Anda di halaman 1dari 349

1

Bagaimanaterjadinyaminyakdangasbumi?
Adatigafaktorutamadalampembentukan
minyakdan/ataugasbumi,yaitu:
Pertama,adabebatuanasal
(sourcerock)yangsecarageologis
memungkinkanterjadinyapembentukan
minyakdangasbumi.

Kedua,adanyaperpindahan(migrasi)\
hidrokarbondaribebatuanasalmenuju
kebebatuanreservoir
(reservoirrock),umumnyasandstone
ataulimestoneyang
berpori-pori(porous)danukurannyacukup
untukmenampunghidrokarbontersebut.

Ketiga,adanyajebakan(entrapment)geologis.
Strukturgeologiskulitbumiyangtidakteraturbentuknya,
akibatpergerakandaribumisendiri(misalnyagempabum
idanerupsigunungapi)danerosiolehair
dananginsecaraterusmenerus,dapat
menciptakansuaturuanganbawahtanahyang
olehlapisanyangimpermeable,makahidrokarbon
tadiakandiamditempatdantidakbisabergerak
kemana-manalagi.

Temperaturbawahtanah,yangsemakin
dalamsemakintinggi,merupakanfaktor
pentinglainnyadalam
pembentukanhidrokarbon.
Hidrokarbonjarangterbentukpada
temperaturkurangdari65OCdan
umumnyateruraipadasuhu
diatas260oC.
Hidrokarbonkebanyakanditemukanpadasuh
umoderat,dari107ke177oC.
6

Apasajakomponenkomponenpembentukminyakbumi?
Minyakbumimerupakancampuranrumit
dariratusanrantaihidrokarbon,
yangumumnyatersusunatas
85%karbon(C)dan15%hidrogen(H).
Selainitu,jugaterdapatbahanorganik
dalamjumlahkecildanmengandung
oksigen(O),sulfur(S)ataunitrogen(N).
8

Apakahadaperbedaandari
jenis-jenisminyakbumi?.
Ya,ada4macamyang
digolongkanmenurut
umurdanletakkedalamannya,
yaitu:
young-shallow,oldshallow,
young-deepdanold-deep
9

.Minyakbumiyoungshallow

biasanyabersifatmasam(sour),
mengandungbanyakbahanaromatik,
sangatkentaldan
kandungansulfurnyatinggi.
Minyakold-shallowbiasanyakurangkental,
titikdidihyanglebihrendah,dan
rantaiparaffinyanglebihpendek.
10

Old-deep
membutuhkanwaktuyang
palinglamauntukpemrosesan,
titikdidihnyapalingrendahdan
jugaviskositasnyapalingencer

11

Sulfuryangterkandung
dapatteruraikanmenjadiH2Syang
dapatlepas,sehinggaold-deep
adalahminyakmentahyang
dikatakanpalingsweet.
Minyaksemacaminilahyangpaling
diinginkankarenadapatmenghasilkan
bensin(gasoline)yangpalingbanyak.
12

Berapalamawaktuyangdibutuhkan
untukmembentukminyakbumi?
Sekitar
30-jutatahundipertengahanjaman
Cretaceous,padaakhirjaman
dinosaurus,lebihdari
50%daricadanganminyakdunia
yangsudahdiketahuiterbentuk
13

Cadanganlainnyabahkandiperkirakan
lebihtualagi.
Darisebuahfosilyangdiketemukanbersa
maandenganminyakbumidarijaman
Cambrian,diperkirakanumurnyasekitar
544sampai505-jutatahunyanglalu.

14

Parageologisumumnyasependapat
bahwaminyakbumiterbentuk
selamajutaantahundari
organisme,tumbuhandanhewan,
berukuransangatkecilyanghidup
dilautanpurba.

15

Begituorganisme
lautinimati,badannyaterkuburdi
dasarlautanlalutertimbunpasirdan
lumpur,membentuklapisan
yangkayazatorganikyangakhirnya
akanmenjadibatuanendapan
(sedimentaryrock).
16

Prosesiniberulangterus,satulapisan
menutuplapisansebelumnya.
Laluselamajutaantahunberikutnya,
Lautandibumiadayangmenyusutatau
berpindahtempat.

17

Deposit yang membentuk batuan


endapanumumnya tidak cukup
mengandung oksigen untuk
mendekomposisimaterialorganiktadi
secarakomplit.
Bakterimenguraizatini,molekul
demimolekul,menjadimaterialyang
kayahidrogendankarbon.

18

Tekanandantemperaturyang
semakintinggidari
lapisan bebatuan di atasnya kemudian
mendistilasi
sisa-sisa bahan organik, lalu
pelan-pelanmengubahnyamenjadi
minyakbumidangasalam
19

Bebatuanyangmengandung
minyakbumitertuadiketahuiberumurle
bihdari600-jutatahun.
Yangpalingmudaberumur
sekitar1-jutatahun.
Secaraumumbebatuandimana
diketemukanminyakberumurantara
10-jutadan270-jutatahun.
20

Bagaimanacaranyamenemukan
minyakbumi?
Adaberbagaimacamcara:
observasigeologi,surveigravitasi,
surveimagnetik,surveiseismik,
memborsumuruji,ataudengan
educatedguessdanfaktor
keberuntungan.
21

Surveigravitasi:
metodeinimengukurvariasi
medangravitasibumiyang
disebabkanperbedaan
densitasmaterialdistruktur
geologikulitbumi.
22

Surveimagnetik:
metodeinimengukurvariasi
medanmagnetikbumiyang
disebabkanperbedaan
propertimagnetikdaribebatuan
dibawahpermukaan.
23

Keduasurveiinibiasanyadilakukandi
wilayahyangluasseperti
misalnyasuatucekungan(basin).
Darihasilpemetaanini,
barumetodeseismikumumnya
dilakukan.
24

Surveiseismikmenggunakan
gelombangkejut
(shockwave)buatanyang
diarahkanuntukmelalui
bebatuanmenujutargetreservoir
dandaerahsekitarnya.

25

Olehberbagailapisanmaterial
dibawahtanah,gelombangkejut
iniakandipantulkankepermukaan
danditangkapolehalatreceivers
Sebagaipulsatekanan
(olehhydrophonedidaerahperairan)
atausebagaipercepatan
(olehgeophonedidarat).
26

Sinyalpantulaninilalu
diprosessecaradigitalmenjadi
sebuahpetaakustikbawah
permukaanuntuk
kemudiandapatdiinterpretasikan.
27

seismic

28

drilling and well construction

29

well logging

30

Well testing

31

Well completion

32

33

Apakahrig?Apasajajenis-jenisnya?
Rigadalahserangkaianperalatankhusus
yangdigunakanuntukmemborsumur
ataumengaksessumur.
Ciriutamarigadalahadanyamenarayang
terbuatdaribajayangdigunakanuntuk
menaik-turunkanpipa-pipatubularsumur.

34

Umumnya,rigdikategorikanmenjadiduamacam
menuruttempatberoperasinya:
1.Rigdarat(land-rig):beroperasididarat.
2.Riglaut(offshore-rig):
beroperasidiataspermukaanair
(laut,sungai,rawa-rawa,danauatau
deltasungai).
35

Darifungsinya,rigdapat
digolongkanmenjadi
duamacam:

36

1.Drillingrig:
rigyangdipakaiuntukmembor
sumur,baiksumurbaru,
cabangsumurbaru
maupunmemperdalamsumurlama.

37

2.Workoverrig:
fungsinyauntukmelakukansesuatu
terhadapsumuryangtelahada,
misalnyauntukperawatan,
perbaikan,penutupan,dsb.
38

39

40

41

42

43

Apasajakomponenrig?
Komponenrigdapatdigolongkanm
enjadilimabagianbesar:

44

Hoistingsystem:
fungsiutamanyamenurunkan
danmenaikkantubular
(pipapemboran),
peralatancompletionataupipa
produksimasuk-keluarlubangsumur.
Menararig(mastatauderrick)
termasukdalamsistemini.
45

Rotarysystem:
berfungsiuntukmemutarkanpipapipatersebutdidalamsumur.
Padapemborankonvensional,
pipapemboran(drillstrings)memutar
mata-bor(drillbit)untuk
menggalisumur.

46

Circulationsystem:
untukmensirkulasikanfluida
pemborankeluarmasuksumur
danmenjaga
agarpropertilumpursepertiyang
diinginkan.
47

(1)pompatekanantinggiuntuk
Memompakanlumpurkeluarmasuksumurdanpompatekananrendauntuk
mensirkulasikannyadipermukaan,

48

(2)peralatanuntukmengkondisikanlumpur:
shaleshaker
berfungsiuntukmemisahkansolidhasil
pemboran(cutting)darilumpur;desander
untukmemisahkanpasir,
degasseruntukmengeluarkangas,
Desilleruntukmemisahkanpartikelsolid
berukurankecil,dsb

49

Blowoutpreventionsystem:
peralatanuntukmencegahblowout
(meledaknyasumurdipermukaanakibat
tekanantinggidaridalamsumur).
Yangutamaadalah
BOP(BlowOutPreventer)
yangtersusunatasberbagai
katup(valve)
dandipasangdikepalasumur(wellhead).
50

Powersystem:yaitusumbertenagauntukmen
ggerakansemuasistemdiatas
danjugauntuksuplailistrik.
Sebagaisumbertenaga,biasanyadigunakanme
sindieselberkapasitasbesar.

51

52

Mengapadigunakanlumpur
untukpemboran?
Lumpurumumnyacampurandari
tanahliat(clay),biasanyabentonite,
danairyangdigunakanuntuk
membawacuttingkeataspermukaan.

53

Lumpurberfungsisebagai
lubrikasidanmediumpendinginunt
ukpipapemborandan
matabor.

54

Lumpurmerupakankomponen
pentingdalampengendaliansumur
(wellcontrol),karenatekanan
hidrostatisnyadipakaiuntukmencegah
fluidaformasimasukkedalamsumur.

55

Lumpurjugadigunakanuntuk
membentuklapisansolidsepanjang
dindingsumur(filter-cake)yang
bergunauntukmengontrolfluidayang
hilangkedalamformasi(fluid-loss).

56

57

58

Process flow diagram (PFD)

Cilacap Refinery Configuration


Middle
EastCrude
118mbsd

FuelOil
Complex

LongResidue
MixCrude
(Domestic&
Import)
230mbsd

1747 kt/a
56.13 mbsd

FuelOil
Complex

II

LPG7.92mbsd
Premium68.25mbsd
Naphtha16.67mbsd

Kerosine62.10mbsd
Avtur10.34mbsd
Solar(ADO/IDO)82.00mbsd
LSWR14.33mbsd
M-bakar(IFO)56.43mbsd

LubeOil
ComplexI/II/III

Naphtha

Paraxylene

591 Kt/a
15.77 mbsd

BaseOil
428kt/a
ParafinicOil34kt/a
Minarex24kt/a
Asphalt
720kt/a
SlackWax100kt/a
Solar40kt/a(0.9mbsd)
WhiteOil(*)
IFO359kt/a(7.4mbsd)
LPG11.88kt/a
Raffinate108.90kt/a
Paraxylene268.95kt/a
Benzene103.29kt/a
Toluene0.0kt/a
HeavyAromate27.06kt/a

Remark: (*) Plan, kt/a: kilo ton per annum


2/12/15

CilacapRefineryIndonesia

60

Process flow diagram (PFD)

KILANG MINYAK CILACAP

65

66

inimenyatakanbahwa
minyakbumimerupakanproduk
perubahansecaraalami
darizat-zatorganikyangberasal
darisisa-sisatumbuhandanhewan
yangmengendapselama
ribuansampaijutaantahun.
67

Akibatdaripengaruhtekanan,
temperatur,
kehadiransenyawalogamdan
mineralsertaletakgeologisselama
prosesperubahantersebut,
makaminyakbumiakanmempunyai
komposisiyangberbedaditempat
yangberbeda.
68

Teoriinimenyatakanbahwa
minyakbumimerupakanproduk
perubahan
secaraalamidarizatzatorganikyang
Berasal darisisa-sisa
tumbuhandanhewanyangmengen
dap
selamaribuansampaijutaantahun.

69

akibatdaripengaruhtekanan,
temperatur,
kehadiransenyawalogamdan
mineralserta
letakgeologisselamaprosesperubahan
tersebut,makaminyakbumiakan
Mempunyaikomposisiyangberbeda
ditempatyangberbeda.
70

KomposisiMinyakBumi
Minyakbumimemilikicampuran
senyawahidrokarbon
sebanyak50-98%berat,sisanya
terdiriatas zat-zatorganikyang mengandung
belerang, oksigen,dannitrogensertasenyawa
senyawaanorganikseperti
vanadium,nikel,natrium,besi,
aluminium,kalsium,danmagnesium.
Secaraumum,komposisiminyakbumidapat
dilihatpadatabelberikut:
71

Tabel1.
KomposisiElementalMinyakBumi

berdasarkankandungansenyawanya,
minyakbumidapatdibagimenjadi
golonganhidrokarbondannon
hidrokarbonserta
senyawa-senyawalogam.

72

Komposisi

Persen

Karbon(C)

8487

Hidrogen(H)

1114

Sulfur(S)

03

Nitrogen(N)

01

Oksigen(O)

02
73

Hidrokarbon
Golonganhidrokarbon-hidrokarbonyang
utamaadalah
parafin,olefin,naften,danaromat.
(PONA)

74

75

Parafin
Parafinadalahkelompoksenyawa
hidrokarbonjenuh berantailurus(alkana),
CnH2n+2.
Contohnya adalah metana (CH4),etana
(C2H6), n-butana(C4H10),
Isobutana(2-metilpropana,C4H10),
isopentana (2-metilbutana,C5H12),
Isooktana(2,2,4-trimetilpentana,C8H18).
76

Parafin
Jumlahsenyawayangtergolong
kedalamsenyawaisoparafin
jauhlebihbanyakdaripada
senyawayangtergolongn-parafin.
Tetapi,didalamminyakbumi
mentah,kadarsenyawa
isoparafinbiasanya
lebihkecildaripadan-parafin.
77

Olefin
Olefinadalahkelompok
senyawahidrokarbontidakjenuh,CnH2n.
Contohnya
Etilena(C2H4),propena(C3H6),
danbutena(C4H8).

78

Naftena
Naftenaadalahsenyawahidrokarbon
jenuhyangmembentukstrukturcincin
denganrumusmolekulCnH2n.
senyawa-senyawakelompoknaftena
yangbanyak
ditemukanadalahsenyawa
yangstrukturcincinnyatersusun
dari5atau6atomkarbon.
79

Naftena
Contohnyaadalahsiklopentana
(C5H10),
metilsiklopentana(C6H12)
dansikloheksana(C6H12).
Umumnya,didalamminyakbumimentah,
naftenamerupakankelompok
senyawahidrokarbonyang
memilikikadarterbanyakkeduasetelah
n-parafin.
80

Aromatik
Aromatikadalahhidrokarbonhidrokarbontakjenuhyangberintikan
atom-atom
Karbonyangmembentuk cincinbenzen(C6H6).
Contohnyabenzen(C6H6),
Metilbenzen(C7H8),dannaftalena(C10H8).
MinyakbumidariSumateradan
Kalimantanumumnyamemilikikadararomat
yangrelatifbesar.
81

NonHidrokarbon
Selainsenyawa-senyawayangtersusundari
atom-atomkarbondanhidrogen,didalam
minyakbumiditemukanjugasenyawa
nonhidrokarbonsepertibelerang,nitrogen,
oksigen,vanadium,nikeldannatriumyang
terikatpadarantaiataucincinhidrokarbon.

82

NonHidrokarbon
Unsur-unsur tersebutumumnya
tidakdikehendaki
beradadidalamproduk-produk
pengilangan minyakbumi,sehingga
keberadaannya akansangatmempengaruhi
langkah-langkahpengolahanyangdilakukan
terhadapsuatuminyakbumi.
83

Belerang
Belerang terdapat dalam bentuk
hidrogensulfida(H2S),
belerangbebas (S),
merkaptan(R-SH),
denganR=gugusalkil),
sulfida(R-S-R),disulfida(R-S-S-R)
Dantiofen(sulfidasiklik).
Senyawa-senyawabelerangtidak
dikehendakikarena:
84

menimbulkanbautidaksedapdan
sifatkorosifpadaprodukpengolahan.
mengurangiefektivitaszat-zat
bubuhanpadaprodukpengolahan.
meracunikatalis-katalisperengkahan.
menyebabkanpencemaranudara

85

(padapembakaranbahan
bakarminyak,
senyawabelerangteroksidasi
menjadizat-zatkorosifyang
membahayakan
lingkungan,yaituSO2danSO3).
86

Nitrogen
Senyawasenyawanitrogendibagimenjad
iZatzatyangbersifatbasa
seperti3metilpiridin(C6H7N)
dankuinolin(C9H7N)
sertazat-zatyangetidakbersifatbasa
sepertipirol(C4H5N),indol(C8H7N)
dankarbazol(C12H9N).

87

Senyawa-senyawa
nitrogendapatmengganggu
kelancaranpemrosesankatalitik
yangjikasampai
terbawakedalamproduk,
berpengaruh
burukterhadapbau,
kestabilanwarna,
sertasifatpenuaanproduktersebut
.
88

Oksigen
Oksigenbiasanyaterikatdalamgugus
karboksilatdalamasam-asamnaftenat
(2,2,6-trimetilsikloheksankarboksilat,C10H18O2)
danasam-asamlemak(alkanoat),
gugushidroksifenolikdangugusketon.
Senyawaoksigentidakmenyebabkan
masalahseriussepertihalnyasenyawabelerangda
nsenyawanitrogenpada
proses-proseskatalitik.

89

Senyawalogam
Minyakbumibiasanya
mengandung
0,001-0,05%beratlogam.
Kandunganlogamyang
biasanyapalingtinggi
adalahvanadium,nikel
dannatrium.
Logam-logaminiterdapat

90

bentukgaramterlarutdalamair
yangtersuspensi
dalamminyakataudalambentuk
senyawaorganometalyanglarutdalamminyak.
Vanadiumdannikelmerupakanracun
bagikatalis-katalis
pengolahanminyakbumidandapat
menimbulkanmasalahjika
terbawakedalam
91

Jenisminyakbu
mi
Ringan

Specificgravity(s o
)
API
0,830

39

Mediumringan

0,830-0,850

39-35

Mediumberat

0,850-0,865

35-32,1

Berat

0,965-0,905

32,1-24

Sangatberat

0,905

24,8

92

93

Kilangminyakbumiberfungsiuntuk
mengubahcrudeoil(minyakmentah)
menjadiprodukjadiseperti
LiquidPetroleumGas/LPG,gasoline,
kerosene,diesel,fueloil,
lubebaseoil,dancoke

94

Secaraumumteknologiproseskilang
minyakbumidikelompokkanmenjadi
3macamproses,yaitu:

95

PrimaryProcessing
Unit-unityangdikelompokkankedalamprimaryprocessing
adalahunit-unityang
hanyamelibatkanperistiwafisis,yaitudistilasi.
Prosesdistilasiadalahproses
pemisahankomponen-komponen
minyakbumiberdasarkanperbedaan
Titikdidihnya.
Primaryprocessingterdiridari
CrudeDistillationUnit/CDUdanVacuum
DistillationUnit/VDU.
96

SecondaryProcessing
Unit-unityangdikelompokkankedalam
secondaryprocessingadalahunit-unit
yangmelibatkanreaksikimia. Secondaryprocessingterdiridari
Hydrotreatingprocess,
CatalyticReforming/Platformingprocess,
Hydrocrackingprocess,
FluidCatalyticCracking/
ResidualCatalyticCracking/ResidualFluidCatalytic
Cracking/HighOlefineFluidCatalyticCracking,
HydrogenProductionUnit/HPU,
DelayedCokingUnit/DCU,danVisbraking

97

RecoveryProcessing
Unit-unityangdikelompokkankedalamrecoveryprocessing
dalahunit-unityangbertujuanuntuk
memperolehkembaliminyakyangdiproduksiatau
chemicalyangdigunakandi
unit-unitprimarydansecondaryprocessingatauuntuk
mengolahlimbahcairataugassebelumdibuangkelautatau
udaraluar/lingkungansekitar.
RecoveryprocessingterdiridariAmineunit,
SourWaterStrippingUnit,danSulphurRecoveryUnit.

98

Kilangminyakbumiberfungsi
untukmengubahcrudeoil
(minyakmentah)
menjadiprodukjadiseperti
LiquidPetroleumGas/LPG,gasoline
kerosene,diesel,fueloil,
lubebaseoil,dancoke.
99

100

Process flow diagram (PFD)

Cilacap Refinery Configuration


Middle
EastCrude
118mbsd

FuelOil
Complex

LongResidue
MixCrude
(Domestic&
Import)
230mbsd

1747 kt/a
56.13 mbsd

FuelOil
Complex

II

LPG7.92mbsd
Premium68.25mbsd
Naphtha16.67mbsd

Kerosine62.10mbsd
Avtur10.34mbsd
Solar(ADO/IDO)82.00mbsd
LSWR14.33mbsd
M-bakar(IFO)56.43mbsd

LubeOil
ComplexI/II/III

Naphtha

Paraxylene

591 Kt/a
15.77 mbsd

BaseOil
428kt/a
ParafinicOil34kt/a
Minarex24kt/a
Asphalt
720kt/a
SlackWax100kt/a
Solar40kt/a(0.9mbsd)
WhiteOil(*)
IFO359kt/a(7.4mbsd)
LPG11.88kt/a
Raffinate108.90kt/a
Paraxylene268.95kt/a
Benzene103.29kt/a
Toluene0.0kt/a
HeavyAromate27.06kt/a

Remark: (*) Plan, kt/a: kilo ton per annum


2/12/15

CilacapRefineryIndonesia

102

CRUDEDISTILLATIONUNIT
(CDU)
(

103

FeeddanProdukCrudeDistillationUnit
JenisumpanCDUdapatberupa
sourcrudeatausweetcrude
tergantungdaridisainnya.
Penggunaancrudenon-disaintetap
dimungkinkannamunterlebihdahulu
harusdilakukanujicoba
pemakaianuntukmengetahuiefeknya
terhadapunit-unitdowstream.
104

JenisProduk
Overheadproduct
(Gas,LPG)
Naphtha
Kerosene
Diesel
Atmosphericresidue

CutRangeNormal
T
BP,oC
<30
30-150
150-250
250-370
370+
105

Tingkatketajamanpemisahanditentukan
berdasarkangapantara
95%temperaturdistilasiASTMfraksi
denganboilingpointlebih
rendahdan5%temperaturdistilasiASTM
fraksidenganboilingpointlebihtinggi.
Bestpracticegaptersebutadalah
sebagaiberikut:
Straightrunnaphtha/Kerosene:20oF(11oC).
Kerosene/Diesel :10oF(5,6oC)

106

107

CrudeDistillationUnit(CDU)beroperasi
denganprinsipdasarpemisahan
berdasarkantitikdidihkomponenpenyusunnya.
KolomCDUmemproduksi
produkLPG,naphtha,kerosene,dandiesel
sebesar50-60%volumefeed,
sedangkanproduklainnyasebesar40-50%
volumefeedberupaatmosphericresidue.

108

Atmosphericresiduepadakilanglama,yang
tidakmemilikiVacuumDistillation
Unit/VDU,biasanyahanyadijadikanfueloil
yangvalue-nyasangatrendahatau
dijualkekilanglainuntukdiolehlebihlanjut
diVDU.
Sedangkanpadakilang
modern,atmosphericresiduedikirimsebagai
feedVacuumDistillationUnitatau
sebagaifeedResiduelCatalyticCracking
109

(setelahsebagiannyadi-treating
diAtmosphericResidueHydro
Demetalizationunit
untukmenghilangkan
kandunganmetalatmosphericresidue).

110

CrudeOilComposition
Crudeoilterdiridariatomcarbondan
hydrogenyangbergabungmembentuk
molekulhydrocarbon.
Berdasarkanstruktur
molekulerumum,hydrocarbon
dikelompokkanmenjadi4macam,
yaituparaffin,naphthene,aromatic,
danolefin.
111

Paraffin
Senyawaparaffinpalingsimpleadalah
methane(CH4).
Contohsenyawaparafinlainadalah
ethane(C2H6)
ataubiasadisebutdrygas,
propane(C3H8),
butane(C4H10),pentane(C5H12),
Hexane(C6H14),heptane(C7H16),
octane(C8H18)danseterusnya.
112

Paraffin
.Molekulparaffinmempunyai

formulastandardCnHn+2dengann
adalahjumlahatomcarbon.
Penamaansenyawaparafin
mempunyaikeunikan,yaitu
diberiakhiran-ane.
113

Naphthene

Strukturhydrocarbonjenisinilebih
kompleksdaripadastruktur
hydrocarbonjenisparaffinekarena
atomcarbontersusundalam
suatucincin
Contohstrukturhydrocarbonjenisnaphthene
adalahsebagaiberikut:

114

Aromatic

Senyawaaromatikyangpalingsederhanadan
yangmemilikiboiling
pointpalingrendahadalahbenzene(C6H6).
Senyawainiserupadengansenyawanaphthene
dalamhalstrukturringnamunberbeda
dalamhaljumlahatomhydrogenyanghanyasatu
yangterikatpadaatomcarbon
(naphthenememiliki2atomhydrogenyang
terikatpadaatomcarbon).

115

Olefin

Olefinsangatjarangditemukandalamc
rudeoilkarenakomponenini
merupakanprodukdekomposisidari
jenishydrocarbonlainnya.
Konsentrasiolefinterbesarditemukan
dalamprodukthermalcrackingdan
catalyticcracking

116

Sepertipemberiannamapadajenisparaffin,
penamaanjenisolefinmempunyaikeunikan.
Jikasenyawamemiliki1ikatanrangkap
disebutdenganakhiranene
(sepertipropene,butene)
danjikasenyawamemiliki2ikatan
rangkapdisebut
denganakhiran-adiene
(sepertibutadiene,propadiene).
117

SenyawaLain
Selainmengandungsenyawasenyawahydrocarbonsepertitersebut
diatas,crudeoiljugamengandungsenyawasenyawalaindalam
Jumlahkecilyangdikelompokkansebagai
impurities,sepertisebagaiberikut:

118

Salts/Garam
Senyawagaramyangpalingbanyakadalah
senyawachloride,
sepertisodiumchloride,magnesiumchloride,
dancalciumchloride.
Senyawagaraminidapatmembentukasamyangdapat
menimbulkankorosipadabagianataskolomCDU.
Senyawagaramjugabisamenyebabkanpluggingpada
peralatan
Sepertiheatexchangerdantraykolomfraksinasi

119

Senyawasulfur
Jikasulfurcontentsuatucrude
tinggidisebutsourcrude.
Senyawasulfuryangpalingringan
adalahhydrogensulfide
(H2S)yangselainkorosifjuga
merupakandeadlygas.

120

Senyawasulfur
Senyawalainadalahmercaptanyang
merupakannamaumumuntuk
paraffinichydrocarbonyangsatuatom
hydrogennyadigantidengan
radikalSH.
Senyawasulfurlainnyamempunyaistruktur
ringolefindanbiasanyadiberi
namadepanthio
121

Metal
Jenismetalyangbiasaditemukandicrudeoiladalah
arsenic,lead(timbal),vanadium,nikel,danbesi.
Sebagianbesarmetal
dalamumpanCDUakankeluarbersama
atmosphericresidue.
Arsenicdanleadmerupakanracunpalingmematikan
darikatalisunitcatalyticreforming,
sedangkanvanadium,nikel,danbesi
akanmendeaktivasikataliscatalyticcracking.
122

Sand,MineralMatterandWater
Senyawasenyawainidikelompokkan
bersamasebagaiBase
SedimentandWater(BS&W),dan
biasanyaberjumlahkurang
dari0,5%wttotalcrude.

123

Desalter
Sepertitelahdijelaskandiatas,crudeoil
mengandungsaltwaterdansediment.
Saltcontentcrudeoilbiasanyadilaporkan
Sebagaipoundssalt
(diukursebagaisodiumchloride)
perthousandbarrelsminyak(ptb).
Rangesaltcontentbervariasi
antara0s/d1000ptb,
biasanyaantara10s/d200ptb
124

Padasebagianbesarcrudeoil,sekitar95%total
saltcontentditemukandalamBS&Wcrudeoil.
Saltterjadidalambentukhighly
concentratedbrine dropletyang terdispersidalamcrudeoil.
Dropletinisangatkecildansangatsusahterpisah
daricrudeoil.
Prosesdesaltingberfungsiuntukmengencerkan
highsaltcontentbrine
denganmenambahkanfreshwaterpadacrudeoil
Untukmemproduksilowsaltcontentwater.

125

126

Agarfresh waterdapatberkontakdengan efektif


denganconcentratedbrineatauBS&W,
suatuemulsiharusterbentukuntuk
mendispersiairyangadapadacrude.
Emulsidiproduksidengan
melewatkanliquidpadakecepatantinggimelalui
orificekecilyang
kemudianmelaluimixingvalve.
Setelahdemulsifikasidansettling,
BS&Wyangtersisadalamcrudeadalahdiluted
water,bukanlagiconcentratedbrine.
127

AliranProses
CrudeDistillationUnit
ProcessFlowDiagramCDU
dapatdilihatpadagambarberikut

128

129

130

131

132

133

Process flow diagram (PFD)

135

136

137

Distilasiadalahlangkahpertama
dalampengolahanminyakmentah
danituterjadidisebuahmenara
bajatinggiyangdisebutkolom
fraksinasi

138

Bagiandalamkolomdibagi
padaintervaldengan
nampanhorizontal
139

Kolomdisimpansangatpanasdibagian
bawah(kolomterisolasi)tetapisebagai
mendidihhidrokarbonyangberbedapada
temperaturyangberbeda,suhusecara
bertahapmengurangikearahatas,sehingga
setiapbakisedikitlebihdingin
daripadayangdibawahini.
140

Minyakmentahharusdipanaskan
sebelummemasukikolomfraksinasi
daninidilakukanpadaawalnyadalam
serangkaianpenukarpanasdimana
panasdiambildarialiranproseslainnya
yangmemerlukanpendinginansebelum
dikirimkekumuh
141

Panasjugabertukarterhadap
kondensasialirandarikolomutama.
Biasanya,minyakmentahakan
memanasdengancarainiuptosuhu
200-2800C,sebelummemasuki
tungku
142

Sebagaiminyakmentahmentahtiba
mengandungsedikitairdangaram,
itubiasanyadikirimuntukgaram
menghapuspertama,dalamsebuah
peralatanyangdisebutdesalter

143

Huludesalter,minyakmentah
dicampurdenganaliranair,biasanya
sekitar4-6%padapakan.
Intenspencampuranberlangsung
melaluikatuppencampurandan
(opsional)sebagaimixerstatis.

144

Thedesalter,sebuahkapalpenuhbesarcair,
menggunakanmedanlistrikuntuk
memisahkanminyakmentahdari
tetesanair.
Maskapaiinimengoperasikanterbaikdi
120-1500C,karenaitunyaman
ditempatkandisuatutempatditengahtengahkeretapreheat
145

Bagiandarigaramyangterkandung
dalamminyakmentah,terutama
magnesiumklorida,yang
terhidrolisapadasuhudiatas
1200C.
146

Setelahhidrolisis,kloridabisa
dikonversimenjadiasamklorida,yang
akanmenemukanjalanoverheadkolom
distilasidimanaituakanmenimbulkan
korosipadakondensoroverheat

147

Sebuahdesaltermelakukan
yangbaikdapatmenghapus
sekitar90%darigaramminyak
mentahmentah.
148

Hilirdesalter,minyakmentahlebih
lanjutdipanaskandenganpenukar
panas,danmulaimenguap,yang
akanmeningkatkanpenurunan
tekanansistem.
149

Padasekitar170-2000C,minyak
mentahakanmemasukkan'praflashvessel',beroperasipadasekitar
2-5barg,dimanauapdipisahkan
daricairanyangtersisa
150

Uapakanlangsungdikirimke
kolomfraksionasi,dandengan
demikian,bebanhidrolikpadasisa
keretapreheatmentahdantungku
berkurang(pipalebihkecildan
pompa).
151

Hanyahulukapalpreflash,aliran
kaustikkecildicampurdengan
minyakmentah,untukmenetralisir
asamkloridadibentukoleh
hidrolisis.
152

Natriumkloridaterbentukakan
meninggalkankolomfraksinasi
melaluialiranresidubawah.

153

Tingkatdosisdarikaustik
disesuaikanberdasarkan
pengukurankloridadalamkapal
overhead(biasanya10-20ppm).

154

Padasekitar200-2800C
minyakmentahmemasuki
tungkudimanadipanaskan
sampailebihlanjutuntuksekitar
330-3700C.
155

Aliranstopkontaktungku
dikirimlangsungkekolom
fraksinasi.
156

157

Disini,dipisahkanmenjadi
sejumlahfraksi,masing-masing
memilikirentangdidihtertentu.

158

Pada3500C,dansekitar1barg,
sebagianbesarfraksidivapourise
minyakmentahdanbangkitkolom
melaluiperforasidinampan,
kehilanganpanassaatmerekanaik
159

Ketikasetiapfraksimencapaibaki
manasuhutepatdibawahtitik
didihnyasendiri,mengembundan
berubahkembalikefasecair.

160

Sebuahfasecairkontinyumengalir
olehgravitasimelalui'downcomers'
daribakikebawahnampan

161

Dengancaraini,fraksi-fraksiyang
berbedasecarabertahapdipisahkan
darisatusamalainpadanampan
darikolomfraksinasi.

162

Fraksiterberatmengembundi
nampanrendahdanmengembun
fraksiringanpadanampanlebih
tinggidalamkolom.

163

Padaketinggianyangberbeda
dalamkolom,dengannampan
khususyangdisebutmenarik-off
nampan,fraksidapatditarikkeluar
padagravitasimelaluipipa,untuk
diproseslebihlanjutdikilang
164

Diataskolom,uapmeninggalkan
melaluipipadandiarahkanke
kondensoroverhead,biasanya
didinginkanolehudarafin-fans.

165

Padaoutletkondensoroverhead,
padasuhusekitar400C,campuran
gas,cairandannaftaada,yangjatuh
kedalamakumulatoroverhead.

166

Gasyangdiarahkankekompresor
untukpemulihanlebihlanjutdari
LPG(C3/C4),sedangkancairan
(bensin)yangdipompakeunit
hydrotreateruntukmenyingkirkan
sulfur
167

Sebuahkolomfraksinasimembutuhkan
alirankondensasibawahcairdalam
rangkauntukmemberikankekuatan
pendoronguntukpemisahanantara
fraksiringandanberat.

168

Dibagianatasdarikolominialiran
cairandisediakanolehmemompa
alirankembalidariakumulatoratas
kedalamkolom

169

Sayangnya,banyakpanasyang
disediakanolehtungkuuntuk
menguapkanhidrokarbonhilang
terhadapudaraambiendifin-fan
pendinginoverhead.
170

Sebuahcaracerdasuntukmencegah
inipanasyanghilangdari
kondensasihidrokarbondilakukan
melaluidialirkanbalikberedardari
kolom.

171

Dalamrefluksberedar,sisimenarik
hot-offdarikolomdipompamelalui
serangkaianpenukarpanas
(terhadapminyakmentahmisalnya),
dimanasungaididinginkan.

172

Alirandingindikirimkembalike
dalamkolompadaketinggianyang
lebihtinggi,dimanaiatelahdibawa
dalamkontakdenganuappanas
meningkat.

173

Inimenyediakanmekanisme
kondensasiinternaldidalamkolom,
dengancarayangsamaseperti
refluksatastidakyangdikirim
kembalidariakumulatoroverhead.
174

Tujuanutamadarirefluks
beredarkarenaituuntuk
memulihkanpanasdari
kondensasiuap.
175

Sebuahkolomfraksionasiakan
memilikibeberapa(biasanyatiga)
daridialirkanbaliktersebut,
masing-masingmemberikanaliran
cairanyangcukupkebagianyang
sesuaidarikolom.
176

Keuntungantambahandarimemiliki
dialirkanbalikberedaradalahbahwa
halituakanmengurangibebanuap
ketikaakankeatasdalamkolom.Ini
memberikankesempatanuntuk
memilikidiameterkolomkeciluntuk
bagianatasmenara.
177

Sepertipengurangandiameter
disebut'swage'.
Sisiringanmenarik-offdarikolom
fraksionasiadalahsebagiankecilyang
disebutminyaktanah,direbusdalam
kisaran160-2800C,yangjatuhkebawah
melaluipipakedalamkolomyanglebih
kecilyangdisebut
'side-penaritelanjang'.
178

Tujuandaristrippersisiadalah
untukmenghilangkanhidrokarbon
sangatringandenganmenggunakan
injeksiuapataupemanaseksternal
yangdisebut'reboiler'.
179

Tingkatsteamstripping,atau
tugasreboileddikendalikan
sepertiuntukmemenuhi
spesifikasiflashpointproduk

180

Demikianpulauntukkolom
atmosfer,strippersisitelah
fraksionasinampanuntuk
menyediakankontakantara
uapdancair.
181

Uapyangdihasilkandaribagian
atasstrippersisiyangdiarahkan
kembalimelaluipipakedalam
kolomfraksionasi.

182

Sisi(opsional)keduadanketiga
menarik-offdarikolomfraksionasi
utamaadalahpecahangasoil,
mendidihdalamkisaran200-400
0C,yangakhirnyadigunakanuntuk
campuranprodukdieselakhir.
183

Miripsepertidenganprodukminyak
tanah,fraksigasoil(gasoilringan
danberat)yangpertamakalidikirim
kestrippersisisebelumdialihkanke
unitmengobatilanjut.

184

Dibagianbawahkolom
fraksinasiyangberat,cokelat/
hitamfraksiberwarnadisebut
residudiambiloff.

185

Dalamrangkauntukmelucutisemua
hidrokarbonringandarifraksiinidengan
benar,bagianbawahkolominidilengkapi
dengansatusetnampanpengupasan,yang
dioperasikandenganmenyuntikkan
beberapauappengupasan(1-3%pada
produkbawah)kebagianbawahkolom.

186

187

FeeddanProdukVDUFuelType
Seperti telah dijelaskan diatas,
FeedVDUfuelTypeadalah
atmosphericresidueyangberasaldariCDU
(boilingrange370s/d540oC+),
sedangkanproduknyaberupa
LightVacuumGasOil
(boilingrange243s/d382oC),
HighVacuumGasOil(boilingrange
365s/d582oC),danVacuumResidue
(boilingrang582oC+)
188

FeeddanProdukVDULubesType
FeedVDUlubestypedapatberupa
atmosphericresidueyang
berasaldariCDU(untukLubeBaseOilplantyang
memproduksilubebaseoilgrade
rendah/non-sintetis)atauberupaunconverted
oilyangberasaldariunitHydrocracker
(untukLubeBaseOilplant
yangmemproduksilubebaseoilgradetinggi/sintetis).
ProdukprodukVDUlubestypetergantungjenis
gradelubebaseoil
yangingindihasilkannya,biasanyaada3jenis
gradeyangdapat
dihasilkanolehVDUlubestype.
189

190

191

Cilacap Refinery Configuration


Middle
EastCrude
118mbsd

FuelOil
Complex

LongResidue
MixCrude
(Domestic&
Import)
230mbsd

1747 kt/a
56.13 mbsd

FuelOil
Complex

II

LPG7.92mbsd
Premium68.25mbsd
Naphtha16.67mbsd

Kerosine62.10mbsd
Avtur10.34mbsd
Solar(ADO/IDO)82.00mbsd
LSWR14.33mbsd
M-bakar(IFO)56.43mbsd

LubeOil
ComplexI/II/III

Naphtha

Paraxylene

591 Kt/a
15.77 mbsd

BaseOil
428kt/a
ParafinicOil34kt/a
Minarex24kt/a
Asphalt
720kt/a
SlackWax100kt/a
Solar40kt/a(0.9mbsd)
WhiteOil(*)
IFO359kt/a(7.4mbsd)
LPG11.88kt/a
Raffinate108.90kt/a
Paraxylene268.95kt/a
Benzene103.29kt/a
Toluene0.0kt/a
HeavyAromate27.06kt/a

Remark: (*) Plan, kt/a: kilo ton per annum


2/12/15

CilacapRefineryIndonesia

192

Padaawalnyakilanghanyaterdiri
darisuatu
CrudeDistillationUnit(CDU)yang
beroperasidenganprinsipdasarpemisaha
nberdasarkan
titikdidihkomponenpenyusunnya.

193

DenganhanyamemilikiCDU,maka
CDUhanyamemproduksi
produkLPG,naphtha,kerosene,
dandiesel
sebesar50-60%volumefeed,
sedangkan40-50%volumefeed
yangberupaatmosphericresidue
Biasanyahanyadijadikanfueloil
yangvalue-nyasangatrendah
194

Secaraumumtemperaturcrackingminyak
mentah/crudeadalahsekitar370oC
(UOPmenyebut385oC)padatekanan
1atmosfer(sebenarnyabervariasi
tergantungjeniscrude,tetapisecara
umumrata-ratapadatemperatur
tersebut).

195

Olehkarenaitupemisahan
minyakyangdilakukandiCrude
Distillationunittidak
bolehmelebihitemperature
370oCagar
minyaktidakmengalamicracking.
196

Secaraumumtemperaturcrackingminyak
mentah/crudeadalahsekitar370oC
(UOPmenyebut385oC)padatekanan
1atmosfer(sebenarnyabervariasi
tergantungjeniscrude,tetapisecara
umumrata-ratapada
temperaturtersebut).
197

IdedasaroperasiVDUadalah
bahwatitikdidih
(boilingpoint)semuamaterial
turundenganmenurunnya
tekanan.
Sebagaicontoh,padatekanan
1atmosferairmempunyaititikdidih
100oC,sedangkan
padatekanan10atmosferair
mempunyaititikdidih180oC.
198

Jikatekanandikurangihingga
1psiamakatitik
didihairakanmenjadi39oC.

199

TeoriVacuumDistillationUnit
Crudeoilmengandungberbagaimacam
komponen
yangmempunyaititikdidih
berbeda-beda,
sepertitergambardalamgambarberikut:

200

201

Sepertiterlihatpadagambar
diatas,crudeoilmengandung
komponenyang
mempunyaititikdidih>370oC.

202

JikabottomCDU(ataubiasadisebut
atmosphericresidueataulongresidueatau
(reducedcrude)padatekanan
atmosferisdipanaskanhingga
temperature>370oC
untukdapatmenguapkan
komponenvacuumgasoilyang
terkandungdalamlongresidue,maka
akanterjadithermaldecomposition.
203

Denganmenurunkantekanan,
hingga<1psia,
makakomponenvacuumgasoiltersebut
apatdipisahkandaribottomVDU
(ataubiasadisebutvacuumresidue
ataushortresidue)
tanpamengalami
thermaldecomposition.
204

Kemudiankeduanya(vacuumgasoil
danvacuumresidue)
dapatdipisahkan
menjadi2streamyangbebeda
untukdapatmeningkatkanmargin
kilang.

205

Parameter

CDU

VDU

FlashZonePressure

1atm(760mmHg)

30mmHgA

FlashZoneTemp.

330-350oC

HeaterCOT

o
330-350C
LPG,Naphtha,
Kerosene,Diesel,
Atmospheric
Residue

o
400-410C
o
416-427C
LightVacuumGasOil,
HeavyVacuumGasOil,
VacuumResidue(untukVDU
fueltype)danLubeCut-1,
LubeCut-2,Lube-Cut-3
(untukVDUlubestype;nama
tergantungviscosityatau
viscosityindex-nya).

Produk

206

FeeddanProdukVDUFuelType
Sepertisetelahdijelaskandiatas,
FeedVDUfueltypeadalah
atmosphericresidueyang
berasaldariCDU
(boilingrange370s/d540oC)

207

sedangkanproduknyaberupa
LightVacuumGasOil
(boilingrange243s/d382oC),
HighVacuumGasOil
(boilingrange
365s/d582oC),
danVacuumResidue
(boilingrang582oC+).
208

209

FeeddanProdukCrudeDistillationUnit
JenisumpanCDUdapatberupa
sourcrudeatausweetcrude
tergantungdaridisainnya.
Penggunaancrudenon-disaintetap
dimungkinkannamunterlebihdahulu
harusdilakukanujicobapemakaian
untukmengetahui
Efeknyaterhadapunit-unitdowstream
210

VariabelProsesCrudeDistillationUnit
Beberapavariabelprosesyang
berpengaruhpadaoperasiCDU
adalahsebagaiberikut:

211

FlashZone
Temperature

212

FlashZoneTemperature
Semakintinggiflashzone
temperaturemakasemakin
banyakyieldproduk
yangdihasilkan,dan
sebaliknyasemakinsedikit
yieldbottomCDU.
213

COT
CombinedOutletTemperatur,yaitu
temperaturegabunganpadaoutlet
daritiapflowpassfiredheater.

214

Temperaturedrawoff
Temperaturetarikanproduk
darikolom
(VDU/CDU/fraksinasi).

215

Reflux
Aliranprodukkolomfraksinasiyang
dikembalikankekolomfraksinasi
Untukmengaturspesifikasidan
jumlahprodukyangdihasilkanoleh
kolomfraksinasi

216

Flashzonetemperature
Temperaturinletkolom
(VDU/CDU/fraksinasi).

217

AsalMinyakBumi
Minyakmentahataucrudeoiladalahcairan
coklatkehijauansampaihitamyangterutama
terdiridarikarbondanhidrogen.
Teoriyangpalingumumdigunakanuntuk
menjelaskanasalusulminyakbumiadalah
organicsourcematerials.

218

Namun
flashzonetemperatuetidakboleh
terlalutinggikarenadapat
Mengakibatkanterjadinya
thermaldecomposition/cracking
umpan.

219

Temperaturethermal
decomposition/crackingtergantung
jenisumpan.
Padaumumnyatemperature
thermal decomposition/cracking crude
adalah sekitar 370 oC
(UOPmenyebutkan385oC).
220

Flashzonetemperaturediatur
secaratidaklangsung,
yaitudenganmengaturCombined
OutletTemperatur/COTfiredheater

221

TemperatureTopKolomCDU
Temperature top kolom CDU diatur
dengan mengembalikan
sebagiannaphthayangtelah
dikondensasisebagairefluxkembali
ketopkolomCDU.
222

Jikatemperatureflashzone
dinaikkan,maka
refluxrateharusdinaikkanuntuk
menjagatemperaturetoptetap.
Temperaturetopkolommerupakan
salahsatupetunjuk
endpointnaphtha.

223

Untukmemperolehendpointover
headprodukyanglebih
rendah makatop temperature harus
diturunkan dengan cara
menambahjumlahtopreflux
224

TekananTopKolomCDU
Meskipuntekanantopkolomtidak
pernahdivariasikan,namun
perubahankecilpadatekanantop
kolomakanmenghasilkan
perubahanbesarpadatemperature
padakomposisiumpanyang
tetap.
225

Jikatekanantopkolomtidakdapat
dijagatetapdanoperasi
CDUhanymengandalkan
Qualitycontrolprodukhanya
berdasarkanpengaturantemperature
tray/temperaturedrawoff,
makakomposisiprodukakanberubah
cukupsignifikan.
226

Pressureswingyangsangatseringakan
membuatoperasiCDUmenjadi
tidakstabil.
Untukmenjagastabilitastekanan
topkolommaka
dipasangtemperaturecontrolleryang
di-cascadedenganflowtopreflux.
227

StrippingSteam
Jumlahstrippingsteam(superheated)
yangdimasukkankebottom
tiapsidecutproductstripperdigunakanun
tukmenghilangkanuap
ringanyangterlarutdalamproduk,
yangakanmenentukanflash
pointproduk.
228

Strippingsteamdapatjuga
dimasukkankebagian
bawah/bottomkolomCDUsebagai
penggantireboilerdenganfungsi
sama,yaitumenghilangkanfraksi
ringanyangadadalamproduk
bottomkolomCDU.

229

230

231

232

233

234

235

236

237

238

Catalyticcrackingcairan(FCC)
adalahproseskonversiyangpaling
pentingyangdigunakandalamkilang
minyakbumi

239

Halinibanyakdigunakanuntuk
mengkonversitinggimendidih,tinggiberatmolekulhidrokarbonfraksi
petroleumminyakmentahuntuklebih
berhargabensin,olefingas,dan
produklainnya.
240

Crackinghidrokarbonminyakbumi
padaawalnyadilakukanolehtermal
retak,yangtelahhampirsepenuhnya
digantikanolehcatalyticcracking
karenamenghasilkanbensinlebih
tinggidengannilaioktan

241

Halinijugamenghasilkangas
produksampinganyanglebiholefin,
dankarenanyalebihberharga,
daripadayangdihasilkanoleh
retaktermal.

242

ThebahanbakukeFCCbiasanyaitu
bagiandariminyakmentahyang
memilikiawaltitikdidihdari340C
ataulebihtinggipadatekananatmosfer
danrata-rataberatmolekulberkisar
darisekitar200sampai600atau
lebihtinggi.
243

Inibagiandariminyakmentah
seringdisebutsebagaiminyak
gasberat.

244

ProsesFCCmenguapdanistirahat
panjangrantaimolekulyangtinggi
didihcairanhidrokarbonmenjadi
molekulyanglebihpendekdengan
menghubungibahanbaku,padasuhu
tinggidantekananmoderat,dengan
bubukterfluidisasikatalis.
245

Akibatnya,kilangmenggunakan
catalyticcrackingcairanuntuk
memperbaikiketidakseimbangan
antarapermintaanpasaruntuk
bensindankelebihanberat,berbagai
produkdidihtinggiyangdihasilkan
dari
penyulinganminyakmentah.
246

Pada2006,unitFCCyangberoperasi
pada400kilangminyakdiseluruh
duniadansekitarsepertigadariminyak
mentahhaluspadamerekakilang
diprosesdalamFCCuntuk
menghasilkantinggioktanbensindan
bahanbakarminyak
247

Selamatahun2007,unitFCCdi
AmerikaSerikatdiprosestotal
5.300.000barel(834.300.000liter)per
haridaribahanbakudan
FCCunitdiseluruhduniadiproses
sekitarduakalijumlahitu.
248

ReaktordanRegenerator
Reaktordanregenerator
dianggapjantungUnitCracking
FluidCatalytic
249

250

251

252

ApakahFCCitu?

FCCdalahunitsecondaryprocessingdi
kilangyangmenggunakan
micro-spherodialcatalyst
(zeoliticcatalyst)yang
akanterfluidisasidengan
pengaturansupplyudarayangtepat.
253

ApakahFCCitu?

FCCbertujuanuntukmengubah
fraksiminyakbumiyang
memilikiboilingpointtinggi
menjadigasoline
denganoktantinggi
254

PerbedaandenganRCC
(ResidualCatalyticCracking)
terutamahanyapadajenis
feedyangdiolah.

255

BiasanyaRCC
mengolahatmosphericresidue
yangberasaldari
CrudeDistillationUni/CDU
(setelahsebelumnyadihilangkan
kandunganmetal-nyadiunit
AtmosphericResidue
Hydrodemetalizationunit),
sedangkanFCCmengolah
gasoilyangberasaldari
VacuumDistillationUnitVDU.
256

MengapaFCCMenggunakan
CirculatingFluidizedBed?
Sangatbaikdalamhalkontakantaragasdanpadatan.
Sangatbaikdalamhalkeefektifankatalis.
Sangatbaikdalamhalpengendaliantemperatureinternal.
Sangatmenguntungkandalamhalregenerasikatalis.

257

Reactor
Feedmasukmelaluibagianbawahriser,
berkontakdengankatalisyangsudah
diregenerasi.
Reaksicrackingterjadidalamfaseuap.
Kenaikanvolumuapmengangkat
katalisdanmeningkatkanjumlah
minyakyangteruapkan.
Reaksiyangterjadidireactorhanya
dalamhitungandetik.
258

Riser
Aliranumpanyangmengalirdalamriser
adalahplugflow.
Steamdigunakanuntukmengatomisasiumpan.
Kecepatanuapkeluar
adalahsekitar18meter/detik,sedangkan
hydrocarbonresidencetimeadalah2detik.

259

Cyclone
Cycloneterletakpadabagianakhirriseruntuk
Memisahkankatalisdariuapminyak.
Cyclonemenggunakandeflectordevice
untukmembelokkanarahkataliskebawah.
Biasanyadigunakan2stagecyclone.
Cyclonemengembalikankataliskestrippermelaluidipleg.
Uapprodukkeluarcyclonedanmengalirke
Mainfractionationcolumn.

260

Stripper
Spentcatalystsetelahbereaksidengan
minyakkemudianjatuhKestripper.
Selamaprosesreaksidiriser,valuable
hydrocarbonakanterserapdalamcatalystbed.
Olehkarenaitudiperlukan
stripperuntukmen-stripvaluablehydrocarbonini
daripermukaankatalis.

261

Stripper
Strippingsteam,dengankecepatan

4kgper1000kg
sirkulasikatalis,digunakanuntuk
men-striphydrocarbon
Daripermukaankatalis.
Levelkatalismenyediakanpressurehead
yangmembuatkatalismengalir
menujuregenerator.

262

Regenerator
Regeneratormempunya duafungsi,
Yaitumengembalikan
aktivitaskatalis(dengancaramembakar
cokeyangadapadapermukaankatalis)
danmenyediakanpanasuntuk
meng-crackumpan.
Udaramerupakansumberoksigen
untukpembakaran
cokeyangadapadapermukaankatalis.

263

Regenerator
Kecepatanudaradari
mainairbloweradalah1meter/detik
untukmempertahankan
catalystbeddalamkondisifluidized.
Pressuredroppadaair
distributordijagasekitar2psiuntuk
menjaminpositive
airflowmelaluisemuanozzle.
264

Regenerator
Regeneratormempunya duafungsi,
Yaitumengembalikan
aktivitaskatalis(dengancaramembakar
cokeyangadapadapermukaankatalis)
danmenyediakanpanas
untukmeng-crackumpan.
Udaramerupakansumberoksigen
untukpembakaran
cokeyangadapadapermukaankatalis.

265

StandpipedanSlideValve
Standpipememberikanpressureheadyangdiperlukanuntu
kmensirkulasikankatalisdisekitarunit.
DensitaskatalisdalamStandpipeadalah642kg/m3.
Slidevalvedigunakanuntuk
mengaturkecepatanalirandariregenerated
catalystkeriser.
Slidevalveberfungsiuntukmemberikankatalis
yangcukupuntukmemanaskanumpanhingga
mencapaitemperaturereactoryangdiinginkan.

266

267

Prosesperengkahanthermal(thermal
Cracking)adalahsuatuprosespemecahan
rantaihydrocarbondarisenyawarantai
panjangmenjadihydrocarbondenganrantai
yanglebihkecilmelaluibantuanpanas

268

Suatuprosesperengkahanthermal
bertujuanuntukmendapatkanfraksi
minyakbumidenganboilingrange
yanglebihrendahdarifeed
(umpannya).
269

Dalamprosesinidihasilkan:gas,
gasoline(naphtha),gasoil(diesel),
residueataucoke.
Feednyadapatberupagasoil
atauresidue.
270

Setelahmengalamipemanasanawal
danditampungdalamakumulator,
prosespemanasanselanjutnya
dilakukandalamsuatufurnace(dapur)
sampaimencapaitemperatur
rengkahnya.
271

Keluardarifurnace,minyakyang
sudahpadasuhurengkahtadi
dimasukkandalamsuatusoaker,yaitu
suatualatberbentukdrumtegakyang
bergunauntukmemperpanjangreaksi
perengkahanyangterjadi.
272

Selanjutnyahasilperengkahan
dimasukkankedalamsuatumenara/
kolompemisah(fractionator)dimana
berikutnyaakandipisahkanmasingmasingfraksiyangdikehendaki.

273

Adajugabagianyangdikembalikan
lagiuntukdirengkahlebihlanjutyang
disebutrecyclestock.

274

SelainmenghasilkanprodukBBM
(bahanbakarminyak)dangas,dalam
prosesperengkahanthermaljuga
dihasilkancokes.

275

Cokesyangdiharapkanhanya
terbentukdidalamchamber(coke
drum)dapatpulaterbentukdidinding
tubesheater/furnacedantransferline
(pipatransfer).

276

Cokestersebutterbentuksedikit
demisedikitdanpadaakhirnyaakan
terakumulasi.

277

Jikaakumulasisudahdianggap
mengganggujalannyaoperasi,maka
unitperengkahanthermaltersebut
harusdihentikanuntukproses
penghilanganakumulasicokes
atauSAD(SteamAirDecoking).
278

Untukmemperkirakanapakah
akumulasicokessudahberlebihandan
menggangguoperasiataubelum
biasanyadilihatdaritanda-tandasbb:

279

Penurunantekananantarainletdan
outletfurnacesampaitingkat
maksimumtertentu.
Tekanansoaker/reactionchamberyang
makintinggisampaitingkatmaksimum
tertentu.
Temperaturtubemetal(tubeskin)
makinnaik.
280

Pembersihanakumulasicokestersebut
disampingsecaraproses(SAD),dapat
jugadilakukansecaramekanis
menggunakanpompabertekanantinggi
(aquadyne/hammelmann).

281

282

283

Hydrocrackingmerupakanunitproses
kilangminyakbumiyangtermasuk
kelompoksecondaryprocessing,yaituproses
downstreamkilangminyakbumi
yangmenggunakan reaksikimiauntuk
menghasilkan produk-produ

284

Walaupunmenggunakankatalis
danprosesnya
meng-crackingumpan,namun
seringkaliHydrocrackingtidak
dikelompokkankedalam
catalyticcracking.

285

Seringkaliistilahcatalyticcrackinghanya
diperuntukkankepadaunit-unitproses
FluidCatalyticCrackingatauResidual
CatalyticCrackingatauResidualFluid
CatalyticCracking(perbedaanketiganya
terutamahanyapadajenisumpannya

286

Sedangkanhydrocracking
Dikelompokkan
terpisah,berdirisendirisebagai
Hydrocracking

287

Padabeberapatahunterakhirini,
prosesCatalyticCracking
(FCC-FluidCatalytic
Cracking/RCC-ResidualCatalitycCracki
ng/RFCC-ResidualFluidCatalytic
Cracking)

288

lebihdiminatiterutamakarena
keunggulannyayangdapatmengubah
minyakberat(gasoildanbahkan
residu)menjadi
asoline/bensin(maksimasigasoline)
sertadapatmenghasilkanumpanuntuk
kilangPetrokimia(propylene).
289

NamunprosesHydrocrackingtetap
tidakkehilanganpamordantetap
diminati
karenakeunggulannyayang
dapatmengubah
minyakberat(gasoil)menjadi
distillate(maksimasikerosenedandiesel).

290

TeoriHydrocracking
Hydrocrackingmerupakanprosesmengubah
umpanberupaminyakberatmenjadi
produk-produkminyakyanglebihringan
dengankehadiranhydrogendengan
bantuankatalisdanmenggunakan
tekanantinggi
(hingga100s/d200kg/cm2
umumnya175kg/cm2)
.
291

TeoriHydrocracking

dantemperaturmedium
(290s/d454oC).
Catalystyang
digunakanberbasissilicaalumina
dengankombinasinikel,molybdenumda
ntungsten.
292

Feedhydrocrackingyang
umumadalah
heavyatmosphericgasoil,
heavyvacuum
gasoil,catalyticallygasoil,atau
thermallycrackedgasoil.
293

Feedstockinidiubahmenjadiprodukprodukdenganberatmolekulyang
lebihringandanbiasanya
denganmemaksimalkanproduk
naphthaatau
distillates(keroseneataudiesel).

294

295

296

Prosesperengkahanpanas
(thermalcrackingprocess)
adalahsuatuproses
pemecahanrantaihydrocarbondarisenyawa
rantaipanjangmenjadihydrocarbon
denganrantaiyanglebihpendekdengan
bantuanpanas

297

Prosesperengkahan
panasbertujuanuntukmendapatkan
fraksiminyakbumidenganboilingrange
yanglebihrendahdarifeed(umpannya).
Denganmelaluiprosesinidihasilkan
gas,LPG,gasoline(naphtha),gasoil(diesel),
residueataucoke.
Feednyadapatberupagasoilatauresidue.

298

Prosesperengkahanthermal(thermal
Cracking)adalahsuatuproses
pemecahanrantaihydrocarbondari
senyawarantaipanjangmenjadi
hydrocarbondenganrantaiyanglebih
kecilmelaluibantuanpanas.
299

Suatuprosesperengkahanthermal
bertujuanuntukmendapatkanfraksi
minyakbumidenganboilingrange
yanglebihrendahdarifeed
(umpannya).
300

Dalamprosesinidihasilkan:gas,
gasoline(naphtha),gasoil(diesel),
residueataucoke.
Feednyadapatberupagasoilatau
residue.

301

Setelahmengalamipemanasanawal
danditampungdalamakumulator,
prosespemanasanselanjutnya
dilakukandalamsuatufurnace(dapur)
sampaimencapaitemperatur
rengkahnya
302

Keluardarifurnace,minyakyang
sudahpadasuhurengkahtadi
dimasukkandalamsuatusoaker,yaitu
suatualatberbentukdrumtegakyang
bergunauntukmemperpanjangreaksi
perengkahanyangterjadi
303

Selanjutnyahasilperengkahan
dimasukkankedalamsuatumenara/
kolompemisah(fractionator)dimana
berikutnyaakandipisahkanmasingmasingfraksiyangdikehendaki

304

Adajugabagianyangdikembalikan
lagiuntukdirengkahlebihlanjutyang
disebutrecyclestock.

305

SelainmenghasilkanprodukBBM
(bahanbakarminyak)dangas,dalam
prosesperengkahanthermaljuga
dihasilkancokes

306

Cokesyangdiharapkanhanya
terbentukdidalamchamber(coke
drum)dapatpulaterbentukdidinding
tubesheater/furnacedantransferline
(pipatransfer)

307

Cokestersebutterbentuksedikitdemi
sedikitdanpadaakhirnyaakan
terakumulasi.Jikaakumulasisudah
dianggapmengganggujalannyaoperasi,
makaunitperengkahanthermaltersebut
harusdihentikanuntukprosespenghilangan
akumulasicokesatauSAD
(SteamAirDecoking).
308

Untukmemperkirakanapakah
akumulasicokessudahberlebihan
danmenggangguoperasiatau
belumbiasanyadilihatdari
tanda-tandasbb:
309

Penurunantekananantarainletdan
outletfurnacesampaitingkat
maksimumtertentu.
Tekanansoaker/reactionchamber
yangmakintinggisampaitingkat
maksimumtertentu.
Temperaturtubemetal(tubeskin)
makinnaik.
310

311

312

313

VisbreakingUnitbiasanyadidisainuntukmengolah
VacuumDistillationUnit
residue(ataudapatjugauntukmengolahgasoil).
Prosesperengkahanresidueini
dimungkinkandenganpemanasanumpan
menggunakanvisbreakingunitfired
heaterdanrapidquenchingfluidakeluarfired
heater,yangmemudahkan
terjadinyaperengkahanpanasdanperubahanviscosity
untukproseslebihlanjut.

314

Produkvisbreakingunitadala
hoverheadtailgas,
naphtha,danbottom.

315

TeoriPerengkahanPanasdan
ProsesVisbreaking
Saathydrocarbondipanaskandan
didekomposisidalamkondisi
perengkahan
panas,hydrocarbondapat
diasumsikanterpecah
menjadiduaataulebihradikalbebas.

316

Radikalradikalbebastersebut
kemudian
bereaksimenghasilkantotal
produkyangmencakuprentang
beratmolekulyangbesarmulai
darihydrogen
hinggabitumendancoke

317

Terkaitdenganteoriperengkahanpan
as
reaksi-reaksinya,sebagaicontoh,
dapatdigambarkansebagaiberikut:
C10H22 C8H17* + C2H5*

318

Radikal-radikal
yangsangatreaktiftidak
keluarsebagaieffluentproduk
perengkahanpanas,tetapitergantung
ukurandanlingkungannya:
(a)bereaksidenganhydrocarbonlain,
(b)terdekomposisimenjadiolefin,
c)bergabungdenganradikal-radikallain,dan
(d)bereaksidenganpermukaanlogam
319

Secaraumum,
radikalradikalkecillebihstabil
daripadaradikal-radikalyanglebih
besar,danakanlebihsiapbereaksi
denganhydrocarbonlaindengan
menangkapsatuatomhydrogen,
ebagaicontoh:
C2H5*+C6H14 C2H6+C6H13*
320

Radikalradikalbesartidakstabildan
terdekomposisiuntukmembentuk
olefindan
radikal-radikalyanglebihkecil,
sebagaicontoh

321

C6H13*C5H10+CH3* (3)
C8H17*C4H8+C4H9* (4)
C4H9* C4H8+H*
(5)

322

Reaksi-reaksi
rantairadikalbebastersebut
berakhirsaatduaradikalbergabung,
sebgaicontoh:
C8H17*+H* C8H18 (6)
Atausaatsebuahradikalbereaksiden
gansuatulogamatauracun.
323

Reaksi-reaksi
kondensasidanpolimerisasiyang
terjadipadakondisiperengkahan
panasdapatmenjadiaromatictar,
sebagaicontoh:
xC4H8+yC4H8+zC3H6

multi-aromatic-ring (7)

324

Cokedanbitumenadalahjenis
polimerutama.
Molekul-molekultersebutbisa
menjadisangatbesar.
Kekuranganhydrogendanberat
molekulyangbesar
mengurangikelarutannyadalam
hydrocarbon.
Cokemempunyairasioatom
hydrogen-carbonsekitar2:1.
325

FeeddanProdukVisbreaking
Spesifikasiprodukvisbreakingprocessunit
harusdisesuaikandenganspesifikasi
blendingfueloildansifatkomponen
blendinglainnya.Jikaviscosityvisbroken
bottomtinggi,makafueloilblending
memerlukanlebihbanyakfueldan
temperaturekeluarfiredheateryang
lebihtinggi
326

Haltersebutakanmeningkatkan
kecenderunganterbentuknyacokingpada
tubefiredheater.
Olehkarenaitu,
spesifikasiprodukharusdisesuaikan
berdasarkanmaksimalisasikeuntungan
untukkeseluruhankilang
327

328

329

330

331

332

333

334

335

336

337

338

Catalyticreforming
(atauUOPmenyebutPlatforming)
telahmenjadibagian
pentingbagisuatukilangdiseluruh
duniaselamabertahun-tahun.

339

Fungsiutama
prosescatalyticreformingadalah
meng-upgradenaphthayangmemiliki
octanenumberrendahmenjadi
komponenblending
mogas(motorgasoline)
denganbantuankatalismelalui
serangkaianreaksikimia
340

Naphthayang
dijadikanumpancatalyticreformingharus
di-treatingterlebihdahuludiunit
naphthahydrotreateruntukmenghilangkan
impuritiessepertisulfur,nitrogen,
oksigen,halide,danmetalyangmerupaka
nracunberbahayabagikatalis
catalyticreformeryangtersusundariplatina.

341

Selainitu,
catalyticreformingjugamemproduksi
by-productberupahydrogen
yangsangatbermanfaatbagi
unithydrotreater
maupunhydrogenplantatau
jikamasihberlebihdapatjuga
digunakansebagai
fuelgasbahanbakarfiredheater.
342

Butane,
by-productlainnya,sering
digunakan
untukmengaturvapor
pressuregasolinepool.
343

Feednaphthakeunitcatalytic
reformingbiasanyamengandun
C6s/dC11,
paraffin,naphthene,danaromatic.
Tujuanprosescatalytic
Reformingadalahmemproduksi
aromatic dari naphthenedanparaffin
344

Kemudihan reaksi catalytic


Reformingsangatditentukanoleh
kandunganparaffin,naphthene,
danaromaticyangterkadungdalam
naphthaumpan.
Aromatichydrocarbonyang
terkandungdalam
naphthatidakberubaholeh
prosescatalyticreforming.
345

Sebagian
besarnapthenebereaksisangat
cepatdanefisienberubahmenjadi
senyawaaromatic
(reaksiinimerupakanreaksi
dasarcatalyticreforming).
346

Paraffinmerupakansenyawa
palingsusahuntukdiubah
menjadiaromatic.

347

Untukaplikasilowseverity,
hanyasebagiankecil
paraffinberubahmenjadiaromatic.
Sedangkanpadaaplikasihigh
severity,konversiparaffinlebihtinggi,
tetapitetapsajaberlangsung
lambatdaninefisien.
348

Reaksi-reaksi
yangterjadidicatalytic
reformingadalahsebagai
berikut
349