Penulis

DAFTARISI

Halaman
HALAMANJUDUL......................................................................................

HALAMANPENGESAHAN........................................................................

ii

MOTTO..........................................................................................................

iii

PERSEMBAHAN...........................................................................................

iv

KATAPENGANTAR....................................................................................

DAFTARISI...................................................................................................

vi

DAFTARTABEL...........................................................................................

ix

DAFTARGAMBAR......................................................................................

BABI

BABII

PENDAHULUAN.........................................................................

A. LatarBelakang.................................................................................................

B. TujuanMagang.................................................................................................

TINJAUANPUSTAKA................................................................
A. Mieinstan

..................................................................................................5

B. BahanPembuatMie.........................................................................................

a.BahanUtama..............................................................................................

b.BahanTambahan........................................................................................

C. ProsesProduksiPembuatanMieInstan...........................................................

D. PengawasanMutu(QualityControl)...............................................................

11

BABIII TATALAKSANAPELAKSANAAN.........................................

18

A. WaktudanTempatkegiatanMagang...............................................................

18

B. MetodePelaksanaan........................................................................................

18

C. TehnikPengumpulanData..............................................................................

18

D. AspekYangDipelajari.....................................................................................

19

BABIV HASILDANPEMBAHASAN....................................................

20

A. KedaanUmumPerusahaan..............................................................................
1. SejarahdanStatusInstansi...............................................................................
2. LokasiPabrik

20

20
20

3. KeadaanAlam

21

4. VisidanMisiPerusahaan.................................................................................
B. ManajemenPerusahaan....................................................................................

21
22

1. StrukturdanSistemOrganisasi........................................................................

22

2. HakdanKewajibanKaryawan.........................................................................

24

3. KetenagaKerjaan ............................................................................................25
4. KesejahteraanKaryawan..................................................................................

27

5. PeningkatanSDMTenagaKerja.....................................................................

27

C. AspekAspekQualityControl..........................................................................

27

1.

PengendalianBahanBaku(RawMaterial)................................................

27

2.

PengendalianProsesProduksiMieInstan................................................

31

3.

PengendalianPemeriksaanProdukJadi(OutGoingQualiyControl).....

41

4.

Penyimpanan ............................................................................................44

D. MesindanPeralatanyangdigunakan...............................................................
1. Screw

47

2. Mixer

47

3. DoughFeeder

47

47

4. DS(DoughSheet) ............................................................................................47
5. LaminateRoller ............................................................................................48
6. ContinousRoller ............................................................................................48
7. Slitter

48

8. Steamer

48

9. Cutter

49

10. Fryer

49

11. Cooler

49

12. Packer

49

13. EtiketSealingMachine....................................................................................

50

14. CartonSealingMachine..................................................................................

50

E. SanitasiPerusahaan..........................................................................................

51

1. SanitasiBangunan............................................................................................51
2. SanitasiPeralatan ............................................................................................51

3. SanitasiTenagaKerja.......................................................................................
F. PengolahanLimbah.......................................................................................

BABV

52
52

1. MacamMacamLimbah...................................................................................

52

2. PengolahanLimbah.........................................................................................

53

PENUTUP.....................................................................................

56

A.

Kesimpulan.......................................................................................

56

B.

Saran.................................................................................................

57

DAFTARPUSTAKA.....................................................................................
LAMPIRAN

58

DAFTARTABEL

Tabel4.1

SyaratMutuTepungTeriguBerdasarkanSNI0137511995...........................

28

Tabel4.2PersyaratanStandarKualitasTepungTapioka...............................................29
Tabel4.3

SyaratMutuKualitasTepungTapiokaSNI0129051992..............................

29

Tabel4.4

KomposisiMinyakGoreng.............................................................................

40

Tabel4.5InformasiNilaiGiziMieInstanProdukIndomiePT.IndofoodSuksesMakmurTbk
......................................................................................................44
Tabel4.6

SyaratMutuMieinstanMenurutSNI01035520..........................................

45

Tabel4.7

JenisProdukdiPT.IndofoodSuksesMakmurTbk.........................................

46

DAFTARGAMBAR
Gambar2.1 BaganProsesPembuatanMieInstan..............................................................

12

Gambar4.1 DiagramAlirKualitatifProsesProduksiMieInstan......................................

32

Gambar4.2 DiagramAlirKuantitatifProsesProduksiMieInstan.....................................

33

Gambar4.3 DiagramAlirProsesPengolahanLimbahCair................................................

54

BABI
PENDAHULUAN
A.

LatarBelakang
Tanaman yang termasuk bijibijian yang banyak digunakan oleh
manusia adalah dari jenis serealia. Jenis serealia yang penting antara lain
gandum, jagung dan padi. Pada dasarnya serealia merupakan sumber
karbohidrat walaupun mengandung protein, lemak beberapa vitamin dan
mineral.
Salah satu produk olahan serealia yang paling banyak dimanfaatkan
adalahtepungteriguyangberasaldaribahandasargandum.Keistimewaan
tepung terigu diantara serealia lainnya adalah kemampuannya membentuk
glutenpadasaatterigudibasahidenganair.Tepungterigubanyakdigunakan
untukprodukprodukpangansalahsatunyaadalahmieinstan.
DalamStandarNasionalIndonesia(SNI)nomor35511994,mieinstan
didefinisikansebagaiprodukmakanankeringyangdibuatdaritepungterigu
denganatautanpapenambahanbahanmakananlaindanbahantambahanlain
danbahanmakananyangdiizinkan,berbentukkhasmidansiapdihidangkan
setelahdimasak atau diseduhdenganairmendidihpalinglama4menit.Mie
instanumumnyadikenalsebagairamen.Mieinidibuatdenganpenambahan
beberapa proses setelah diperoleh mie segar. Tahaptahap tersebut yaitu,
pengukusan,pembentukan,danpengeringan.Kadarairmieinstanumumnya
mencapai 58% sehingga memiliki daya simpan yang lama
(MadeAstawan,2003).
Miemerupakanjenismakananyangsudahbegituakrabbagisebagian
besar lidah orang Indonesia, bahkan dunia. Makanan yang banyak
mengandung karbohidrat ini menggantikan fungsi nasi sebagai makanan
pokok.Teksturmieyangkenyal,dapatmenyenangkan,dancaramemasaknya

yangpraktismembuatmakananinibanyakdigemari.MeskipunbukanmakananasliIndonesia,bisa
dibilang mie sudah menjadi makanan pokok kedua bagi sebagian besar masyarakat Indonesia.
Keragamanjenismiedenganberbagaivariasicaramemasaknyamenjadikanmietetapmemiliki
banyakpeminat.Miedapatdimasakdengandicampurberbagaibahantambahansehinggamenjadi
lebihvariatifdantidakmembosankan.(Yuyun,2008). Salahsatuperusahaanmieyangberadadi
IndonesiayaituPT.IndofoodSuksesMakmurTbk,NoodlesDivision.Produkmieyangdiproduksi
oleh PT. Indofood Sukses Makmur Tbk, Noodles Division yaitu Indomie, Sarimi, Supermi,
Nikimiku dansakura.Kelimajenis produkinimempunyaitingkatdayajual/pangsapasar yang
berbedabedadanmerkIndomieyangpalinglakudipasaransedangkanproduklainnyadibawah
Indomie. Selain itu, produkproduk yang dihasilkan oleh PT. Indofood Sukses Makmur Tbk,
NoodlesDivision lebihmenguasaipasarbiladibandingkandenganperusahaanmieinstanlainnya
halinidapatdilihatdaritingkatpenjualanprodukmieinstandiPT.IndofoodSuksesMakmurTbk,
NoodlesDivision.
Pengawasanmutumerupakankegiatanuntukmemastikanapakahkebijaksanaandalamhal
mutu(standar)dapattercermindalamhasilakhir.Dengankatalainpengawasanmutumerupakan
upaya untuk mempertahankan mutu dari bahan yang dihasilkan agar sesuai dengan spesifikasi
produkyangditetapkanberdasarkankebijaksanaanpimpinanperusahaan.Dalampengawasanmutu
inisemuaprestasibarangdicekmenurutstandardansemuapenyimpanganpenyimpangandicatat
dandianalisa(Assauri,1980).
Aktivitas kendali mutu terpadu harus ada dalam semua operasi utama yaitu pemasaran,
rekayasa rancangan, produksi, hubungan industrial, pelayanan, dan bidangbidang pokok yang
serupa. Setiap upaya perbaikan mutu dan pemeliharaan mutu baik itu berupa perubahan dan
perlengkapandantenagakerja,dalamstrukturyangsalingberhubungan,dalamarusinformasi,atau
dalammanajemendanpengendalianfungsifungsiini,harusmemenuhisyaratbaikuntukkontribusi
terhadapdirinyasendirimaupunkontribusiterhadapkeefektifanmututerpadu(Feigenbaum,1992).
Sebuahperusahaanmakanan/minumandituntutuntukmenghasikanprodukyangberkualitas
seehinggaperluadanyapengendalianmutuprodukpangan.Untukmenunjangdanmemperlancar
prosesmutuprodukpangandiperlukankaryawanyangditempatkanpadabagianQCdanQA
karenaQCdanQAmenurutHadiQCdanQAmerupakanbagiandaripengendalianmutu.QCdan
QAseringdiartikansebagai2halyangsama,padahalQCdanQAmempunyaiperbedaanyang
sangat nyata sesuai dengan ISO 8402, QA (Quality Assurance) adalah seluruh kegiatan yang

sistimaikdanterencanayangditerapkandalamsistimmutusertadidemonstrasikanjikadiperlukan,
untuk memberikan suatu keyakinan yang memadai bahwa suatu produk/jaa akan memenuhi
persyaratanmutu.Denganmenggunakanbahasayanglebihsederhana.QAadalahsegalasesuatu
yang dilakukan baik didalam maupun diluar laboratorium, untk mencapai suatu produk yang
bermutu.SedangkanQCadalahtehnikoperasionaldankegiatanyangdigunakanuntukmemenuhi
persyaratanmutu.DengankatalainQCadalahsuatutahapandalamproseduryangdilakukanuntuk
mengevaluasisuatuaspekteknispengujian.KarenaituQCmerupakanpengendalian,monitoring,
pemeriksaanyangdilkukanuntukmemastikanbahwasistemmutuberjalandengnbenar.Darikedua
deviisitersebutjelasbahwaQCmerupakanbagiandariQA(Hadi,2000).
Untuk memperlancar arus barang dari produsen ke konsumen perusahaan tidak hanya
dituntutuntukmembuatbarangyangsesuaidenganselerakonsumen,tapidituntutpulaagarbarang
yangdihasilkankualitasnyabaik.Apabilakualitasbarangtersebutkurangbaikmakakonsumen
akanmenjadikecewasehinggasatupersatupelangganakanpindahkebaranglain.Olehkarenaitu,
setiap perusahaan harus melakukan pengawasan yang baik terhadap kualitas dari barang yang
dihasilkan,sebabtidakjarangperusahaanyangjatuhhanyakarenatidakmampumempertahankan
kualitasnya. Setiap perusahaan hendaknya memperhatikan dan mengawasi setiap hal dan setiap
kegiatanyangdapatmempengaruhikualitasdariproduksinyamulaipembelianbahanbakusampai
barangtersebutdibeliolehkonsumenkonsumennya.Setiapkegiatanyangberpengaruhterhadap
kualitasdariproduksinyaperusahaanharusmelakukanpengawasanyangketatdansempurna,sebab
sebagiandaripadanyawaperusahaanterletakdisini(Nitisemito,1981).
Pengontrolan terhadapkualitasprodukmenjadifaktoryangsangatpentingkarenadengan
kualitasyangbaikakanmenumbuhkankepercayaankonsumen.Kepercayaankonsumenmerupakan
asetyangsangatberhargabagiprodusenuntukkemajuanusahanya.MelaluiKegiatanmagangini
diharapkan mahasiswa dapat memahami aspek Quality Control sebagai bahan penting dari
keseluruhankegiatan,dimanapadakesempataninitopikkajiandiambilpadalokasiPT.Indofood
SuksesMakmurTbkSemarangJawaTengah,yaituprodukmieinstan.
B.

TujuanKegiatanMagang
5. MengetahuidanmemahamiprosespengolahanmieinstandiPT.IndofoodSuksesMakmurTbk,
NoodlesDivisionCabangSemarang.

6. MengetahuidanmemahamipengendalianmutumieinstandiPT.IndofoodSuksesMakmur
Tbk,NoodlesDivisionCabangSemarang.

BABII
TINJAUANPUSTAKA

5. MieInstan
MiemerupakansalahsatujenismakananyangsangatpopulerdiAsia,
khususnya Asia Timur dan Asia Tenggara. Menurut catatan sejarah, mie
dibuatpertamakalididaratanCinasekitar2000tahunyanglalupadamasa
pemerintahan Dinasti Han. Dari Cina, mie berkembang dan menyebar ke
Jepang, Korea, Taiwan, dan negaranegara di Asia Tenggara termasuk
Indonesia.DiBenuaEropa,miemulaidikenalsetelahMarcopoloberkunjung
keCinadanmembawaoleholehmie.Selanjutnya,mieberubahmenjadipasta
diEropa,sepertiyangdikenalsaatini(Suyanti,2008).
Dalam Standar Nasional (SNI) nomor 33511994, mie instan
didefinisikansebagaiprodukmakanankeringyangdibuatdaritepungterigu
dengan atau tanpa penambahan bahan makanan lain dan bahan tambahan
makananyang diizinkan,berbentukkhas miedansiapdihidangkansetelah
dimasakataudiseduhdenganairmendidihpalinglama4menit.Mieinstan
umumnya dikenal sebagai ramen. Mie ini dibuat dengan penambahan
beberapa proses setelah diperoleh mie segar. Tahaptahap tersebut adalah
pengukusan,pembentukan,danpengeringan.Kadarairmieinstanumumnya
mencapai5%8%sehinggamemilikidayasimpanyanglama.
Berdasarkanprosespengeringan,dikenalduamacammiepengeringan
dengancaramenggorengmenghasilkanmieinstan(instantataufriednoodle),
sedangkanpengeringandenganudarapanasdisebutmiekering(driednoodle).
Mie instan mampu menyerap minyak hingga 20% selama penggorengan
(dalamprosespembuatanmie)sehinggamieinstanmemilikikeunggulanrasa
dibandingmiejenislain.Namundemikian,mieinstandiisyaratkanagarpada
saatperebusantidakadaminyakyangterlepaskedalamairdanhasilnyamie

haruscukupkompakdanpermukaannyatidaklengket(Astawan,1999).

6. BahanPembuatMie
g. BahanUtama
Tepungterigumerupakanbahandasarpembuatanmie.Tepungterigudiperolehdaribiji
gandum(Triticumvulgare)yangdigiling.Keistimewaanterigudiantaraserelialainnyaadalah
kemampuannyamembentukglutenpadasaatterigudibasahidenganair.Sifatelastisglutenpada
adonanmimenyebabkanmieyangdihasilkantidakmudahputuspadaprosespencetakandan
pemasakan.Biasanyamututeriguyangdikehendakiadalahteriguyangmemilikikadarair14%,
kadarprotein8%12%,kadarabu0,250,60%,danglutenbasah24%36%(MadeAstawan,
1999).
Berdasarkankandunganproteinnya(gluten),terdapat3jenisteriguyangadadipasaran,
yaitusebagaiberikut:
a. Teriguhardflour
Terigujenisinimempunyaikadarprotein1213%.Jenistepunginibanyakdigunakanuntuk
membuatmidanroti.Contohnyaadalahterigucapcakrakembar.
b. Terigumediumhardflour
Jenis tepung ini mengandung protein 9,5%11 %. Tepung ini banyak digunakan untuk
campuranpembuatanmie,roti,dankue.Contohnyaadalahterigucapsegitigabiru.
c. Terigusoftflour
Jenis terigu ini mengandung protein 7%8,5 %. Jenis tepung ini hanya cocok untuk
membuatkuecontohnyaadalahterigucapkunci(Suyanti,2008).
Tepung terigu berfungsimembentukstrukturmiekarenaglutennyadapatmembentuk
strukturtigadimensisebagaipembentukkerangka.Kandunganproteintotaldalamgandum7%
18%, lebih kurang 80% penyusun protein adalah fraksi gluten yang merupakan pembentuk
strukturkerangka(Nitasari,2003).
Padadasarnyatepungterigumengandungproteinyangmerupakanzatgiziyangpaling
penting. Dalam sel protein terdapat protein struktural dan metabolik, protein struktural
merupakanbagianintegraldaristrukturseldantidakdapatdiekstrasisehinggamenyebabkan
disintegrasiseltersebut.Proteinmetabolikdapatdiekstrasitanpamerusakintegrasistruktursel

itusendiri.DalammolekulproteinmengandungunsurC,H,O,danN(TatiNurmala,1980).
h. BahanTambahan
ix.

Tapioka
Tepung tapiokaadalahpatiyangdiperoleh dari ekstraksiubikayumelalui proses
pemarutan, pemerasan, penyaringan, pengendapan pati, dan pengeringan. Proporsi
penggunaanteriguuntukindustripengolahanmiediIndonesiarelatifbesar.Olehsebabitu,
pemanfaatantepungtapiokasebagaipensubstitusi(mengurangipenggunaan)terigudalam
pembuatanmiediharapkandapatmemberikeuntunganyangcukupbesar (MadeAstawan,
1999).Tepungtapiokabisadigunakansebagaibahanalternatifagarmietetapkenyal.Harga
tepung tapioka lebih murah dibandingkan dengan tepung terigu. Selain sebagai bahan
pembuatmie,tepungtapiokadapatdigunakansebagaidusting,yangbergunaagarmie
tidaklengketsaatdicetak(Yuyun,2008).
Patiadalahcadanganmakananutamapadatanaman.Senyawainicampurandaridua
polisakarida yaituamilosadanamilopektin,amilosaterdiridari70300unitglukosayang
berikatan membentuk rantai lurus. Kirakira 20% dari pati adalah amilosa. Sedangkan
amilopektin terdiri hingga 100.000 unit yang berikatan membentuk struktur rantai
bercabang(Bukkle,1985).
Pengembangangranulapatidalamairdingindapatmencapai25%30%dari berat
semula. Pada keadaantersebut granula patitidaklarutdalamairdingintetapiterbentuk
suspensi.Denganmakinnaiknyasuhususpensipatidalamairmakapengembangangranula
semakin besar. Mekanisme pengembangan tersebut disebabkan karena molekulmolekul
amilosa dan amilopektin secara fisik hanya dipertahankan oleh adanya ikatanikatan
hidrogenyanglemah.Atomhidrogendarigugushidroksilakantertarikpadamuatannegatif
atomoksigendarigugushidroksilyanglain(Muchtadiet.al,1988).

x.

Air
Airberfungsisebagaimediareaksiantaraglutendankarbohidrat,melarutkangaram,
danmembentuksifatkenyalgluten.Patidanglutenakanmengembangdenganadanya air.
Air yang digunakan sebaiknya memiliki pH antara 69, hal ini disebabkan
absorpsi air semakin meningkat dengan naiknya pH. Makin banyak air
yang diserap, mi menjadi tidak mudah patah. Jumlah air yang optimum
membentuk pasta yang baik (Anonim, 2009).

xi.

Garam
Garam berperan dalam memberi rasa, memperkuat tekstur mie, meningkatkan
fleksibilitas dan elastisitas mi serta mengikat air. Garam dapat menghambat aktivitas
enzimproteasedanamilasesehinggapastatidakbersifatlengketdantidakmengembang
secaraberlebihan(Winarno,F.G,1997).

xii.

SodaAbu
Soda abu merupakan campuran dari natrium karbonat dan kalium karbonat
(perbandingan 1:1). Soda abu berfungsi untuk mempercepat pengikatan gluten,
meningkatkan elastisitas dan fleksibilitas mie, meningkatkan kehalusan tekstur, serta
meningkatkansifatkenyal(MadeAstawan,1999).

xiii.

MinyakGoreng
Minyakdapatdigunakansebagaimediumpenggorenganbahan.Dalampenggorengan,
minyak berfungsi sebagai medium penghantar panas, menambah rasa gurih dan kalori
dalam bahan. Minyak yang telah rusak mengakibatkan kerusakan nilai gizi, tetapi juga
merusaktekstur,flavordaribahanyangdigoreng.Kerusakanminyakselamapenggorengan
akanmempengaruhimutudannilaigizibahanyangdigoreng.Minyakyangrusakakibat
proses oksidasi dan polimerisasi akan menghasilkan bahan dengan rupa yang kurang
menarikdancitarasayangtidakenak.Hasiloksidasilemakdalambahanpangantidak
hanya mengakibatkan rasa dan bau tidak enak, tetapi juga dapat menurunkan nilai gizi
karenakerusakanvitamin(karoten dan tokoferol)danasamlemakessensialdalamlemak
(Ketaren,1986).

14. ProsesPembuatanMiInstan
Tahapan pembuatan mie terdiri dari tahap pencampuran (mixing), pembentukan lembaran
(roll-sheeting), pembentukan untaian mie (slitting), pemotongan danpelipatan (cutting and
folding),pengukusan(steaming),penggorengan(frying),pendinginan(cooling)sertapengemasan
(packing)(Anonim,2008).
Tahappencampuranbertujuanagarhidrasitepungdenganairberlangsungsecarameratadan
menarik seratserat gluten. Untuk mendapatkan adonan yang baik harus diperhatikan jumlah
penambahanair(2838%),waktupengadukan(1525menit),dansuhuadonan(24400C)(Anonim,
2008).
Proses

roll-pressing/roll-sheeting

(pembentukan lembaran) bertujuan untuk

menghaluskanseratseratglutendanmembuatlembaranadonan.Pastayangdipresssebaiknyatidak
bersuhurendahyaitukurangdari250C,karenapadasuhutersebutmenyebabkanlembaranpasta
pecah-pecah dan kasar. Mutu lembaran pasta yang demikian akan menghasilkan
mie yang mudah patah. Tebal akhir pasta sekitar 1,22 mm. Di akhir proses
pembentukan lembaran, lembar adonan yang tipis dipotong memanjang selebar
12 mm dengan roll pemotong mie, dan selanjutnya dipotong melintang pada
panjang tertentu, sehingga dalam keadaan kering menghasilkan berat standar
(Anonim,2008).
Setelah pembentukan mie dilakukan proses pengukusan. Pada proses ini
terjadi gelatinisasi pati dan koagulasi gluten sehingga dengan terjadinya
dehidrasi air dari gluten akan menyebabkan timbulnya kekenyalan mie. Hal ini
disebabkan oleh putusnya ikatan hidrogen, sehingga rantai ikatan kompleks pati
dan gluten lebih rapat. Pada waktu sebelum dikukus, ikatan bersifat lunak dan
fleksibel, tetapi setelah dikukus menjadi keras dan kuat (Anonim,2008).
Pengukusandenganpemanasanakanmengakibatkanperombakanstrukturpatidanpenurunan
integritasgranulasehinggaterjadigelatinisasi.Secaraalamisenyawapatibersifattidaklarutdalam
airtetapimenyerapair1530%.Denganpeningkatansuhu,ikatanHantaramolekulamilosadan
molekul air cenderung lepas.Molekul airpada tingkat energilebih tinggi dapat memperlemah
strukturpatidansecarabertingkatterjadihidrolisismolekulpati.Selamamengembanggranulapati
melepaskanamilosadanbeberapamolekulamilopektinyangmempunyaiderajatpolimerisasilebih
kecildanmeninggalkangranulasecaradifusi(Kerr,1950).
Pengeringan adalah pengurangan sejumlah massa air dari suatu bahan. Pengeringan
merupakan proses penting dalam produksi pertanian yang bertujuan untuk meningkatkan nilai
ekonomiproduk,mengawetkanprodukselamapenyimpanan,memantapkankualitassepertiflavor,
nilainutrisisertamengurangivolumeproduk(Matz,1984).
Berdasarkanproses pengeringan,dikenalduamacammieinstan.Pengeringandengan cara
penggorengan menghasilkan mie instan goreng (instan fried noodle), sedangkan pengeringan
denganudarapanasdisebutmieinstankering(instandriednoodle).Mieinstangorengmampu
menyerapminyakhingga20%selamapenggorengan(dalamprosespembuatanmie)sehinggamie
instangorengmemilikikeunggulanrasadibandingkanmiejenislain.Namundemikian,mieinstan

goreng disyaratkanagarpadasaat perebusan tidak adaminyakyangterlepas kedalam air dan


hasilnyamieharuscukupkompakdanpermukaantidaklengket(MadeAstawan,2003).
Setelah pengukusan, mie digoreng dengan minyak pada suhu 1401500C
selama 60-120 detik. Tujuannya agar terjadi dehidrasi lebih sempurna
sehingga kadar airnya menjadi 3%5%. Suhu minyak yang tinggi menyebabkan
air menguap dengan cepat dan menghasilkan pori-pori halus pada permukaan
mie, sehingga waktu rehidrasi dipersingkat. Teknik tersebut biasa dipakai
dalam pembuatan mie instan (Anonim,2008).
Setelah digoreng, mie ditiriskan dengan cepat hingga suhu 400C dengan
kipas angin yang kuat pada ban berjalan. Proses tersebut bertujuan agar minyak
memadat dan menempel pada mie. Selain itu juga membuat tekstur mie
menjadi keras. Pendinginan harus dilakukan sempurna, karena jika uap air
berkondensasi akan menyebabkan tumbuhnya jamur (Anonim,2008).PadaGambar
2.1dapatdilihatbaganprosespembuatanmieinstan.
15. PengawasanMutu(QualityControl)
Pengawasanmutuadalahkegiatanyangmemastikanapakah kebijaksanaandalamhalmutu
(standar)dapattercermindalamhasilakhir,dengankatalainpengawasanmutumerupakanusaha
untukmempertahankanmutudaribahanyangdihasilkanagarsesuaidenganspesifikasiproduk
yang ditetapkan berdasarkan kebijaksanaan pimpinan perusahaan. Dalam pengawasan mutu ini
semua perfomance barang dicek menurut standar dan semua penyimpanganpenyimpangan dari
standardicatatsertadianalisasemua.Semuapenemuanpenemuandalamhalinidigunakansebagai
umpan balik (feed back) untuk para pelaksana sehingga mereka dapat melakukan tindakan
perbaikanpadamasayangakandatang(Assauri,1980).
Agribisnis menangani produk pertanian yang diproses industri sebelum memasuki pasar
sebagai produk industrial. Proses industrialnya berupa conditioning atau pemolesan maupun
processing atau pengolahan. Dari produk primernya atau bahan bakunya, produk akhirnya
merupakanprodukyangditingkatkanmutunyamelaluiprosesconditioningyaitupembersihan,
pemilahan, pengemasan, atau produk processing yang berubah sama sekali dari produk
primernya.Produkakhirdemikianlahyangakandihadapkanpadakonsumen(Sadjad,2001).Bagan
tahaptahapprosespembuatanmieinstandapatdilihatpadagambar2.1:

TepungTerigu

Pengadukan

Larutan

Pengepresan
(67langkah)DenganKetebalanYangDiinginkan
Pembelahan
(AdonanMieMenjadiUntaianYangBergelombang)

Pemotongan

Pencetakan

Pengeringan

Pendinginan

PengemasanDenganKemasanBiasa

MieInstanKemasan
Biasa

PengemasanCup

MieInstanKemasan
Cup

Gambar2.1BaganProsesPembuatanMieInstan(Jameset.al,1996).
Ditingkat perusahaan industri pengolahan, mutu berkaitan dengan pola pengelolaan dalam

industri. Citramutuprodukditegakkanolehpimpinanperusahaandandijagaolehseluruhbagian
atausatuankerjadalamperusahaanatauindustri.Dalamperusahaanindustripanganyangmaju
pengendalianmutusamapenting dengan prosesproduksi.Programprogrampengendalian mutu
akandidukungpenuholehpimpinanpuncakperusahaan,karenaprogramitumerupakanpenjabaran
yang terinci kebijaksanaan pimpinan perusahaan. Kelemahan pengendalian mutu pada industri
pangandapatberakibatfatal.Keteledoranbukansajaberakibatfatalbagiindustriyang
bersangkutanyaituperusahaanharusditutup,tetapikerugianitujugameluaskeperusahaansejenis,
pemerintah,masyarakatumumdannegara(Soekarto,1990).
Kualitasmenurutdefinisidari American SocietyforQualityControl adalahkeseluruhanciri
serta sifat dari suatu produk atau pelayanan yang berpengaruh pada kemampuannya untuk
memuaskankebutuhanyangdinyatakanatautersirat(Kotler,1997).
Pengawasan biaya harus mencakup kemungkinan terjadinya kerugiankerugian yang
disebabkanolehpemakaianbahanbakuyangrusakatausebagaiakibatkegiatanpelayananyang
kurang baik. Dalam sistem produksi, kegiatan pengawasan tidak dapat terlepas dari kegiatan
perencanaanagartujuanyangdiharapkandapattercapaidandalamkegiataninidigunakanmetode
StatisticalQualityControl(Kotler,1997).
Menurut Feigenbaum (1992), prosedur untuk mencapai sasaran mutu industri diistilahkan
dengan kendali mutu seperti halnya prosedurprosedur untuk mencapai sasaran biaya dan
produksi masingmasing diistilahkan sebagai kendali biaya dan kendali produksi. Pada
umumnyaadaempatlangkahdalamkendalitersebut,yaitu:
C.

Menetapkanstandar.Menentukanstandarmutubiaya,standarmutuprestasikerja,standar
mutukeamanan,danstandarmutuketerandalanyangdiperlukanuntukproduksitersebut.

D.Menilai kesesuaian. Membandingkan kesesuaian dari produk yang dibuat atau jasa yang
ditawarkanterhadapstandarstandarini.
E. Bertindak bila perlu. Mengkoreksi masalah dan penyebabnya melalui faktorfaktor yang
mencakuppemasaran,perancangan,rekayasa,produksi,danpemeliharaanyangmempengaruhi
kepuasanpemakai.
F. Merencanakan perbaikan. Mengembangkan suatu upaya yang kontinyu untuk memperbaiki
standarstandarbiaya,prestasi,keamanan,danketerandalan.
Penentuanmutumaupunkendalimutusebenarnyaterjadipadaseluruhdaurindustrial.Inilah
sebabnyamengapakendalimutuyangsebenarnyatidakdapatdicapaidenganberkonsentrasipada

pemeriksaan saja, atau rancangan produksi saja, atau pencarian gangguan yang mengakibatkan
penolakan saja, atau pendidikan operator saja, atau pengendalian pemasok saja, atau analisis
statistik saja, atau telah ketrampilan saja. Setiap unsurunsur yang ada ini sama pentingnya
(Feigenbaum,1992).
Aktivitas kendali mutu harus ada dalam semua operasi utama yaitu, pemasaran, rekayasa
rancangan,produksi,hubunganindustrial,pelayanan,danbidangbidangpokokyangserupa.Setiap
upayaperbaikanmutudanpemeliharaanmutubaikituperubahandalamperlengkapandantenaga
kerja,dalamstrukturyangsalingberhubungan,dalamarusinformasi,ataudalammanajemendan
pengendalian fungsifungsi ini harus memenuhi syarat baik untuk kontribusi terhadap dirinya
sendirimaupunkontribusiterhadapkeefektifankendalimututerpadu(Feigenbaum,1992).
Kendali mutu terpadu menyertakan tidak hanya aktivitasaktivitas kendali mutu secara
mendalam,tapiyangterpentingadalahsalingketergantunganantaraaktivitasmutumultifungsional
diseluruh organisasi. Atau, dalam bentuk definisi adalah dampak diterapkannya kendali mutu
terpadupadaseluruhorganisasimenyertakanimplementasimanajerialdanteknisdariaktivitas
aktivitasmutuyangberorientasikepadapelanggansebagaisuatutanggungjawabuntukmanajemen
umumdanpelaksanaangarispokokpemasaran,rekayasa,produksi,hubunganindustrial,keuangan,
danpelayanansertafungsikendalimutuitusendiri(Feigenbaum,1992).
Suatu kemampuan kendali mutu terpadu yang ampuh adalah salah satu keuntungan
kerekayasaandanmanajerialutamabagisebuahperusahaanmasakini,yangmenyediakansebuah
sendiutamabagikelangsunganhidupekonomi.Pelembagaankendalimututerpadusangatpenting
dalammemperluasdanmemperdalampekerjaandankonsepkendalimutudalamsebuahperusahaan
modern. Ini kemungkinan apa yang disebut manajemen mutu terpadu dapat mencakup seluruh
ruanglingkupdaurkehidupanprodukdanpelayananmulaidaripembentukankonsepproduk
hinggakeproduksidanpelayanankepadapelanggan(Feigenbaum,1992).
ISO9000adalahkumpulanstandaruntuksistemmanajemenmutu(SMM).Sebuahperusahaan
atauorganisasiyangtelahdiauditdandisertifikasisebagaiperusahaanyangmemenuhisyaratsyarat
dalam ISO 9001 berhak mencantumkan label "ISO 9001 Certified" atau "ISO 9001
Registered".SertifikasiterhadapsalahsatuISO9000standartidakmenjaminkualitasdaribarang
danjasayangdihasilkan. Sertifikasihanyamenyatakanbahwabisnisprosesyangberkualitasdan
konsistendilaksanakandiperusahaanatauorganisasitersebut.Walaupanstandarstandarinipada
mulanya untuk pabrikpabrik, saat ini mereka telah diaplikasikan ke berbagai perusahaan dan

organisasi,termasukperguruantinggidanuniversitas(Anonim,2008).
ISO9000mencakupstandarstandardibawahini:
B.

ISO9000:2005QualityManagementSystemsFundamentalsandVocabulary:mencakup
dasardasarsistemmanajemenkualitasdandaftarbahasadanistilahdalamkumpulanISO9000.

C.

ISO9001:2000QualityManagementSystemsRequirements:ditujukanuntukdigunakan
di organisasi manapun yang merancang, membangun, memproduksi, memasang dan/atau
melayaniprodukapapunataumemberikanbentukjasaapapun.Standarinimemberikandaftar
persyaratanyangharusdipenuhiolehsebuahorganisasiapabilamerekahendakmemperoleh
kepuasan pelanggan sebagai hasil dari barang dan jasa yang secara konsisten memenuhi
permintaan pelanggan tersebut. Implementasi standar ini adalah satusatunya yang bisa
diberikansertifikasiolehpihakketiga.

D.

ISO9004:2000QualityManagementSystemsGuidelinesforPerformanceImprovements:
mencakup perihal perbaikan sistem yang terusmenerus. Bagian ini memberikan masukan
tentang apa yang bisa dilakukan untuk mengembangkan sistem yang telah terbentuk lama.
Standar ini tidaklah ditujukan sebagai panduan untuk implementasi, hanya memberikan
masukansaja(Anonim,2008).
ISOmencatat"Perhatianterhadapsertifikasiseringkalimenutupifaktabahwaterdapatbanyak

sekalibagiandalamkumpulanstandarISO9000.Suatuorganisasiakanmeraupkeuntunganpenuh
ketikastandarstandarbarudiintegrasikandenganstandarstandaryanglainsehinggaseluruhbagian
ISO9000dapatdiimplementasikan".Sebagaicatatan,ISO9001,ISO9002danISO9003telah
diintegrasikan menjadi ISO 9001. Kebanyakan, sebuah organisasi yang mengumumkan bahwa
dirinya"ISO9000Registered"biasanyamerujukpadaISO9001(Anonim,2008).
Di Indonesia, yang mengeluarkan sertifikat halal adalah Majelis Ulama Indonesia (MUI),
perananLembagaPengkajianPanganObatobatandanKosmetika(LPPOMMUI)adalahsebagai
tenagaprofesionalyangmembantumemberikanpertimbanganteknologi/pengetahuantekniskepada
MUI dan membantu masyarakatdalam memproduksi makanan yang halal serta memperoleh
sertifikat sshalal. Proses pengurusan sertifikat halal diajukan melalui LPPOMMUI dan akan
diperiksakelengkapanberkasnyaterlebihdahulu.Bilaberkaslengkap,selanjutnyadiadakanaudit
lapangan.Apabilaauditlapangandanberkassinkrondantidakditemukanhalhalyangmeragukan,
maka prosespenetapansertifikathalaldilakukanolehkomisifatwaMUI.Adatigajenis usaha
pengolahanpanganyangmenjadisasaranutamabagisertifikasihalal,yaitu:

1. Restoran/rumah makan, setiap restoran/rumah makan seyogyanya memiliki sertifikat halal


sebagai jaminan keamanan batin bagi konsumen. Yang disertifikasi adalah bahan baku dan
prosesyangterjadiselamapembuatanmakanan,penyajiandanperalatanyangdigunakan.
2.Rumahpotonghewan(RPH),dagingyangtidakdisembelihdenganbenarsecarasyarimaupun
niathukumnyajatuhmenjadibangkaidanharamuntukdimakan.Penyembelihanyangbenar
mewajibkanterputusnyanadi(vena/arteri),saluranmakanan(kerongkongan),dansaluranudara
(tenggorokan).Selainprosespemotongan,jugapemotongnyaharusdisertifikasi.
3.Makanandalamkemasan,adalahmakananyangdidistribusikanbaiksiapolahmaupunsiapsaji
dalamkemasanplastik(polyprophylene,polyethylene,polyethylenetreftalat,retortpouch,gelas
plastik),kaleng,kertas(tetrapack,dsb). Selainperusahaannyamendapatkansertifikathalal,
jugadiperlukanizinpencantumanlabelhalaldariBadanPOM(PengawasanObatMakanandan
Kosmetika)(Anonim,2008).
Pencantumanlabelhalaltidakbolehdilakukansendiritanpasertifikasidanizin.Industri
milik pengusaha muslim belum tentu menghasilkan produk yang halal. Pak haji belum tentu
memproduksimakananhalal.Sebagaipayunghukum,masalahsertifikasidanpencantumanlabel
halaldiaturdalam:
1. UUno7/1996tentangPangan,
2. UUno8/99tentangPerlindunganKonsumen,hukumannyamax.5thkurunganataudendamax.
2milyar,
3. UUno23/92tentangKesehatan,
4. PPno28/2004,tentangPencantumanLabelPangan.
Perusahaantidakbisamainmaindalampencantumanlabelhalal,pressreleaseharamnya
sebuahprodukpangandapatmenyebabkankebangkrutanindustri,contohnyaAjinomoto(sekarang
sudah halal), Hokahoka Bento (terlambat memperpanjang sertifikasi). Sertifikasi halal dapat
dicabutsewaktuwaktuolehLPPOMMUIapabilaterjadipelanggaranmisalnya,pergantianbahan
baku, ditemukanketidaksesuaianantaraprosesyangdisertifikasidanprakteknya,danpenipuan
(Anonim,2008).

BABIII
TATALAKSANAPELAKSANAAN
G. WaktudanTempatKegiatanMagang
KegiatanmaganginidilaksanakandiPT.IndofoodSuksesMakmurTbk
Jl.TambakAjiIINo.08POBOX1271SemarangJawaTengah.Kegiatan
maganginidilaksanakanmulaitanggal4Mei2009Sampaidengantanggal21
Mei2009.
H. MetodePelaksanaan
Kegiatan magang dilaksanakan dengan metode terjun langsung ke
lapangan dalam kegiatankegiatan pengawasan mutu sesuai dengan aspek
tujuan.
I. TeknikPengumpulanData
G.

Wawancara

Wawancana dilaksanakan untuk menggali informasi tentang perusahaan


dantopikyangberkaitandengankendalimutu(QualityControl) dengan
menanyakanlangsungkepadapihakpihakyangterkait.
H.

Observasi
Mengadakan pengamatan langsung dari lokasi magang terutama yang
berkaitandenganaspekkendalimutu(QualityControl)yangditerapkandi
PT.IndofoodSuksesMakmurTbkSemarang,JawaTengah.

3. Pencatatan
Mencatat data sekunder dari sumbersumber yang dapat dipertanggung
jawabkandanmendukungkegiatanmagang.Jenisdatasekunderantara
laindatamengenaikondisiumumPerusahaanIndofoodSuksesMakmur
Tbk, sejarah berdirinyaperusahaan, struktur organisasi perusahaan, dan
datalainnyayangberkaitandengantujuanmagang.

4. StudiPustaka
Dilakukanuntukmencariinformasiataureferensiyangdiperlukangunamelengkapidata.
J. AspekYangDipelajari
9. AspekUmum
Aspek umum yang akan dikaji meliputi sejarah perusahaan, struktur organisasi dan
tugasnya,kondisiumum,sertaperkembanganPT.IndofoodSuksesMakmurTbk.
10. AspekKhusus
Aspekyangdikajisecarakhususyaitupengawasanmutu(QualityControl)mieinstanyang
diterapkandiPT.IndofoodSuksesMakmurTbkSemarangJawaTengah.

BABIV
HASILDANPEMBAHASAN

K. KeadaanUmumPerusahaan
12.

SejarahdanStatusInstansi
PT. Indofood Sukses Makmur semula berdiri dengan nama
PT.SanmaruFoodManufacturingCo.Ltdyangsecarayuridisberdiripada
tanggal27April1970.PabrikpertamakaliberdiridiJakarta,sedangkan
PT.SanmaruFoodManufacturingCo.LtdCabangSemarangberdiripada
tanggal31Oktober1987yangdiresmikanolehMenteriPerindustrianIr.
HartartodanMenteriTenagaKerjaSoedomo.Padatangal1Maret1994
PT.Sanmaru FoodManufacturing Co.Ltdbersamadenganperusahaan
perusahaanlainnyabergabungmenjadisatuperusahaandengannamaPT.
Indofood Sukses Makmur. PT. Indofood Sukses Makmur Tbk. Divisi
Noodle Cabang Semarang merupakan salah satu cabang dari Group
Indofood Divisi Noodle. Cabangcabang lainnya berada di Medan,
Pekanbaru,Palembang,Lampung,Jakarta,Tangerang,Cibitung,Bandung,
Surabaya,Pontianak,Banjarmasin,MakasardanManado.Selaindidalam
negeri, Divisi Noodle jugamemiliki pabrik di Filipina, China, Nigeria,
SaudiArabia,SiriadanMalaysia.

13.

LokasiPabrik
PT.IndofoodSuksesMakmurTbk.DivisiNoodleCabangSemarang
terletak di Jl. Tambak Aji 2 No. 8 Kelurahan Tambak Aji, Kecamatan
Ngaliyan, Semarang. Lokasi PT. Indofood Sukses Makmur Tbk. Divisi
Noodle Cabang Semarang terletak di dalam suatu kawasan industri di
SemarangbagianBaratberdekatandenganjalanutaraSemarangJakarta,
sehinggamempermudahprosespendistribusiandanpengangkutanbahan
bakudanprodukjadi.BataswilayahPT. Indofood SuksesMakmurTbk.

DivisiNoodleCabangSemarangadalahsebagaiberikut:

SebelahBarat

:PT.Apollo

SebelahTimur

:PT.GunaMekarIndustri

SebelahUtara

:PT.LautanLuas

SebelahSelatan

:PT.Woi

Lokasipabriktidakberadadidekattepijalandanjarakmenujupabriksekitar1kmdari
tepijalan.Halinitidakmempengaruhiproses pendistribusian danprosestransportasikarena
lokasipabrikmudahdijangkau.Lokasipabrikjauhdarirumahpemukimanwargakarenaarea
tersebutmerupakanareakawasanindustri.Luasbangunanpabrikadalah19.695m2,sedangkan
luastanahadalah33.015m2.
14.

KeadaanAlam
PT.IndofoodSuksesMakmurTbk.DivisiNoodleCabangSemarang terletak didalam
suatukawasanindustridiSemarangbagianBaratberdekatandenganjalanutaraSemarang
Jakarta.SemulakawasanTambakAjimerupakanperbukitanyangkemudiandiratakanuntuk
dijadikankawasanindustri.

15.

VisidanMisiPerusahaan
16.

Visi
Menjadi penyedia utama makanan consumer produk bermerek terkemuka bagi jutaan
konsumenIndonesiadanjugadiberbagaipenjurudunia.

17.

Misi
5.

MengembangkanjaringandistribusidiseluruhIndonesia.

6.

Menghasilkanprodukyangmemberikannilaitambahbagiparakonsumennya.

7.

Meraihpertumbuhanmelaluimanajemenyanghandal.

8.

Menjalankan praktek bisnis yang sehat tanpa harus mengabaikan kebutuhan


konsumendanlingkungan.

R. ManajemenPerusahaan
19.

StrukturdanSistemOrganisasi
PT. Indofood Sukses Makmur Tbk. Divisi Noodle Cabang Semarang dipimpin oleh
seorang General Manager (GM) yang memiliki tugas pokok memimpin dan mengarahkan
seluruh kegiatan perusahaan untuk mencapai performance yang tinggi dalam menghasilkan
produkproduk yang berkualitas tinggi dengan jaminan sistem yang selalu dijaga dan
dilaksanakandengankonsisten.
General Manager membawahienamdepartemenyangsalingterkaitsatusamalainnya,
yaitu:
a. DepartemenPurchasing
Departemen Purchasing dipimpin oleh Purchasing officer yang dibantu staffstaffnya
bertugas melakukan pengadaan barangbarang yang dibutuhkan oleh masingmasing
departemen.
b. DepartemenFinancedanAccounting(FA)
Departemen FA dipimpin oleh seorang Finance dan Accounting Manager (FAM) yang
mempunyaitugasantaralain:
5. Merencanakandanmengendalikansemuakegiatankeuangan.
6. Menyajikan laporan dan analisa keuangan untuk mendukung kegiatan operasional
perusahaan.
c. DepartemenPersonalia
Departemen Personalia dipimpin oleh seorang Branch Personnel Manager (BPM) yang
mempunyai tugas merencanakan, mengkoordinir, mengarahkan dan mengendalikan
kegiatan kepersonaliaan yang meliputi hubungan industrial, administrasi, kepegawaian,
jaminansosialdanpelayananumumuntukmendukungpencapaiansasaranperusahaan.
d. DepartemenMarketing
Departemen Marketing dipimpinolehArea SalesandPromotion Manager(ASPM)yang
mempunyaitugaspokokmerencanakandanmengkoordinirstrategikegiatanpromosidan
penjualanterhadapsemuaprodukyangdihasilkan.
e. DepartemenProccesDevelopmentandQualityControl
Departemen PDQC dipimpin oleh Branch Procces Development and Quality Control
Manager (BPDQCM) yang mempunyai tugas mengendalikan mutu (Incoming Quality
Control,ProccesQualityControl,OutgoingQualityControl)danMarketAudit.

f. DepartemenManufacturing
Departemen Manufacturing dipimpin oleh Factory Manager yang mempunyai tugas
merencanakan, mengkoordinir, mengarahkan dan mengendalikan kegiatan manucfaturing
yangmeliputi:
1) ProductionPlanningandInventoryControl(PPIC)
Production Planning and Inventory Control dipimpin oleh PPIC Supervisor yang
bertugasmerencanakanjadwalproduksiberdasarkan CorfimedWeeklyOrder (CWO)
yang diterima dan mengendalikan tingkat ketersediaan Raw Material dan Finished
GoodssehinggastandarBufferStocktetapterjangkau.
2) Production
Production dipimpinoleh ProductionCoordinator yangmembawahitiga Production
Shift Supervisor yang bertugas merencanakan, mengkoordinir dang mengendalikan
aktifitasproduksisesuaistandaryangtelahditetapkansertamenjagakelancaranproses
produksidengantetapmeminimalkanpembocoranRMdan Utility secaraefektifdan
efisien.
3) WareHouse
Ware House dipimpin oleh Ware House Raw Material Supervisor dan Ware House
Finished Goods Supervisor yang bertugas merencanakan, mengkoordinir dan
mengendalikankegiatanpergudangansehinggatercapaikeakurasianjumlah,keutuhan
dankeamananbarang.
4) Technical
Technical dipimpin oleh Technical Supervisor yang bertugas merencanakan,
mengkoordinasi,danmengendalikankegiatandibagianteknikbaikdalamperawatan
maupun perbaikan mesin sehingga dapat menjamin kelancaran operasional mesin
produksibesertasaranapenunjangnya.
20.

HakdanKewajibanKaryawan
PT. Indofood SuksesMakmurTbk.Divisi Noodle CabangSemarangtelahmenetapkan
hakdankewajibanyangsalingberkaitansatusamalainnyaartinyaantaraperusahaandengan
karyawanpabrik ataupun karyawankantor samasama mendapat keuntungan,dan tidak ada
pihakyangdirugikan.Hakhakdankewajibanyangtelahdiaturolehpihakperusahaanyaitu;
E. HakKaryawan
6. GajisesuaiUMK(UpahMinimumKota/Kabupaten)

7. Seragamdanperlengkapankerja
8. Kenaikangajitahunan
9. Tunjanganharirayakeagamaan
10. Programkeluargaberencana
11. Jaminansosialtenagakerja
12. Jaminankesehatan
13. Bantuankelahiran
14. Kompensasikerja(melaluijamsostekdanperusahaansesuaibatasclaimdiJamsostek).
15. Kompensasikecelakaandiluarjamkerjapadasaatberangkatdanpulangkerja(melalui
JamsostekdanperusahaansesuaibatasclaimdiJamsostek).
16. Jaminanmakan
17. Subsiditransportasi
18. Bantuandukacita
19. Bantuansukacita
20. Tunjanganharitua
21. Beasiswaanakpekerja
22. Tempatibadah
23. Saranaolahraga
24. Penghargaanmasabaktipekerja(5thn,10thn,15thn,dst).
Y. KewajibanKaryawan
1)

Mematuhiperaturandalamperusahaan

2)

Melaksanakandantundukpadaperjanjiankerjayangdisepakati

3)

Mengindahkandanmenaatiperintahatasannyasertamelaksanakantugasyang
diberikandenganpenuhrasatanggungjawab

4)

Menjunjung tinggi nama baik perusahaan serta memegang kerahasiaan akan


segalasesuatuyangdiketahuinyadanmelaksanakantugaspekerjaannya

5)

Datangtepatwaktudantidakterlambat

6)

Mengisidaftarhadir/presentasi

7)

Mengindahkandanmenaatisemuaketentuanketentuanperaturanhokumpositif
danperaturanperusahaan

8)

Memelihara dan menjaga sebaikbaiknya semua peralatan dan perlengkapan


kerjayangdipercayakankepadapekerja

9)

Memberilaporanjikaterjadiperubahanstatusdiridankeluargasertaalamatnya

10)

Memberikankepadapihakperusahaandalamhaltidakdapatmelaksanakantugas
pekerjaan

11)

Mengikutikursuspelatihaninternalatasizinperusahaanyangdiselenggarakan
olehkonsultanprofesionalseperti,seminar,implementasisystem,manajemenmodern
dansebagainya.

21.

Ketenagakerjaan
Proses produksi tidak akan berjalan lancar tanpa adanya campur tangan sumber daya
manusiawalaupuntersedianyasumberdayaalamdanperalatankerja.Untukitudenganadanya
tenagakerjadalamperusahaansangatberpengaruhterhadapkesuksesanperusahaan.Perekrutan
karyawantidakdilakukansetiapharimelainkanpadasaatperusahaanmembutuhkan tenaga
kerja.SyaratpenerimaantenagakerjaminimaltamatSLTA/sederajat usiaminimal18tahun.
Sedangkan untuk karyawan kantor syarat penerimaan karyawan disesuaikan dengan jabatan
yangdiduduki,sehatjasmanimaupunrohani,lulustesttertulisdanwawancarasertamemiliki
etoskerjayangtinggidanbertanggungjawab.Dankaryawanyangtelahdinyatakanditerima
harusmenandatanganiikatankerjasebagaikaryawanyangdikontrakterlebihdahuluselama6
bulan.Perbandinganjumlahkaryawanlakilaki49,48%danperempuan50,16%.Jumlah
karyawandiPT. Indofood SuksesMakmurTbk.Divisi Noodle CabangSemarangsebanyak
sebanyak871orang(update24Februari2009)yangterdiridarikaryawankantordankaryawan
pabrik. Jumlah karyawan masih dapat berubah sesuai dengan penerimaan karyawan baru.
Jumlahkaryawandibagianproduksimencapaiprosentasetertinggiyaitu64,68%dariseluruh
karyawanyangada.Jamkerjakaryawanminimal40jamperminggudanselebihnyadihitung
sebagai jam lembur. Hal tersebut sesuai dengan peraturan pemerintah. Namun, khusus hari
SabtujamkerjakaryawanlebihpendekataudihitungsetengahharidanhariMinggukaryawan
diberilibur.TetapipadahariMinggutersebut,adabeberapakaryawanyangdiharuskanmasuk
yaituuntukmelakukankegiatansanitasiperalatan.
Untukkaryawankantormempunyaijamkerjasebagaiberikut:
9. Senin Jumat08.0016.00denganistirahatsatujam darijam12.0013.00,sedangkan
padahariSabtu08.0013.00tanpawaktuistirahat.
Sedangkanuntukkaryawanpabrikmempunyaijamkerja:
10. HariSeninJumat
ShiftI

:07.0014.30

ShiftII

:14.3022.00

ShiftIII

: 22.0007.00

11. HariSabtu
ShiftI

:07.0012.00tanpawaktuistirahat.

ShiftII

:12.0017.00tanpawaktuistirahat.

ShiftIII

:libur.

Karyawan yangtidakmematuhiperaturanataumelakukanpelanggaranyang merugikan


pihakperusahaanharusbertanggungjawabatasapayangdilakukan.Halinidilakukanagar
kejadianyangmerugikanperusahaantidakterulangkembalidankaryawanlebihbertanggung
jawabataspekerjaannya.Jenissangsiyangdiberikankaryawanatastindakanyangindisipliner
yaitu:
16.

Lisandilakukanolehatasanbersifatumumdanringan.

17.

Suratperingatan13tergantungpelanggaranyangdilakukan,suratperingatan
inidilakukanolehpersonaliaataspermintaanatasanataspelanggaranyangbersifatkhusus.

22.

18.

Skorsing.

19.

PHK.
KesejahteraanKaryawan
Pihakperusahaandisampingmemperkerjakankaryawannyajugasangatmemperhatikan

kesejahteraan karyawan yaitu dengan dengan cara memperhatikan kesehatan karyawannya.


Pemeriksaankesehatanpadakaryawandilakukansecaraberkalayaitusetiapduatahunsekali,
sedangkan karyawan yang telah berumur diatas 40 tahun dilakukan pemeriksaan kesehatan
setiapsatutahunsekali.
23.

PeningkatanSDMTenagaKerja
PeningkatanSDMterusdilakukanperusahaandengancaramelakukan pelatihan sesuai
dengan kebutuhan dan kinerja serta dilaksanakan pengembangan karyawan disesuaikan
pengembanganorganisasidanprestasi.PeningkatanSDMinidilakukanagarkaryawanyang
berkecimpung/bekerja pada perusahaan mempunyai wawasan yang luas dan berkembang
sehinggadiharapkandapatmemberikaninovasibarupadaperusahaanuntukkedepannya.

X. AspekaspekQualityControl
1.

PengendalianBahanBaku(RawMaterial)
Bahanbakudengansifatdanjenisyangberbedamemerlukanpengendalianyangberbeda
pula,pengendalianbahanbakumeliputi:

25.

Tepungterigu
Salahsatubahanbakuyangdigunakanuntukpembuatanmieinstanadalahtepung
terigu.Tepungteriguyangdigunakanuntukpembuatanmieinstan diproduksiolehPT.
Bogasari Flour Mills. Terigu yang digunakan untuk membuat mie adalah terigu yang
memilikikadarproteintinggi,halinibertujuanagarmieyangdihasilkankualitasnyabaik.
SyaratmututepungterigusesuaiSNIdapatdilihatpadatabel4.1.Pengendaliankualitas
terigumeliputianalisafisikdankimia.Analisafisikmeliputi,kebersihanzak,jahitantidak
terbuka/bekasdibuka,tidakbasah,tidaktercemarbaranglain,kodeproduksi,label,berat25
kg 0,1125kg.Analisafisikdilakukantiapkedatangan.Secaraorganoleptikdiamatibau,
warna,bentukpowder.Untukanalisakimiapengendalianmutunyameliputi,kadarair,kadar
gluten,kadarabu.Monitoringanalisakimiadilakukan3bulansekali.

Tabel4.1SyaratMutuTepungTeriguBerdasarkanSNI0137511995
No.

Kriteriamutu

1.
1.1
1.2
1.3
1.4
2
3.
4.
5.

Keadaan
Bentuk
Bau
Rasa
Warna
Bendaasing
Serangga
Jenispatilain
Kehalusan(lolos
ayakan100mesh)
Air
Abu
Protein(Nx5,7)
Seratkasar
Keasaman(dihitung
sebagaiasamlaktat
Cemaranlogam
Timbal(Pb)
Tembaga(Cu)
Seng(Zn)
Raksa(Hg)
Cemaranarsen
Cemaranmikroba
Angkalempengtotal
E.colli
Kapang

6.
7.
8.
9.
10.
11.
11.1
11.2
11.3
11.4
12
13
13.1
13.2
13.3

JenisA

Persyaratan
JenisB

Serbukhalus
Normal
Normal
Normal
Tidakbolehada
Tidakbolehada
Tidakbolehada
Min95

Serbukhalus
Normal
Normal
Normal
Tidakbolehada
Tidakbolehada
Tidakbolehada
Min95

Serbukhalus
Normal
Normal
Normal
Tidakbolehada
Tidakbolehada
Tidakbolehada
Min95

%b/b
%b/b
%b/b
%b/b
%b/b

Mak14
Maks06
Maks12
Maks0,4
Maks0,4

Mak14
Maks06
1011
maks0,4
maks0,4

Mak14
Maks06
89
maks0,4
maks0,4

g/kg
g/kg
g/kg
g/kg
g/kg

Maks0,1
Maks0,1
Maks40,0
Maks0,05
Maks0,5

Maks0,1
Maks0,1
Maks40,0
Maks0,05
Maks0,5

Maks0,1
Maks0,1
Maks40,0
Maks0,05
Maks0,5

106
10
104

106
10
104

106
10
104

Satuan

koloni/kg
APM/g
Koloni/g

JenisC

Sumber:DewanStandarisasiNasional,1995
26. Tepungtapioka
Tepung tapioka merupakan bahan tambahan yang digunakan sebagai pensubtitusi
terigu.Standartepungtapiokadapatdilihatpadatable4.2.PersyaratanStandar Kualitas

TepungTapiokameliputitingkatkeputihan(BaSO4 =100),kekentalan(Engler),kadarair,
tingkatkehalusan,seratdankotoran.DengantingkatkualitasAAA(terbaik),AA(baik),A
(sedang).Monitoringdilakukan3bulansekali.
Tabel4.2PersyaratanStandarKualitasTepungTapioka

Sumber:DepartemenPerindustrianJakarta,1976dalamRadiyati,1990.
Tabel4.3SyaratmututepungtapiokaberdasarkanSNI0129051992
No.
KriteriaMutu
Satuan
Persyaratan
1 Warna
Putih(khastepungtapioka)
2 Bentuk
Serbuk
3 Bau
Normal
4 Bendaasing
Tidakada
5 KadarAir
%
17,5
6 Kadarlemakdan
%
0,7
kotoranmaksimum
Sumber:DewanStandarisasiNasional1992dalamSuprapti,2008.
27. Minyakgoreng.
Minyakgorengdarisupliersebelumditerimaolehperusahaandilakukanujikimiadan
ujiorganoleptik.Apabilasudahmemenuhistandarmutumakaminyakgorengbisaditerima.
Minyak goreng yang digunakan untuk pembuatan mie instan diproduksi oleh PT. Salim
NomasPratama.Yangperludiperhatikandalampengawasanminyakgorengadalahpadasaat
kedatangan dengan memeriksa segel truk pengangkut minyak goreng yang datang pada
bagianatasbelakangyangberupakuncidankabeldengantandacekkuningberartidalam
pengecekan dan tanda cek hijau yang berarti layak digunakan. Pemeriksaan yang lain
dilakukanselamaprosesberlangsung,denganmengambilsampeldaritangkipenyimpanan.
SampelminyakgorengyangdiambildianalisakimiameliputikadarFreeFattyAcid(FFA),
POV (PeroksidaOksidVolume).StandarFFAtiapkedatangan0,075%sedangkanStandar
FFAuntukprosestidaklebihdari0,25%.Secaraorganoleptikujiyangdilakukanmeliputi
cairan kuning berbau normal dan tidak tercemar. Monitoring di lakukan tiap kedatangan

minyakgoreng.
28. Garamdapur
GaramdapuryangdigunakanuntukpembuatanmieinstandiproduksiolehPT.Niaga
GaramCemerlang.Analisapengendalianmutugaramdapurmeliputiwarna,bentukkemasan
tidakrusak,utuh,tidaktercemar,adalabel,analisakadariod,kadarair,kemurniandankadar
kotoran.Standargaramyangditerimawarnaputihdanbentukkristal.Monitoringdilakukan
tiapbarangdatang.
29. Zatpewarna
ZatpewarnayangdigunakanadalahtartazineCl19140.Zatpewarnayangdigunakan
untukpembuatanmieinstandiproduksiolehPT.HalimSakti.Analisapengendaliankualitas
zatpewarnameliputiintensitaswarnadanbentuk.Standarmutuzatpewarnayangditerima
yaituwarnakuningdanbentukpowder.Monitoringdilakukantiapbarangdatang.
30. Bumbudanminyakbumbu
Bumbudanminyakbumbuyangdigunakanuntukpembuatanmieinstandiproduksi
olehPT.IndofoodSuksesMakmurCabangDevisiSeasoning.Pemeriksaanyangdilakukan
terhadap bumbu, minyak bumbu dan cabe serta standar mutunya adalah kemasan tidak
berlobang,beratbersih/pcs(gram)bumbu,minyakbumbu,cabestandarnya(5,03;5,75;0,30),
beratkotor/bungkus(pcs)5,700,5pcs,jumlahisi/kartonstandarnya200010pcs,umur,
warna,bau,danrasa,penampakan,bebasdaribendaasing,kadarairbumbustandarnya1825,
kadar air minyak bumbu 0,25 dan cabe kadar airnya 5670. Pemeriksaan dilakukan di
laboratorium QualityControl tiapkedatanganbarang. Hasilpemeriksaanhanyaberlaku 1
bulan,apabilabumbutersebutsampaisatubulanbelumdipakai,makadilakukanpemeriksaan
lagisebelumbarangtersebutdipakai.
31. Air
Sumberairyangdigunakanuntukprosesproduksiberasaldariairbor.Pengendalianair
bormeliputianalisapH,kesadahandantotalpadatan.Analisaanalisainidilakukansecara
rutin per hari. Sedangkan analisa logam berat dilakukan monitoring per triwulan sekali.
Sedangkanuntukanalisaorganoleptikmeliputiwarna,rasa,baudantidakterdapatcemaran
monitoringdilakukantiapkedatanganbarang.
32. Etiketdankarton
Etiket dan karton yangdigunakan untuk pembuatan mie instan diproduksi oleh PT.
SuryaRengoContainer.Pengendalianbahanbakuetiketdankartonmeliputipengendalian

saatbahandatang(incomingQC)danpengendalianselamapenyimpanan.Pengendalianetiket
dilakukandengankontrolberatrollstandarnya12,8613,86kg,ketebalanstandarnya352,
gulunganrapat,kondisietiketstandarnyatidakmisprin,dimensistandar(berat13,2514,25,
panjang 170mm, lebar 280mm), standar warna tajam dan fokus. Sedangkan untuk
pengendaliankartonmeliputi,standarstandarwarnatajamdanfokus,kekokohandandimensi
standar (panjang 335, lebar 195, tinggi 240). Untuk kekokohan dimensi pengendaliannya
dilakukandengancaradiberibeban70Kgselama5menitjikatidakrobohbisadipakai,
lipatanmenutuprapat,sertapemeriksaankodelot.Monitoringdilakukantiapkedatangan
etiketdankarton.
2.

PengendalianProsesProduksiMieInstan
Pengendalianprosesproduksibertujuanuntukmelakukan pengembanganpengembangan
Terigu
danperbaikanperbaikansehinggamenghasilkanoutputyanglebihbaik.Pengendaliandilakukan
mulaidaribahanbaku,barangsetengahjadidanbarangjadi.Tahaptahapdiagramalirkualitatif
Sorting
prosesproduksimieinstanyangdilakukanolehPT.IndofoodSuksesMakmurTbkdapatdilihat
(1115menit)
padagambar4.1dantahaptahapdiagramkuantitatifprosesproduksimieinstanyangdilakukan
olehPT.IndofoodSuksesMakmurTbkdapatdilihatpadaGambar4.2.
Mixing
Laruta
(1115menit)
nalkali
Rollsheeting&slitting
Steaming
(suhu901000C,tekanan0,250,4kg/m2
waktu7073detik)
Cutting&folding
Frying(suhu1001500C
Waktu7077detik)

Colling(suhu<320C
waktu318322detik)
Packing

MieInstan

Bumbu,Minyak
Bumbu,Etiket,
Karton

Terigu200kg,tapioka50kg
=250kg
Gambar4.1.DiagramAlirKualitatif
Sorting
ProsesProduksiMieInstan

KadarAir3233%,
328kg

Alkali50L+Air5L

Mixing(1115menit)

Pressing

Slitting

Ketebalan1,15mm

Jumlahuntaian7073

Steaming(suhu90100 C,tekanan0,250,4kg/cm ,7073detik

CuttingdanFolding

KadarAir2,53,5%,
226,32kg

@62gr

Frying(100150oC,7077detik)

Minyak

Cooling(suhu<32oC,318322detik)

3650pack

Packing

91karton

Cartoning

Seasoning

Karton

KadarAir34%
328kg

Gambar4.2DiagramAlirKuantitatifProsesProduksiMieInstan

Mieinstandibuatdenganmelewatitahaptahapsebagaiberikut:
Z. Pengayakan(Sorting)

Bahanbahan seperti tepung terigu dan tepung tapioka dituangkan ke dalam mesin
sorting.Fungsidarimesinsortingyaitumengayaktepungterigudantepungtapiokasehingga
bebasdaricemaranfisik(kerikil,kutu,benangdanlainlain).Ayakanyangdigunakanuntuk
menyaringtepungterigudantepungtapiokaadalah20mesh.Tepungyangsudahdiayakyaitu
tepungyangbebasdaribendaasingkemudiandilanjutkankemesinmixsermelaluimesin
screw.Mesinscrewberjalankarenaadanyaconveyoryangdigerakkanolehmotorsehingga
tepung akan terhisap keatas menuju mesin mixer. Lama proses untuk mengayak tepung
sebanyak10zakyaituantara1115menit. Agardihasilkanmieyangberkualitasbaikdan
sesuaidenganharapanpelanggan.Pengendalianmutumeliputicemaranbendaasing,setiap
shift diidentifikasi bendabenda asing apa yang ada serta pengamatan warna dan aroma.
Standarmututepungayakanmeliputibendaasingtidakada,warnafisiknormal,aromatidak
tercemar bau benda asing. Jika sesuai standar maka ayakan tepung bisa masuk keproses

selanjutnyadanayakantepungyangtidaksesuaistandarbilaterdapatadanyabendaasing
masih bisa diterima dengan membuang benda asing tersebut sebelum masuk ke proses
selanjutnya. Apabila tepung tercemar bau benda asing seperti minyak tanah tepung
dikembalikankesuplierdantidakbisaditerimaolehperusahaan.
AA.

Pengadukan(Mixing)
Bahanyangsudahdiayakselanjutnyadilakukanprosespencampurandanpengadukan

(mixing),bahandasartepungterigudanbahanpenunjangsepertitepungtapioka,airalkali,
untukmemperolehadonanyanghomogendancukupkadarairnya.Padaprosesiniterjadidua
tahapmixingyaitumixingkeringdanmixingbasah.Keduaprosesinitidakjauhbedahanya
sajapadamixingbasahadanyapenambahanairalkali.Prosesmixingkeringdilakukanuntuk
mencampursemuatepungagardapathomogendengankecepatanputaranyangtinggi.Setelah
semuatepungtercampurbarukemudianterjadiproses mixing basahdimanapadatahapini
adanyapenambahanairalkalikedalamadonanagarmempercepatproseskekalisanadonan.
Airalkalidibuatdalamtangkipencampuralkaliyangterdiridariduatangkiberukuranbesar
yangdidalamnyaterdapatalatpengadukdandilengkapidengansaringansehinggaairalkali
bersifathomogendanbebasdaribendaasing.Komposisidariairalkaliyaitugaram,air,zat
pewarnayangdiizinkandaningredientlainnya.Setiappembuatanairalkalidibutuhkanair
sebanyak 1500 liter yang dapat digunakan untuk 20 kali mixing. Air alkali yang akan
digunakanselaludilakukanpemeriksaansepertidilakukanujibobotjenis,viskositas,danpH.
Standarmutuujibobotjenis1,032gr/ml,viskositas25212,danpH912.
Pengendalianmutupadawaktuproses mixing, halhalyangharusdiperhatikanadalah
homogenitasadonan,warna,jumlahairalkali,penambahanairdankadarairadonansehingga
adonan yang terbentuk sesuai dengan standar yang ada. Homogenitas adonan sangat
mempengaruhi kualitas dari adonan pada proses selanjutnya. Homogenitas adonan yaitu
terbentuknya adonan yang kalis/seluruh tepung dapat tercampur semua dengan air alkali
sehinggadihasilkanadonanyangtidakpero,patahdanlembek.Setelahterbentuk adonan
yangkalisdibiarkanselama10menitagarkadarairdalamadonanmerata,kadarairdari
adonanstandarnya3234%.Totalwaktuproses mixing sampaiterbentukadonanyangkalis
antara1115menit. Jikasudahsesuaidenganstandarmakaadonanbisamasukkeproses
selanjutnya,jikatidakstandarmisaladonanterlaluperomakabisaditambahkanair/larutan
alkali dan jika adonan terlalu lembek maka bisa ditambahkan tepung dengan menambah

waktumixingsehinggadidapatadonanyanghomogen.
BB.

Pengrepresan(Pressing)

Proses selanjutnya yaitu pengepresan adonan. Setelah adonan menjadi homogen,


campurantersebutdimasukkankemesinpelempeng.Dalammesinpelempeng(rollpress)
adonan akan dibentuk menjadi sheet/lembaran, untuk tebal sheet pada rol press pertama
sampai terakhir harus semakin tipis, dan rol press terakhir tebalnya harus sama karena
berpengaruh pada keseragaman puller. Dengan melalui 7 pasang silinder yang berbeda
ketebalan akhirnya akan membentuk adonan yang halus, homogen, dan tidak terputus.
Pembentukanlempenganyangbaiktersebutituditunjangolehpanasyangditimbulkanmesin.
Pengedalianmutupadatahappengrepresanadalahdisetiaprollpressdenganmelalui7
rolyangberbedaketebalanya,dilakukanpengukurandalamlembaranadonansetiap2jam
dalam setiap shift. Pengendalian mutu ini bertujuan untuk mengantisipasi agar dapat
membentuk lembaran yang lurus, homogen dan tidak keras serta mempunyai standar
ketebalanrollpressakhir1,15mm.
DalamprosesPressinginijikaketebalanadonanpadarollpresssesuaidenganstandar
masukkeprosesselanjutnyajikatidakmemenuhistandarshettinganrollpressharusdisetel
ulangdengancaramenaikkanataumenurunkanketebalansettsesuaidenganstandaryang
telahditentukan.
CC.

Pemotongan(Slitting)
Dalam proses ini adonanadonan yang telah menjadi lembaranlembaran tipis

selanjutnya akan dicetak oleh mesin slitter menjadi untaianuntaian yang bergelombang.
Pembentukangelombanghanyamelewati weaving conveyor,kemudianmasukkemangkok
membagi menjadi 5 bagian, diharapkan dengan mangkok pembagi beratnya sama dan
seimbang. Jika tidak sama dilakukan penambahan berat basah dengan menaikkan atau
menurunkanangkainventer.
Pengendalianprosesdaritahap slittingyaitudenganmengecekjumlahmasingmasing
untaianrataratastandarnya7073untaiandenganstandarketebalanuntaianmie1,121,18.
Selain itu pengendalian mutu pada tahap slitter berupa penilaian kerapian gelombang.
Pengendalian mutu tingkat kerapian gelombang ini dapat dilakukan dengan tidak
ditemukannyabentukmieyangmenyimpang.Standarparameterbentukmieyangdigunakan
berupabentukmienormalbergelombangdengankerapianyangcukupmerata. Jikapuller

memenuhistandarmasukkeprosesselanjutnyajikatidakmemenuhistandarmakadiametar
pullerharusdisetelulangdengancaramemutaruliranyangadadiatasmesinrollcatter.
DD.

Pengukusan(Steaming)
Setelah pemotongan kemudian mie dilewatkan ke dalam pengukus dengan

menggunakankonveyorberjalan.Padawaktupengukusantersebutterjadigelatinisasipatidan
koagulasiglutensehinggaikatanmenjadikerasdankuat,miemenjadikenyal,sertamietidak
menyerapminyakterlalubanyakdanlembut.Tandatandamiematangyaitubilapullerdi
putustidakadawarnaputihtepung,miejikadipegangtidaklengketdantidakkaku.
Dalam proses ini untaian mie yang bergelombang menuju ke steam box dengan
menggunakan conveyor berjalan.Panasyangdiberikanberasaldariuapairdengan Suhu
standardari steamer dikondisikanpadasuhu90100 0Cdenganstandartekanan steamer in
0,2504kg/cm2,out0,2504kg/cm2danwaktuSteaming7072detik.Padaprosesiniterjadi
gelatinisasipatidankoagulasiglutensehinggaikatanmenjadikerasdankuat,miemenjadi
kenyalsertamietidakmenyerapminyakterlalubanyakdanlembut.Tujuandariprosesini
adalahuntukmengukusmie,mematangkanmiemematikanmikoorganismedanenzimenzim
yangmasihadapadatepungdanagarmielebihsoliddantidakmudahtergerai.
Pengendaliaan mutu tahap steaming adalah dengan mengontrol waktu steaming dan
tekananyangdigunakan. Faktoryangmempengaruhi steaming secarakualitasadalahmutu
steamdansecarakuantitasadalahjumlahsteam.Mutusteamyangbaikadalahsteambasah
karenadengansteambasahmakaakanmempercepatfungsipemanasan.Sedangkanjumlah
steam berhubungan dengan panas yang diterima oleh mie. Steam merupakan media
penghantarpanassehinggaapabilajumlahsteamlebihbesarmakapanasyangberpenetrasi
dalam mie akan semakin baik. Jika tingkat kematangan mie sesuai dengan standar maka
masukkeprosesselanjutnyajikatidaksesuaidenganstandarmakatekanandansuhusteam
bisaditurunkanataudinaikkansehinggasesuaidenganstandar.
EE. Pemotongan danpelipatan(CuttingdanFolding)

Cutting adalahproses pemotonganuntaianuntain mie bergelombangdengan ukuran


tertentu yang sesuai dengan standar, sedangkan folding merupakan proses pelipatan mie
menjadi dua lipat yang sama panjangnya. Setelah melalui pemasakan, mie dikeringkan
dengankipasuntukmengurangiuappanassetelahprosespengukusandanmenghindarimie
tidaklengket.Selanjutnyadipotongpotongdenganmesinpemotongdenganpanjangsekitar

12cmdanbobotsekitar80gram.Padasaattertentumieiniditimbanguntukmengontrol
beratmie.
Pengendalianmutuyangdilakukanyaitudenganmengontrolberatmiebasahdanrpm
cutter. Standar berat mie basah 77 gram. Standar kecepatan alat potong yang digunakan
adalah42rpmmakadalamsatumenitnyamampumemotongmiesebanyak42potonganmie
dandisesuaikandarikecepatanalatyangdigunakan.Alatyangdigunakanuntukmemotong
mieadalahcutter.Jikaberatmiedanrpmsesuaistandarmakamasukkeprosesselanjutnya,
jikatidakstandarmisalberatmiebasahtidakmemenuhistandardilakukanpenyetelanulang
dimesinSlittingdenganmenaikkanataumenurunkanangkainventerdanapabilarpmtidak
standardilakukanpenyetelanulangdimesincutter.
FF. Penggorengan(Frying)

Mie yang telah di potongpotong dengan ukuran dan berat tertentu dengan
menggunakan konveyor, menuju ke mesin penggorengan. Proses penggorengan dilakukan
dengansuhuawal,suhutengah,dansuhuakhirselamakuranglebih70detiksehinggakadar
air menurun, mie menjadi kering dan padat. Tujuan dari proses penggorengan ini untuk
mengawetkanmiesecaraalamidengancaramengurangikadarairdalamminyak,kadarair
menurundari30%menjadi3%.Suhuminyakyangtinggiakanmenyebabkanairmenguap
dengan cepat dan membentuk poripori halus yang dapat mempercepat proses rehidrasi
(penyerapanairpadasaatdimasak).
Pengendalian mutu minyak yang digunakan pada proses frying dilakukan dengan
penilaiankadarFFA(FreeFattyAcid)ataukandunganasamlemaknyadenganpengambilan
sampel 2x setiap shift pada tangki frying. Pengendalian mutu pada proses frying juga
dilakukandenganpenilaianwaktu,suhu,levelminyakgorengdanadanyacemaran.Standar
FFAminyakgorengmax0,1waktufrying7680detik.Padaprosesfryingpenilain
suhuharusdiperhatikan,standarsuhuawal100110 0C,suhutengah120130 0C,dansuhu
akhir 140150 0Ckarenauntukmenghindariadanyaperistiwachashardening.
Penilaianlevelminyakgorengpadapengorenganmieinstan3,04,0cmdiatasmangkuk,jika
level minyak kurang dari standar maka minyak dalam frying harus ditambah. Hal ini
bertujuanagarmieinstanyangdihasilkanmatangsecaramerata.Dalamprosespenggorenan
inijikamemenuhistandarmakamasukkeprosesselanjutnyajikatidak memenuhistandar
bisamenaikan/mengurangisuhu.penggorengan.

Pengendalianmutupadaprosesfryingjugadilakukanpadasisaminyakgorengyang
dihasilkan.Jikadalamprosespengorenganpadaakhirproduksimasihadasisaminyakgoreng
difryingdengankadarFFA>0,245%yangdisimpanditangkidaily,makaminyakgoreng
disebut minyak lama. Minyak goreng ini dapat dipergunakan kembali sebagai bahan
campuranminyakgorenguntukprosesproduksibaikpadaawalproduksimaupun selama
proses berlangsung.Jikamemenuhistandarminyakgorengbisadigunakankembali, jika
tidaksesuaistandarminyaktersebutdibuang.Padaawalproduksiminyakgorenglamadapat
dipergunakandenganketentuan:
11. QCanalismelakukananalisaterhadapminyakgorenglamadenganmengunakanform
FFAFryer.
12. OperatorFryermemakaiminyakgorenglamasesuaisaranQCanalis,dalampelaksananya
dapatdilihatpadaTable4.4.
Tabel4.4KomposisiMinyakGoreng%
No
FFAminyak
Komposisiminyakgoreng%
gorenglama
Lama
baru
1.
0,000,10
75
25
2.
0,110,11
50
50
3.
0,180,20
25
72
4.
>0,20
0
100
Sumber:SOPPT.IndofoodSuksesMakmurTbk
GG.

Pendinginan(Cooling)
Selanjutnyamieyangtelahdigorengdidinginkandenganmenggunakankipasangindan

mesin pendingin. Mesin ini bekerja dengan meniupkan angin ke arah mie panas yang
bergerakmelaluibanberjalan.Prosespendinginaniniakanmenyebabkanpengerasanminyak
yang terserap dan menempel pada mie sehingga mie pun menjadi keras. Apabila proses
pendinginannyatidaksempurna,uapairyangtersisaakanmengembundanmenempelpada
permukaanmiesehinggamemicutumbuhnyajamur.
Pengendalianprosespendinginandenganmemperhatikansuhudanwaktupendinginan,
pengendalianmiesecaraperiodiksetiapsatujamsekali,bentukmieinstansimetrisminimal
bisaberdiritigasisi.Secaraorganoleptik,kematanganmie,bentukmie,warnamie,tidakada
cemaranfisik,kimia,biologi.Selainitujugadianalisakadarair,kadarlemak.Standarsuhu
pendinginanmax45 0C,waktu120124detik,kadarairmax3,5%dankadarlemak15
19%. Jika dalam proses pendinginan ini memenuhi standar maka masuk keproses

pengemasan,jikatidaksesuaidenganstandarsuhudinaikkanatauditurunkan.
HH.

Pengemasan(packing)
Mieyangtelahdidinginkankemudiandikemasdenganpengemasbersifatkedap air,

udara dan bau. Kemasan primer yang biasa digunakan adalah plastik polipropilen atau
polietilen.Kemasaninibersifatsekalipakai.Dalampenggunaannya,kemasaninibiasanya
dilapisidenganOrientedPolypropilen(OPP).
Setelahdikemasdengankemasanprimer,miedimasukkandalamkotakkartonsebagai
sekunder.Umumnya,satukotakkartonberisi40bungkusmie,sedangkansatukotakkarton
miecupberisi12cup. Standarpackingrpmpackkanandankiri110180,sedangkanlong
sealerkanandankiri65380.
3.

PengendalianPemeriksaanProdukJadi(OutGoingQualityControl)
PengendalianmutuprodukakhirdilakukandenganstandarQualitymanualPT.Indofood
SuksesMakmurTbk.Persyaratanmutuprodukakhirmiinstanyangdilakukanmelitputikode
produksibaikdikartonmaupundietiket,tidakrobek, kartontidakbasah,lakbanyangbenar
benar lengket,tertutuprapat,isisesuaistandar,etiket(kodeproduksi,benar,jelas dan mudah
dibaca),kadarair,kadarlemak,pengecekanbumbusertakondisisealertertutupbaikdanrapi.
Contohkodeproduksidalampengemasadalah
t. Padaetiketplastik

Kodeproduksi
ProdukA1527029dapatdiartikanbahwamiinstandiproduksiolehreguA,shift1,mesin
5,padatanggal27,bulan2dantahun2009.

Kodekadaluwarsa
Exp13092009dapatdiartikanbahwamiinstanbaikuntukdikonsumsisebelumtanggal
13,bulanSeptember,tahun2009.

u. Padakarton

Kodeproduksi
ProdukA1527029dapatdiartikanbahwamiinstandiproduksiolehreguA,shift1,mesin
5,padatanggal27,bulan2dantahun2009.

Kodekadaluwarsa
Exp 13092009 dapat diartikan bahwa mi instan baik dikonsumsi sebelum tanggal 13,
bulanSeptember,tahun2009.

Produkshelflifeyangtelahdihasilkandilakukananalisakimiasecaraperiodikdansecara
organoleptikpadakualitasmasakanmi.Shelflifesecaraorganoleptikdilakukansetiapshiftsetiap
lineharusdianalisa.Produkdenganumur08bulankemudiandidokumentasikandandianalisa
setiap bulan untuk mengetahui adanya perubahan dari waktu ke waktu sebelum proses
penyimpangan. Selain itu produk Shelf life digunakan sebagai referensi apabila terjadi
penyimpangansetelahprodukdilemparkepasardandikonsumsiolehkonsumen.
Penyimpanan mie instan di gudang diletakkan di atas paletpalet dengan tumpukan
maksimal 8 karton. Pengendalian mutu produk selama penyimpanan antara lain dengan
penggunaansistemFIFO(dimanabarangyangprosesproduksinyaselesaiterlebihdahuluakan
dijual kepasar terlebih dahulu dibandingkan barangbarang proses produksi yang selesainya
berikutnya), gangguan serangga, tingkat kekeringan mie dan pemeriksaan pada saat
pengangkutan.
PenilaianpenggunaansistemFIFOdapatdilakukandenganpenyimpananprodukakhirmie
instanberdasarkanjangkawaktupenyimpanan1bulan.Penilaiangangguanserangadilakukan
dengan cara pembersihan baik lantai maupun atap dengan sapu serta pengunaan paletpalet
disetiap dasartumpukanprodukakhirmieinstanyangdilakukansetiapharipadaawalshift,
setelah istirahatdansebelumpulang.Setiapminggujugadiadakan pestcontrol.Pemeriksaan
yang dilakukan di gudang adalah pada saat pengangkutan produk ke dalam truk harus
diperhatikankebersihandiareatruck,penumpukanyangrapidanadanyaterpalpenutup.Dari
pengendalian tersebut dilakukan untuk mengantisipasi terjadinya kerusakan produk yang
dihasilkandanprodukyangakandipasarkan.
Selain pengendalian dilakukan untuk bahan baku, proses produksi dan barang jadi,
pengendalianmutujugamemperhatikanbeberapahalyaitupemenuhanpersyaratanhalaldimana
secaraperiodikdilakukanauditolehMUI,DepartemenAgamaJakarta,mulaidarirawmaterial
(bahanbaku)sampaidenganprosesproduksi.Padabahanbakuadasertifikatmasingmasing.PT.
IndofoodSuksesMakmurTbkmemilikitimhalalsendiriuntukmengontrolpersyaratanhalal
yang ditetapkan pabrik yang dilakukan setiap 6 bulan sekali. Sistem jaminan mutu ISO
(InternationalStandaritationOrganitation)diterapkandiPT.IndofoodSuksesMakmurTbkdan
secara periodik dilakukan oleh PT. SGS ICS Indonesia. Untuk SNI dilakukan audit secara
periodik oleh Departemen Perindustrian dan diambil sampel untuk dianalisa pemenuhan
persyaratanSNIproduk.

Pemeriksaan mutu produk akhir dilakukan sesuai dengan standar quality manual PT.
IndofoodSuksesMakmurTbkNoodleDivision.Persyaratanmutuprodukakhirmeliputisesuai
kodeproduksibaikdikartonmaupundietiket,karton(bersihtidakrobek,tidakbasah,tidak
penyok),lakbannyaaslilengket,tertutuprapat,isisesuaistandar,etiket(kodeproduksibenardan
jelas, mudah terbaca) dilakuan pengecekan setiap kedatangan. Kadar air, kadar lemak,
pengecekan bumbu serta kondisi sealer tertutup baik dan rapi dilakukan pengecekan setiap
kedatangan produk. Produk shelf life untuk dianalisa kimia secara periodik dan secara
organoleptik.Shelflifesecaraorganoleptiksetiapshiftsetiaplineharusdianalisa,produkdari
umur08bulankemudiandidokumentasiapakahadaperubahandariwaktukewaktu.Selainitu
Shelflife jugadigunakanuntukreferensijikaterjadipenyimpangansetelahprodukdilemparke
pasardandikonsumsiolehkonsumen.
InformasinilaigizimieinstanProdukIndomiePT.IndofoodSuksesMakmurTbkdapatdi
lihatpadaTabel4.5.

Tabel4.5.Informasinilaigizimieinstan
INFORMASI
NILAIGIZI
Takaransaji1bks85g
jumlahsajiperkemasan1
EnergiTotal420kkal
EnergidariLemak160
kkal

JUMLAHPER
SAJIAN%AKG*
LemakTotal18gr29%
LemakJenuh9gr51%
Kolesterol0mg0%
Protein7gr12%

JUMLAHPERSAJIAN%
AKG
KarbohidratTotal57gr19%
Seratmakanan3gr10%
Gula6gNatrium730mg32%

VitaminA20%
VitaminB140%
VitaminB620%
VitaminB1245%

Niasin35%
AsamFolat30%
AsamPantotenat20%
Kalsium4%
ZatBesi40%
*PersenAKGberdasarkankebutuhanenergi2000kkal,kebutuhanenergiandamungkin
lebihtinggiataulebihrendah

Sumber: PT.IndofoodSuksesMakmurTbk,NoodlesDivisionCabangSemarang

4.

Penyimpanan
Penyimpanan mie instant di gudang diletakkan di atas palletpallet dengan tumpukan
maksimal 8 karton berdasarkan arus FIFO (dimana barang yang proses produksinya selesai
terdahulu akan dijual ke pasar kepasar terlebih dahulu dibandingkan barangbarang proses
produksiyangselesaiberikutnya,jadidengankatalainbarangyangmasukpertamaakankeluar
pertama).
Pengendalian produk selama penyimpanan antara lain penggunaan sistem FIFO dengan
jangka waktu penyimpanan terlama kurang lebih 3 minggu, penumpukan karton maksimal 8
karton,gangguanseranggadiantisipasisetiapharipadaawalshift,setelahistirahatdansebelum
karyawan pulang. Setiap minggu juga diadakan pest control. Pemeriksaan yang dilakukan di
gudangadalahpadasaatpengangkutanprodukkedalamtrukdanyangharusdiperhatikanadalah
kebersihan,penumpukanyangrapidanadanyaterpalpenutup.
Selain melakukan pengendalian pada bahan baku, proses produksi, produk akhir, juga
memperhatikan pemenuhan persyaratan halal dan aman secara periodik dilakukan audit oleh
MUI,DepartemenAgamaJakartamulaidari rawmaterial (bahanbaku)sampaidenganproses
produksi. Pada bahan bakuada sertifikat masingmasing. PT.IndofoodSukses Makmur Tbk
memiliki tim halal sendiri untuk mengontrol persyaratan halal yang ditetapkan pabrik,
mengontrolsendirisetiap6bulansekali.SistemjaminanmutuISO(InternationalStandaritation
Organitation)diterapkandiPT.IndofoodSuksesMakmurTbkdansecaraperiodikdilakukan
auditolehPT.SGSICSIndonesia.UntukSNIdilakukanauditsecaraperiodikolehDepartemen
Perindustrian,dandiambilsampeluntukdianalisapemenuhanpersyaratanSNIproduk.
BerdasarkanSNI0135512000yangdimaksudmieinstanadalahprodukyangterbuatdari
adonantepungdenganatautanpaditambahbahanbahantambahanyangdikeringkandengancara
penggorengandandimasaksetelahdirendamdalamairmendidihselama4menit.Syaratmutu
mieinstansesuaiSNIdapatdilihatpadaTabel4.6.
Tabel4.6SyaratMutuMieInstanMenurutSNI0135512000
No.
1.
1.1
1.2
1.3
1.4
2.
3.
4.

KriteriaUji
Keadaan2)
Tekstur
Aroma
Rasa
Warna
Bendaasing2)
Keutuhan1)
Kadarair

Satuan

Persyaratan

%b/b

Normal/dapatditerima
Normal/dapatditerima
Normal/dapatditerima
Normal/dapatditerima
Tidakbolehada
Min90

4.1
4.2
5.
5.1
5.2
6.
7.
7.1
7.2
8.
9.
9.1
9.2
9.3
9.4

Prosespenggorengan
Prosespengeringan
Kadarprotein2)
Midariterigu
Mibukandariterigu
Bilanganasam1)
Cemaranlogam
Timbal(Pb)
Raksa(Hg)
Arsen(As)2)
Cemaranmikroba2)
Angkalempengtotal
E.colly
Salmonella
Kapang

%b/b
%b/b

Mak10,0
Mak14,5

%b/b
%b/b
mgKOH/gminyak

Min8
Min4
Mak2

mg/kg
mg/kg
mg/kg

Mak2
Mak0,05
Mak0,5

koloni/g
APM/g
APM/g
koloni/g

Mak1x105
<3
negatife/25g
mak1x103

Sumber:DewanStandarisasiNasional,2000
Keterangan:
1
=berlakuuntukkepingmie.
2
=berlakuuntukkepingmiedanbumbunya.
aJenisProdukAkhir
Brand/produkyangdiproduksidi PT. Indofood SuksesMakmurTbk, Noodles Division Cabang
Semarangterdiridariberbagaijenismerkmieinstandanrasayangbermacammacamdapatdi
lihatpadaTabel4.7.
Tabel4.7JenisProdukdiPT.IndofoodSuksesMakmurTbk.
MerkMiInstan
Indomie
d.
e.
f.
g.
h.
Supermi
i.
j.
k.
l.
m.
Sarimi
n.
o.
p.
q.
r.
s.
t.
u.
Nikimiku

Ayambawang
Ayambawangspesial
Soto
Kariayamekstrabawang
goreng
Gorengspesial
Ayambawang
Gorengrasasoto
Gorengrasakari
Gorengrasaayambawang
Superrasaayambawang
Besarayambawang
Ayambawangekstrabawang
goreng
Basosapi
Besarrasaayambawang
Besargorengspesial
Besarrasasotomi
Sotokoyapedas
Sotokoyajeruknipis

v.
w.
Sakura
x.

Baso
Ayambawang
Ayamspesial

Sumber:PT.IndofoodSuksesMakmurTbk,NoodlesDivisionCabangSemarang
Disampingitu,PT. Indofood Sukses MakmurTbk, Noodles Division CabangSemarang
jugamenyediakanproduklainsepertipopmie,indomiekeriting,anakmastetapiprodukproduk
tersebut tidakdiproduksidisinimelainkandiproduksidiPT. Indofood SuksesMakmur Tbk,
NoodlesDivisionCabangJakartadanCabangSurabaya.Produkprodukinisengajadidatangkan
dariJakarta,Surabayauntukmemenuhipermintaankonsumen.

GG.

MesindanPeralatanyangDigunakan
DalammenghasilkanproduknyaPT.IndofoodSuksesMakmurTbkterdapat12lineruang

produksidanmenggunakanmesinmesinsebagaiberikut:
34. Srew
Fungsi

menuang dan mengayak tepung agar bebas dari

cemaranfisik(kerikil,benang,kutudll).
Prinsipkerja

mendorong bahan seperti powder/tepung, butiran

secaracontinuedenganconveyorulir.
Sumberdaya

motorelektrik

Kapasitas

250kg

Material

stainlesssteel

Jumlahalat

12

Waktuproses

1115menit

Fungsi

mengadukdanmencampurtepunghinggahomogen

Prinsipkerja

35. Mixer
mengaduktepungmelaluigerakanrotasioleh blade

yangdigerakandengansebuahmotor
Kapasitas

250kg

Material

stainlesssteel

Jumlahalat

24

Waktuproses

1115menit

Fungsi

mengistirahatkandanmenampungadonan

Prinsipkerja

36. DoughFeeder
mensuplai adonan ke DCM dan dilanjutkan ke

shappingfolding
Material

stainlesssteel

Jumlahalat

12

37. DS(DoughSheet)
Fungsi

membentukadonanmenjadilembaranyangterdiridari

duasetrollpress
Prinsipkerja

menekanadonanmenjadilembaranlembarantebal

Sumberdaya

motorelektrik

Material

stainlesssteel

Jumlahalat

24

Fungsi

membentuklembaranadonan

Prinsipkerja

tekananantarrollerpressing

Sumberdaya

motorelektrik

Material

stainlesssteel

Jumlahalat

12

Fungsi

membentuklembaranadonanyanglebihtipis

Prinsipkerja

tekananantarrollpressing

Sumberdaya

motorelektrik

Material

stainlesssteel

Jumlahalat

84

38. LaminateRoller

39. ContinousRoller

40. Slitter
Fungsi

membentuklembaranadonanmenjadiuntaian mie

kemudianmenujukewavingconveyor
Prinsipkerja

menekan lembaran adonan menjadi untaian mi

denganukuransesuaistandarolehroller
Sumberdaya

motorelektrik

Jumlahalat

12

mengukus untaian mie dari waving unit secara

41. Steamer
Fungsi

continuedenganuapairpanas/steam.
Prinsipkerja

steam dari boiler dialirkan ke pipa steam menuju

steamer.
Jumlahalat

12

Waktuproses

7073detik

Fungsi

memotonguntaianmiedengantekanan

Prinsipkerja

untaianmieditekandengankecepatantinggi

Kecepatan

42potong/menit

Jumlahalat

12

menggorengmihinggakadarairmencapai2,53,5%

42. Cutter

43. Fryer
Fungsi

denganmediumperantaraminyakgorengsehinggadiperolehkematanganmie
yangmerata(tidakmengalamicasehardening)
Prinsipkerja

sirkulasiminyakgorengdenganpemanasanpadaHE

(heatexchange)secaracontinuedengansumberpanasdariboiler
Jumlahalat

12

Waktuproses

7077detik

mendinginkan mie setelah keluar dari penggorengan

44. Cooler
Fungsi

hinggasuhuruang
Prinsipkerja

aliranudaradarikipas/fandidalamcollingbox

Material

stainlesssteel

Jumlahalat

12

Waktuproses

:318322detik

45. Packer
Fungsi

mengemasmimenggunakanetiket

Prinsipkerja

merekatkan dan melipat bagian bawah kemasan /

panjang dengan long sealer, bagian atas dengan upper sealer, bagian
bawah/lebardenganendsealer.
Sumberdaya

motorelektrik

Jumlahalat

24

46. EtiketSealingMachine
Fungsi

membungkusproduk,bumbudanminyakbumbudan

merekatkan etiket dengan mesin long sealer, end sealer, upper sealer dan
lowersealer.
Sumberdaya

:motorelektrik

Kecepatan

:42rpmdan62rpm

Jumlahalat

:24

47. CartonSealingMachine
Fungsi

merekatkanlakbanpadapermukaanbagian atas dan

bawahkarton.
Jumlahalat

:24

Peralatanyangdigunakanpenangananbahansebelumprosesantaralain:
1. Pallet kayu, yang digunakan sebagai dasar tumpukan dari bahanbahan yang disimpan di
gudang.
2. Timbangan,untukmengetahuiberatetiketdaningredient.
3. Lory,untukmemindahkanbarang(etiket,beberapaRMdanlainlain).
4. Stacking,untukmengujikekuatankartondengandiberibebanselama5menit.
5. Tangkiminyakgoreng,untukmenampungdanmenyimpanminyakgoreng.
6. Forklift,untukmengangkutbahanbahanyangdatangdarikendaraanuntukdiangkutketempat

penyimpanan.
7. Keretadorong,untukmengangkatbahanbahanbakukeruangproses.
Peralatanpemindahanbahanyangdigunakanantaralainsebagaiberikut:
E.

Conveyor,merupakanperalatanpenangananbahanyangmemindahkanbahanbaikdengan
arahvertikalmaupunhorizontalantaraduatitikatauduatempatyangtetap.

F.

Hand pallet, merupakan alat yang berupa landasan segi empat yang digunakan untuk
mengangkutmuatanataubahanbahanuntukdidorongolehpekerja,biasanyadenganbantuan
peganganpadasalahsatuujungnya.

G.

ChainHost (kerekanrantai),merupakanalatpemindahbahansecara vertikal danlateral


dalamruangandenganpanjang,lebardantinggiyangterbatas.

VV.

SanitasiPerusahaan

d.

SanitasiBangunan
Sanitasibangunandilakukandenganpembersihanlantai,dinding,setiaphari3kaliatau
dilakukanpadasetiapshift.Selainsecarahariansanitasibangunandilakukansecaraperiodik
yaitudenganpengecatan,pergantianatap,sesuaidenganperiodeyangtelahditetapkan.

e.

Sanitasiperalatan
Peralatan yang digunakan untuk proses produksi hampir semuanya terbuat dari bahan
stainless steelsehinggatidakmudahberkarat,mudahuntukdibersihkandantahan terhadap
garam.Padaindustripengolahanmakananperalatan/mesinperluadanyapembersihan antara
lain:

Screw conveyor dibersihkan sampai dalam body mesin untuk mencegah


mikroorganismeyangada.Pembersihandilakukandiakhirshift.Dibersihkandengancara
dilapdengankainbasah.

Mixer pembersihan dengan di cuci, dilap dengan kain basahagar tidak lengket,
ditangkidicucidenganairdandisikat.Pembersihandilakukanakhirshiftdibagianbody
mesindanbagiandalammesindilakukan1minggusekali.

Pressdilakukanpembersihanadonanyangmenempel,mengelap,lantaidibersihkan,
bodymesindibersihkanperakhirshiftdanbagiandalammesindilakukan1minggusekali.

Steamboxpembersihanpenyikatandenganairdisemprot,pipaalkalisecaraperiodik
dilakukan pembersihan. Cutting and folding pembersihan dilakukan dengan penyikatan
menggunakan air. Pembersihan dilakukan akhir shift dibagian body mesin dan bagian

dalammesindilakukan1minggusekali.
Untuksanitasifryeradabeberapatahappembersihanyaitupembersihandilakukan

setiaphari,setiapshiftmiehancurharusdibersihkan,setiapistirahatlantaidibersihkan.
Secara periodik pembersihan dengan air panas, dengan bahan kimia tertentu untuk
menghilangkan minyakminyak yang menempel. Setiap minggu dilakukan pembersihan
totaldenganmenggunakanbahankimiatertentuagarkerakterlepas.
Cooler dibersihkan di bagian body mesin setiap shift, untuk kipas angin setiap

minggu pembersihan menggunakan sabun desinfektan. Untuk packing pembersihan


dilakukandenganmembongkarmesinuntukmenghilangkanserpihanserpihanmiedalam
mesin dan dinding kemudian mesin disemprot dengan alkohol. bagian dalam mesin
dilakukanpembersihan1minggusekali.
Untuksanitasirawmaterialdenganmenjagakebersihanperalatan.Secaraperiodik

pembersihanpalletpalletditangkisetiapsatubulansekali.Untuk finishgoods dengan


membersihkandebu,lantai,dinding,pengendalianseranggadigudangdipasangperangkap
tikus,dibeberapabagianpintudipasanginsectkiller.
f.

Sanitasitenagakerja
SanitasidanGMPdilakukanpenilaianpershift,tangankaryawansetiap2jamdisemprot
dengan alkohol dengan cara setiap 2 jam bergantian keluar dari ruang produksi dan
menyemprotkan tangan dengan alkohol di pintu masuk ruang proses, mengenakan pakaian,
masker, topi, sepatu yang seragam, dan sebelum masuk ruang produksi harus cuci tangan
dengansabundesinfektankemudiandikeringkandandisemprotdenganalkoholpadatelapak
tangan.

WW. PengolahanLimbah
50. MacammacamLimbah
Setiapindustripengolahanpanganselalumenghasilkanlimbahbaiklimbahpadat,cair
maupungas.Limbahindustripangandapatmenimbulkanmasalahdalampenanganankarena
mengandungsejumlahbesarkarbohidrat,protein,lemak.Garamgarammineraldansisasisa
bahankimiayangdigunakandalampengolahandanpembersihan.Olehkarenaitudiperlukan
penangananyangseksamaterhadaplimbahpengolahanpanganagarlimbahyangdihasilkan
tidakmembahayakanlingkungansekitar.
MacammacamlimbahyangyangadadiPT.IndofoodSuksesMakmurTbkadalah:

4. LimbahPadat
5. Ceceranadonanmiedanprodukkadaluarsa:miegagalproduksi,miebasah,miehancur
pecah (HP) dan mie hancur halus (HH), yang berasal dari pembentukan mie,
pengukusanmie,dansaatpenggorenganmie.
6. Bekas kemasan bahan baku, bahan penolong, dan kemasan rusak : plastik, karton,
kantongtepung,bobin,kertasdarigudangRawMaterial,gudangFinishedGood,dan
mesinpengemas.
7. Limbahpadatdomestik:kartondansampahyangberasaldarikantordankantin.
8. LimbahCair
9. Limbahcairproduksi
10. LimbahcairLaboratorium
11. LimbahBoiler
12. Limbahkantindantoilet
51. PengolahanLimbah
LimbahdariprosesproduksidiPT.IndofoodSuksesMakmurTbk.DivisiNoodleCabang
Semarangberupalimbahcair,limbahpadatdanlimbahgas.Limbahpadatyangdihasilkanpada
waktuprosesproduksimieinstanyaituterdiridariscrabmieHH/HP,scrabmiebasah,scrab
miehancurminyak,scrabkartonbekasbumbu,scrabkartonbekasminyakbumbu,scrabsak
tepung, scrab plastik bekas dan scrab bobin. Mie yang tidak masuk dalam standar produk
dipisahkandanditempatkanpadaplastik.Mieyangjatuhsetelahmelewati/sebelumpadawaktu
prosessteam(scrabmibasah),fryer(scrabmihancurminyak)diletakkanpadakantongplastik
yangberbedauntukkemudiandigilingdandijadikanpakanternak,begitujugauntukscrabmie
yang jatuh ke lantai (berukuran kecil/serbuk). Sedangkan untuk scrab mie HP yang masih
dalamkeadaanbersihinidijadikanserbukkoya.Scrabkartonbekasbumbu,scrabkartonbekas
minyakbumbu,scrabsaktepung,scrabplastikbekasdanscrabbobindisimpandalamgudang
penyimpananscrabuntukkemudiandijual.
Limbahcairberupasisasteaming,airsisapencucianalat,airdarikantin,laboratorium,
kamar mandi/toilet. Limbah ini nantinya diproses menjadi satu di tempat unit pengolahan
limbahyangsudahdisediakansehinggatidakmengotorilingkungandanprosesnyapunsangat
ramahlingkungan.Diagramalirprosespengolahanlimbahdapatdilihatpadagambar4.3
Trapping

Ekualisasi
UASB
Aerasi
Sedimentasi
Koagulasi
Klorinasi
Filterisasi
Airlimbahterolah
Penampungan
Airuntukpenyiramantaman,pencucianbanmobil
Gambar4.3DiagramAlirProsesPengolahanLimbahCair

Keterangan:
a.

Traping adalah usaha memisahkan antara limbah padat yang terikut dalam limbah
mengalir,limbahmengapungdanlimbahcair.

b.

Equalisasiadalahmengikatsumberlimbahyangbermacammacamyaituunitproduksi,
kantin,kamarkecildanboiler.

c.

Aerasibertujuanuntukmendgradasisisapolutansecaraaerob.

d.

Sedimentasimengendapkanpadatantersuspensiyangterikatdalamprosesaerasi.

e.

Bak kontrol diuji apakah memenuhi syarat untuk kehidupan atau tidak dengan cara
memeliharaikanmasdidalamnya.

f.

Koagulasi dan sedimentasi penggumpalan dimaksudkan menggumpalkan padatan


tersuspensi dengan bantuan Alumunium Sulfat (Al2(SO4)3) yang disebut juga Filter
Alumunium.

g.

Klorinasi untuk membunuh mikroba yang mungkin ada dalam air limbah maka
dimasukkankaporit(CaCl(OCl)kedalamairdibakklorinasi.

h.

Penyaringan dan organosorb sisa endapan yang masih terikat dalam air yang telah
diklorinasidisaringdenganmenggunakansandfilterdanarangaktif.

BABV
PENUTUP

13. Kesimpulan
Dari hasil kegiatan magang di PT. Indofood Sukses Makmur Tbk
SemarangJawaTengahdapatdiambilbeberapakesimpulansebagaiberikut
L.

Tahaptahap proses produksi mie instan pada PT. Indofood Sukses


Makmur Tbk. Divisi Noodle antara lain; penuangan tepung ke mesin
screw conveyor, mixing, roll sheeting dan slitting, steaming, frying,
coolingdanpacking.

M.

Bahanbahan yang digunakan PT. Indofood Sukses Makmur Tbk.


Divisi Noodle CabangSemaranguntukmemproduksimieinstanyaitu:
tepungterigu,tepungtapioka,danairalkali(air,garamdapur,ingredient
lainnyadanpewarna).

N.

Untuk mendapatkan kualitas mie yang bagus, PT. Indofood Sukses


Makmur Tbk melakukan pengendalian mutu bahan baku tepung dan
bahanbahantambahan.

O.

Pengontrolanterhadapprosespembuatanmieinstanyangdimulaidari
pengayakantepungteriguhinggapengemasantelahdilakukandenganbaik
olehPT.IndofoodSuksesMakmurTbk.

P.

PT. Indofood Sukses Makmur Tbk telah menerapkan sistem FIFO


dalam penyimpanan terhadap produk mie instan sehingga kualitas mie
instantetapterjagadenganbaik

Q.

KonsistensimutuprodukmieinstanPT.IndofoodSuksesMakmurTbk
terjaga dengan penerapan sistem manajemen mutu ISO 9001 : 2000,
SistemJaminanHalaldanSNI.

R.

Proses pembuatan mie instan dilakukan dengan memperhatikan


sanitasilingkungandiantaranyayaitusanitasikaryawan,kebersihanmesin

dankebersihanruangproses.
14. Saran
y. Dalamprosesproduksiperlupenambahankaryawanyangditempatkandibagianprosescutting
andfoldingagarmieyangberadapadamangkokslittertertatarapidanmengurangimieyang
tidakstandar.
z. Mempertahankansistemmanajemenperusahaanyangsudahberlangsungdenganbaik.
aa. Meningkatkan pengendalian mutu setiap tahapan proses produksi secara cermat dan efisien
mengingatsetiaptahapproduksisalingmempengaruhikhususnyaterhadapmutudankualitas
mieinstanyangdihasilkan.

DAFTARPUSTAKA

Anonim,2008.http//:www.ebookpangan.com.Diaksestanggal10November2008pukul15.35.
Anonim,2008.http//:www.ISO9000.com.Diaksestanggal30Juni2009pukul15.35.
Assauri,S.1980.ManajemenProduksi.LPEEUI.Jakarta.
Astawan,M.1999.MembuatMiedanBihun.PenebarSwadaya.Jakarta.
Bukkle, K.A, R.A Edwards, G.H Fleet dan M. Wooton. 1985. Ilmu Pangan. Jakarta : Universitas
IndonesiaPress.
Drerosier,NormanW.1988.TeknologiPengawetanPangan.UIPress.Jakarta.
Feigenbaum,A.V.1992.KendaliMutuTerpadu.ErlanggaJakarta.
Hadi,Anwar.2000.SistemManajemenMutuLaboratorium.PT.GramediaPustakaUtama.Jakarta.
JamesEKroger,RobertB.MatsuoandJoelW.Dick.1996.PastaandNoodleTechnology.American
AssociationofCarealChemist,Inc.St.PaulMinnesata.USA.
Nitasari,Lidia.2003.ProsesProduksiMieInstantdanEvaluasiPerencanaanSanitasiPerusahaandi
PT.TigaPilarSejahtera.UGM.Yogyakarta.
Ketaren,S.1986.PengantarTeknologiMinyakdanLemakPangan.UIPress.Jakarta.
Kerr,RW.1950.ChemistryandIndustryofStarch.Academic,inc.NewYork.
Kotler,P.1997.ManajemenPemasaran.Prenhalindo.Jakarta.
Nitisemito,AlexS.1981.Marketing.GhaliaIndonesia.Jakarta.
Matz,SA.1984.SnackFoodTechnologySecondEdition.TheAVIPublishingCo,WestPressLtd.New
Delhi.
Suyanti.2008.MembuatMiSehatBergizidanBebasPengawet.PenebarSwadaya.Depok.
Tati Nurmala, Wiyono. 1980. Budidaya Tanaman Gandum (Triticum spp). PT. Karya Nusantara.
Jakarta.
Yuyun,A.2008.PanduanMembuatdanMenjualAnekaMi.Agromedia.Jakarta.
Winarno,F.G.,1997.KimiaPangandanGizi.PT.GramediaPustakaUtama,Jakarta

LAMPIRAN

Lampiran1

Pengujiankadarlemak
Carakerja:
15.

Menghaluskandanmenimbang24grcontoh(G),bungkusdengankertassaring

16.

Mengeringkandalamoven1050Cselama5jam,didinginkan+tambang.(H)

17.

Mengekstrakdenganpetroleumbenzendalamalatsoxhletselama3jam

18.

Labupenampung,alatekstraksisoxhletdanalatpendingindipasang

19.

Menuangkan pelarut organik (petroliumether) melalui lubang alat pendingin sampai

etherturunkedalamlabupenampungdandiisilagisampaisetengahisialatekstraksi
20.

Mengalirkan air pendingin dan pemanas dihidupkan.ekstraksi 4 jam sampai pelarut

jernih
21.

Mematikan pemanas saat ether di dalam alat ekstraksi mengalir turun ke labu

penampung
22.

Mengeluarkanbungkusansampel+diovensampaiethermenguapdanditimbang.(1)

Perhitungan:
%lemakkasar(wb)=(H1)100%
G
%lemak(db)=(H1)100%
H

Lampiran2

PengujianKadarGluten

Carakerja
13. Menimbangtepungterigu10gramkedalambekergelas100ml(agr)
14. Menambahkan aquades6mlsambildiulenisampaimenjadigumpalandantidakmelekat
padadindingbekergelas
15. Merendamselama15menitdalamairhangat(60)
16. Mencucigumpalantersebutdenganairmengalirsampaiaircucianbersih
17. Menimbang(bgr)
18. Meratakanpadakertassaringyangtelahdikeringkan
19. Mengovenpadasuhu1051100Cselama3jam
20. Mendinginkandalamdesikator
21. Menimbang(cgr)
Perhitungan:
Kadarglutenwetbasis=b100%
a
Drybasis=cb100%
a

Lampiran3

PengujianKadarAir

Carakerja:

5) Mengovencawandantutupnyaselama30menit1050C
6) Mendinginkandalamdesikator
7) Menimbangcawan+tutup(W1gram)
8) Menimbangcontoh25gramdalamcawan(WOgram)
9) Mengovenselama3jam(cawanditutup)
10) Mendinginkandalamdesikatorselama3040menit(tutupdibuka)
11) Menimbangcawandanisinya(W2)
Perhitungan:
Kadarair=W1W2100%
W1W0
Keterangan:
W1=cawantimbangdantutup(gr)
W0=cawantimbangdantutupdancontohujisebelumdipanaskan(gr)
W2=cawantimbangdantutupdancontohujisetelahdipanaskan(gr)

Lampiran4
KriteriaPengecekanQualityControl
Tabel3.1KriteriaPengecekanQualityControl

No
1

Kriteria
Screw
Cemaranbahannajis
Camaranbendaasing
Fisikkemasan
Warna
Aroma
Jumplahterigu/adonan
Mixing
Camaranbendaasing
Waktumixing
Jumplahlarutanalkali
Jumlahpenambahanairputih
Jumlahpenambahanbahanbakulain/adukan
Camaranbendaasing
Pressing
Cemaranbahannajis
Camaranbendaasing
Ketebalanuntaian
slitting
Jumlahuntaian
Bentukuntaian
Bantukgelombang
Steaming
Cemaranbahannajis
Camaranbendaasing
Penampakan
Waktu
Tekanan(kg/cm2)
Suhu
Cutting
Cemaranbahannajis
Camaranbendaasing
Lipatanmi
Beratmibasah
Frying
Cemaranbahannajis
Camaranbendaasing
Suhudepan
Suhutengah
Suhubelakang
Waktu
Levelminyak
Colling
Cemaranbahannajis
Camaranbendaasing
Bentukmi
Suhumi
Waktu
Organoleptik
Wraping
Kondisiproses

Standar
Tidakada
Tidakada
Standar
Normal
Normal
Sesuaistandar
Tidakada
1115menit
Sesuaistandar
Sesuaistandar
Sesuaistandar
Tidakada
Tidakada
Tidakada
1,15mm
7073
Normal
Normal
Tidakada
Tidakada
Normal
7073detik
0,250,4kg/cm2
90100oC
Tidakada
Tidakada
2cm
2gr
Tidakada
Tidakada
1001100C
1201300C
1401500C
7077detik
4cm
Tidakada
Tidakada
Normal
<32oC
318322detik
Normal
Normal

Suhuendsealer
Suhulongsealer
Rpm
Kehalalanproduk
Mutuetiket
KelengkapanProduk
KodeProduksi
Kodeproduksikarton

Sesuaisrandar
Sesuaisrandar
Sesuaisrandar
A/R/1/0
Sesuaistandar
A1527029
GNKSB

Isi/dus

L51109
40pcs

Kondisisealing

Lampiran5DokumentasiPelaksanaanKegiatanMagang

Peralatanyangdigunakandalampenanganandanpengangkutanbahanbaku/bahanpenunjang

Gambar5.1Forklip

Gambar5.2Lori

Gambar5.3HandPallet

Gambar1.4
Gambar5.4Pallet
Lampiran6DokumentasiPelaksanaanKegiatanMagang

Peralatanyangdigunakandalamanalisakarton,etiket

Gambar6.1Stecking

Gambar6.2Teclock

Lampiran7SkemaMesindanPeralatan
7.

MesinPengepresAdonan(RollingPress)

Keterangan:
22. MesinPencampur
23. BakPengumpan
24. Pisau/BalingBaling
25. MotorPenggerak

8.

RollPress

a. PengaturKetebalan
b. ConveyorFeeder
c. LembaranAdonan

d. RollPress
e. Slitter

9.

MesinPembagiJalur

Keterangan:

Rooler

LembaranAdonan

Slitter

PenutupMangkok

RollerPembagi

10.

BautPemberat

4.MesinSteamer

Keterangan:
ZZ.

TutupPengukus

AAA. PipaPenyedotUapAir
BBB. RuangPengukusan
CCC. ConveyortempatKedudukanMie
11.

MesinCutter

Keterangan:
5.

Conveyor

6.

KipasAngin

7.

RollKecil

8.

PisauPemotong

9.

RollNylon

10.

Cangkulan

11.

DistributorConveyor

12.

Mesinfryer

Keterangan:

13.

MangkokMie

TutupMangkok

BakPenggorengan

CerobongUapMinyak

MotorConveyorPenggoreng

PenaraKedalasanMinyak
MesinPacker

Keterangan:
g.

As/RollerPemegangEtiket

h.

RollerPengumpanEtiket

i.

SensorRegisterMark

j.

KotakKontrol

k.

ConveyorBusa

l.

FormingBox

m.

EndSealer

n.

ConveyorPenghempas

o.

SikatPembuangUdaradalamKemasan

p.

SwitchuntukEmergencyStop

q.

CouplingPenggerakConveyorPengumpan

r.

LongSealer

s.

HandlePengaturEksentrisitas

t.

HandlePengaturPanjang/PendekKemasan

u.

HandlePengaturKecepatanPengemasan

v.

RodaPemutarEndSealer

w.

RegisterControllerKnop