Anda di halaman 1dari 11

ASUHAN KEPERAWATAN

PADA PASIEN NY. N DENGAN DIAGNOSA MEDIS ANEMIA,


GEA DEHIDRASI RINGAN
DI RUANG EDELWEIS RSUD KULON PROGO
Disusun untuk Memenuhi
Tugas Praktik Laboratorium Klinik Kebutuhan Dasar Manusia II

Disusun oleh:

1. Annisa Rahmatiah
2. Dodik Firmansah
3. Meilina Murdiani

P07120112046
P07120112053
P07120112065

KEMENTERIAN KESEHATAN REPUBLIK INDONESIA


POLITEKNIK KESEHATAN YOGYAKARTA
JURUSAN KEPERAWATAN
2013

BAB I

DASAR TERORI
A. PENGERTIAN
Gastroenteritis adalah peradangan akut lapisan lambung dan usus ditandai dengan
anoreksia, rasa mual, nyeri abdomen, dan diare. (Kamus Besar Dorland Hartanto,
2002)
Gastroenteritis adalah radang lambung dan usus yang memberikan gejala diare
atau tanpa disertai muntah (muntah berak). (Kapita Selekta Kedokteran Edisi 2)
Gastroenteritis didefinisikan sebagai inflamasi membrane mukosa lambung dan
usus halus yang ditandai dengan muntah dan diare yang berakibat kehilangan
cairan dan elektrolit yang menimbulkan dehidrasi dan gangguan keseimbangan
cairan dan elektrolit. (Cecilya L. Bets, 2002)
B. ETIOLOGI
1. Faktor infeksi
a. Infeksi bakteri : Vibrio, E. Coli, Salmonella, Shigelia
Compylobacter, Yersina, Aeromonas, dan sebagainya.
b. Infeksi virus : Eterovirus (virus ECHO, Coxsackie Poliofelitis),
Adenovirus, Rotavirus, Astrovirus, dan lain-lain.
c. Infeksi parasit : cacing (Ascaris, Triguris, Oxyyuris, Strongyloides),
protozoa (Entamoeba Hstolitica, Glardialambia, Trichomonas
Hominis).
2. Faktor malabsorbsi
Malabsorbsi karbohidrat, lemak, atau protein.
3. Faktor makanan
Makanan basi, beracun, dan alergi terhadap makanan.
4. Factor psikologis
Rasa takut dan cemas.
5. Imunodefisiensi
Dapat mengakibatkan terjadinya pertumbuhan bakteri.
6. Infeksi terhadap organ lain, seperti radang tonsil, bronchitis, dan radang
tenggorokan.
C. PATOFISIOLOGI
Mekanisme dasar yang menyebabkan timbulnya Gastroenteritis :
1. Dehidrasi
Disebabkan karena makanan terkontaminasi dengan mikroorganisme dan
ikut masuk ke dalam saluran pencernaan sehingga menyebabkan iritasi
pada mukosa lambung sehingga makanan tidak dapat diabsorbsi dan keluar
melalui kolon yang berbentuk cair.
2. Gangguan keseimbangan asam-basa
Hal ini terjadi karena :
a. kehilangan Na-bikarbonat bersama tinja
b. adanya ketosis kelaparan
c. terjadinya penimbunan asam laktat karena adanya anoksia jaringan
d. produk metabolisme yang bersifat asam meningkat karena tidak
dapat dikeluarkan oleh ginjal
e. pemindahan ion Na dari cairan ekstra seluler ke dalam cairan intra
seluler
3. Hipoglikemia
Adalah kekurangan glikogen dalam tubuh yang disebabkan oleh kerusakan

sel-sel dan penurunan konsentrasi glukosa serum, insulin, dan hormon


pertumbuhan. Gejalanya antara lain : lemas, apatis, peka rangsang, tremor,
berkeringat, pucat, syok, dan kejang sampai lama.
4. Gangguan gizi
Disebabkan karena :
a. makanan sering dihentikan oleh orang tua karena takut diare atau
muntah yang bertambah berat
b. walaupun susu diteruskan sering diberikan dengan pengenceran dan
susu encer diberikan terlalu lama
c. makanan yang diberikan tidak dapat dicerna dan diabsorbsi dengan
baik karena hiperperistaltik
5. Gangguan sirkulasi
Gangguan sirkulasi darah berupa syok hipovilemik akibat perfusi jaringan
berkurang dan terjadi hipoksia, asidisis bertambah berat dan
mengakibatkan perdarahan dalam otak.
D. MANIFESTASI KLINIS
Gejala awal :
1. Anak menjadi cengeng
2. Gelisah
3. Suhu badan meningkat
4. Nafsu makan menurun atau tidak ada
5. Tinja cair (mungkin mengandung darah atau lendir)
6. Warna tinja berubah menjadi kehijau-hijauan karena tercampur empedu
Gejala lain :
1. Muntah (dapat terjadi sebelum atau sesudah diare)
2. Gejala dehidrasi
3. Berat badan menurun
4. Ubun-ubun cekung (pada bayi)
5. Tonus dan turgor kulit berkurang
6. Selaput lendir dan bibir kering
E. PEMERIKSAAN PENUNJANG
1. Laboratorium
a. Pemeriksaan tinja
Pemeriksaan tinja, baik makroskopik maupun mikroskopikharus
dilakukan untuk menentukan diagnosa yang pasti. Pemeriksaan
secara makroskopik harus diperhatikan bentuk, warna tinja, ada
tidaknya darah, lendir, pus, lemak, dan lain-lain.
Pada pemeriksaan mikroskopik harus diperhatikan telur cacing,
parasit, dan bakteri.
b. Pemeriksaan darah
Homogram lengkap, meliputi : Hb, eritrosi, leukosit, dan
hematokrit untuk membantu menemukan derajat dehidrasi dan
infeksi.
Pemeriksaan pH dan keseimbangan asam basa.
Pemeriksaan AGD dan elektrolit, yaitu Na, K, Cl, dan Mg.
Pemeriksaan urine
Ditetapkan volme, berat jenis, pH, dan elektrolitnya.

2. Endoskopi
Pemeriksaan endoskopi sebaiknya dilakukan sebagai pekerjaan rutin pada
setiap penderia diare. Lebih-lebih lagi setelaah ditemukan colon
fibrescope maka akan mempermudah dalam pembuatan diagnosa.
3. Radiologi
Penderita sering mengalami diare yang hilang timbul, misalnya colitis
ulseratif dan regional enteritis. Untuk menegakkan diagnosa perlu
dilakukan pemeriksaan radiology.

BAB II
TINJAUAN KASUS
A. PENGKAJIAN
TanggalPengkajian
Oleh
Metode

:
:
:

Sumber

1. Identitas pasien
a. Identitas pasien
Nama
Umur

11Juni 2013
Kelompok 7
Observasi, wawancara,
pemeriksaanfisikdanstudidokumen
Klien, keluargapasien, buku status pasiendan team
kesehatan

: Ny. N
: 80 th

Jeis kelamin
: perempuan
Agama
: Islam
Status
: Janda
Pendidikan
: tidak sekolah
Pekerjaan
: IRT
Suku
: Jawa
Alamat
: Karang Patihan,Demangrejo, Sentolo
Diagnosa Medis
: anemia, GEA dehidrasi ringan
No. RM
: 568498
Tanggal masuk RS
: 8 Juni 2013
b. Identitas penanggung jawab
Nama
: Tn. A
Umur
: 60 tahun
Pekerjaan
: Driver
Alamat
: Depok,Sleman
Hubungan dengan pasien : Menantu
2. Riwayat kesehatan
a. Keluhan Utama
Klien masuk rumah sakit karena mengalami BAB cair 5x/hari sejak 2 hari sebelum
masuk rumah sakit
b. Keluhan tambahan
Makan /minum klien sedikit, perut terasa nyeri, mual, badan terasa lemas
c. Riwayat penyakit sekarang
Dx. medis
Anemia, GEA dehidrasi ringan
d. Riwayat penyakit dahulu
Tidak ada
e. Riwayat penyakit keluarga
Keluargapasienmenyatakanbahwadarikeluarganyatidakada yang
mempunyairiwayatpenyakitsampaisepertiini, biasanyakalausakitsepertiiniBAB
hanya2-3x/hari dan setelah 1 hari bisa sembuh sendiri
3. Pengkajian saat ini
a. Pola nutrisi
1. Sebelum sakit
a) Makan
: nafsu makansedang, makan 3x/hari, habis 1 porsi
b) Minum
: 6-7 gelas sehari (teh dan air putih)
2. Selama sakit
a) Makan
: nafsu makan kurang, makan3x/hari dari diit BB
tim di RShabis porsi
b) Minum
:4-6 gelas ukuran 200cc,infus RL 20 Tpm
b. Pola eliminasi
1. Sebelum sakit
a) BAB
: lunak, 1x/ hari
b) BAK
: 5x/ hari
2. Selama sakit
a) BAB
: saat masuk RS : cair, 5x/ hari
saat pengkajian : masih sedikit cair , 2-3x/ hari

b) BAK

: > 10x/hari

c. Pola aktivitas dan latihan


1. Sebelum sakit
Kemampuan perawatan diri
Makan dan minum
Mandi
Toleting
Berpakaian
Mobilitas di tempat tidur
Berpindah
Ambulasi/ ROM

2. Selama sakit
Kemampuan perawatan diri
Makan dan minum
Mandi
Toleting
Berpakaian
Mobilitas di tempat tidur
Berpindah
Ambulasi/ ROM

Keterangan :
1
: Mandiri
2
: Dibantu alat
3
: Dibantu orang lain
4
: Dibantu orang lain dan alat
5
: Tergantung total
d. Pola tidur dan istirahat
1. Sebelum sakit
pasien tidur selama 7jam/ hari
2. Selama sakit
pasien tidur selama 5jam/ hari dan sering terbangun
e. Pola perseptual
1. Sebelum sakit
a) Pendengaran pasien berkurang karena sudah tua
b) Penglihatan pasien sudah agak kabur
c) Pengecapan pasien masih baik
d) Sensasi pasien masih baik
2. Selama sakit
a) Pendengaran sudah berkurang karena sudah tua
b) Penglihatan pasien sudah kabur
c) Pengecapan pasien kurang baik karena lidah tesara pahit
d) Sensasi pasien masih baik

f. Pola persepsi diri


1. Sebelum sakit
Tidak ada kecemasan
2. Selama sakit
Klien terlihat lemah dan pucat,kecemasan hanya terlihat ketika akan dilakukan
asuhan keperawatan klien terlihat takut dan gelisah
g. Pola seksual dan reproduksi
1. Sebelum sakit
pasien sudah menopouse
2. Selama sakit
pasientidak memiliki gairah seks
h. Pola peran hubungan
1. Komunikasi
Dalam berkomunikasi pasien berkomunikasi baik dengan keluarga
2. Hubungan dengan orang lain
Pasien bersosialisasi baik dengan lingkungan dan keluarga terbukti banyak
saudara ataupundan kerabat yang menjenguknya
3. Kemampuan keuangan
Keluarga pasien dapat digolongkan dalam kelompok sosial kelas menengah
i. Pola manajemen koping dan stres
1. Sebelum sakit
Keluarga pasien mengatakan pasien senang jalan-jalan disekitar rumah
2. Selama sakit
Pasien terlihat jenuh karena ruang gerak pasien terbatas
j. Sistem nilai keyakinan
1. Sebelum sakit
Pasien mengatakan beragama islam dan rajin beribadah
2. Selama sakit
Pasien tidak melaksanakan ibadah sholat karena penyakitnya,tapi pasien tetap
berdoa untuk kesembuhannya.
4. Pemeriksaan fisik tanggal 11 juni 2013
a. Pemeriksaan umum
1) Keadaan umum
: sedang
2) Kesadaran
: composmentis
3) Tanda-tanda vital
a) TD
: 120/80 mmHg
b) N
: 82 x/menit
c) S
: 36,5 C
d) R
: 23 x/menit
b. Pemeriksaan Head to toe
1) Kepala
: meesochepal
2) Rambut
: bersih,beruban dan potongan pendek
3) Mata
: reflek terhadap cahaya baik,konjungtiva pucat
4) Hidung
: simetris, tidak ada polip,sekresi ada
5) Telinga
: simetris, tidak ada serumen
6) Mulut dan gigi: bersih,kemampuan bicara kurang jelas karena sudah tua
7) Leher
: tidak ada pembesaran kelenjar, peningkatan JVP

8) Torak
Inspeksi
: bentuk dada simetris,bergerak dengan mudah saat respirasi
Palpasi
: tidak ada nyeri tekan
Perkusi
: perkusi diatas permukaan paru dalam keadaan normal
Auskultasi
: paru-paru dalam keadaan normal
9) Abdomen
Inspeksi
: tidak ada lesi,simetris
Palpasi
: nyeri tekan
Perkusi
: kembung
Auskultasi
: terdapat bising usus
10) Genetalia
: berjenis kelamin perempuan,dan terpasang DC
11) Kulit
: pucat,turgor jelek
12) Ekstermitas
a. Atas
: kekuatan otot lemah,tangan kanan terpasang infuse RL 20 Tpm
b. Bawah :tidak ada edema
5. Pemeriksaan penunjang
Hasil pemeriksaan laboratorium pada tanggal 11 juni 2013
Pemeriksaan
Hematologi
Hemoglobin
Hematokrit
Leukosit
Trombosit
Eritrosit

Hasil

Nilai rujukan

Satuan

Metoda

5.5
19.4
5.6
214
3.1

12.00-16.00
37.00-47.00
4.0-10.5
150-450
3.90-5.50

g/dL
vol %
ribu/ul
ribu/ul
juta/ul

Colorimetric
Analyzer calculates
Impedance
Impedance
Impedance

86.5
9.6
1.9
1.0
1.0

50.0-65.0
25.0-40.0
3.0-9.0
1.0-3.0
0.0-1.0

%
%
%
%
%

Impedance

Kimia klinik
Glukosa Darah
Sewaktu

65

< 200

mg/dL

GOD - PAP

Fungsi hati
SGOT
GGPT

12
10

0-46
0-45

U/l
U/l

Kimia klinik
Ureum
Kreatinin

40
1.3

10-50
0.6-1.2

mg/dL
mg/dL

Modif Brhelot
Jaffe

136.9
3.62
103.5

135-146
3.4-5.4
95-100

mmol/L
mmol/L
mmol/L

ISE
ISE

Hitung jenis
Neutrofil %
Limfosit %
Monosit %
Eosinofil %
Basofil %

Elektrolit
Natrium
Kalium
Chlorida

IFCC
IFCC

Calsium

1.95

1.5-2.4

mmol/L

ISE
Spektro

B. Analisa data
No
1

Data
DS : pasien mengatakan badannya
lemas, nyeri di perut dan mual
DO :
1. Pasien terlihat lemas
2. BAB cair, 5x/ hari, lendir (-),
darah (-)
3. Tdk muntah
4. Thorak
a. Cardio : S1-S2 reguler
b. Pulmo : respirasi
(normal)
c. Abdomen : supel, bising
usus ada
d. Akral : hangat, tidak ada
edema
5. BAK lancar, bening
6. TTV
T : 120/180 mmHg
N : 80 x/menit
S : 36C
7. Turgor kulit jelek
8. Konjungtiva pucat

Masalah
Kekurangan volume
cairan

Penyebab
Kehilangan
cairan aktif

C. Diagnosa keperawatan
Kekurangan volume cairan berhubungan dengan kehilangan cairan aktif ditandai
dengan BAB 5x/ hari dengan konsistensi cair, turgor kulit jelek dan pasien terlihat
lemas.

D. Perencanaan
Diagnosa
Kekurangan
volume cairan
berhubungan
dengan
kehilangan
cairan aktif
ditandai dengan
BAB 5x/ hari
dengan
konsistensi cair,
turgor kulit jelek
dan pasien
terlihat lemas.

Tujuan
Setelah dilakukan
tindakan
keperawatan 4x24
jam diharapkan
volume cairan
pasien dapat
terpenuhi dengan
kriteria hasil:
1. Tanda vital
dalam batas
normal (TT:
120/80, N: 60100 x/mnt, S;
36-37,50 c,
RR : < 40
x/mnt )
2. tidak
ditemukan
tanda dehidrasi,
hidrasi adekuat
3. keseimbangan
intake dan
output
4. tidak terjadi
penurunan BB
10%
5. tidak ada
dahaga yang
abnormal
6. Turgor elastik ,
membran
mukosa bibir
basah,
konjungtiva
tidak anemis.
7. Konsistensi
BAB lembek,

Tindakan
1. tingkatkan intake
cairan sesuai BB
2. monitor tandatanda vital
3. monitor intake
dan output
4. monitor BB
setiap 2hr/sesuai
indikasi
5. monitor adanya
tanda-tanda
dehidrasi dan
status hidrasi
6. monitor respon
klien selama
terapi elektrolit
7. beri penkes klien
untuk ikut aktif
meningkatkan
intake cairan
8. kolaborasi
dengan dokter
untuk pemberian
obat
infus RL
20Tpm
radin
ketorolac
cefotaxime
cloxacillin

Rasional
1. mengembalikan
keseimbangan cairan
dan elektrolit
2. hipovolemia dapat
dimanifestasikan oleh
hipotensi dan takikardi
3. dehidrasi dapat
meningkatkan laju
filtrasi glomelurus
menyebabkan keluaran
tidak adekuat untuk
membersihkan sisa
metabolisme
4. mendeteksi kehilangan
cairan, penurunan 1kg
BB sama dengan
kehilangan 1 liter
5. penurunan sirkulasi
volume cairan
menyebabkan
kekeringan mukosa dan
pemekatan urine, deteksi
dini memungkinkan
terapi cairan segera
untuk memperbaiki
defisit
6. dapat mengganti
program atau rencana
apabila terapi tidak
memberikan
peningkatan keadaan
yang baik
7. peran aktif klien sangat
efektif untuk
mengembalikan
keseimbangan cairan
dan elektrolit

frekuensi 1
kali/ hari

8. mengganti cairan dan


elektrolit secara adekuat
dan cepat