Anda di halaman 1dari 6

PILIHLAHSATUJAWABANYANGBENAR(60%)

( C ) Berikutinimerupakansistempenghantaransignalinterselulermelaluikontak
fisik,kecuali...
A.Juxtacrinesignaling
B.Occludingjunction
C.Synapticsignaling
D.Desmosome
E.Gapjunction
(B)Pernyataanyangbenarmengenaipenghantaransignalolehinsulinadalah..
A.Termasukdalamkelompokparacrinesignaling
B. Berikatan dengan reseptor insulin yang termasuk dalam kelas
enzymelinkedreceptor
C.Dikeluarkandandigunakanolehselyangsama
D.AktivasireseptorinsulinakanmenghasilkanpembukaansaluranionCa2+
E.Reseptorterletakdidalamsitosol
(E)Firstmessengerberikutdilepaskanolehselsyaraf,kecuali
A.Dopamin
B.Gamaaminobutyricacid(GABA)
C.Serotonin
D.Tiroid
E.Asetilkolin
( B )Yangmerupakansecondmessengeruntukreseptoryangberkaitansaluranion
(ionchannellinkedreceptor)adalah.
A.Enzimtirosinkinase
B.Ionkalsium
C.Hormonestrogen
D.EnzimSerin/treoninkinase
E.ProteinG

(A)Pernyataanberikutinibenarmengenaiintracellularsignaling,kecuali
A.Transduction akan merubah informasi yang berasal dari first
messengermenjadielectricalsignal(Seharusnyasecondmessenger)
B.Integrator akanmenggabungkanbeberapasignalmenjadisebuahsignal
yangfungsional
C.Amplificationakanmerubahintensitasinformasiyangkecilmenjadisignal
yanglebihbesar
D.Modulationakanmenurunkanresponselulerterhadapinformasidarifirst
messenger
E.Relay merupakanaktivasiproteinproteinyangterlibatdalam signaling
pathway
( A ) First messenger yang mempunyai target reseptor pada intracellular site
adalah..
A.Steroid
B.Dopamin
C.Serotonin
D.Insulin
E.Glutamat
()AktivasiGproteincoupledreceptorakanmengakibatkanhalhalberikut,kecuali
.
A.G(betagama)akanmengaktivasiadenilatsiklase
B.G(alpha)akanmengaktivasipembukaansaluranion
C.AktivasiproteinkinaseAdanC
D.PenurunankadarcAMP
E.Peningkatanpemasukanionkalsium
( A ) Stimulasireseptorolehagonisakanmenghasilkanperubahandarichemical
signalmenjadielectricalsignaldisebut..
A.Transduksi

B.Relay
C.Translasi
D.Transkripsi
E.Amplifikasi
(E)Pernyataanberikutyangbenarmengenaisecondmessengeradalah..
A.Terdapatpadaekstradanintraseluler
B.Dapatberupaproteinkecilatauenzim
C.Hanyaaktifdalambentukion
D.Dapatberupaagonisyangbersifateksogen
E. Aktivasinya hanya tergantung pada interaksi antara ligan dan
reseptor
( E ) Perubahan penghantaran signal akibat adanya pemaparan agonis
dapatmenyebabkanterjadinyaperubahan,kecuali...
A.Metabolisme
B.Genetik
C.Signaling
D.Respon
E.Stimulus
PETUNJUK: Pilihlah jawaban yang benar dan tuliskan jawaban pada tanda ( )
disebelahkirimasingmasingsoaldenganmemperhatikanpetunjuk:
A.Jikapernyataan1,2dan3benar
B.Jikapernyataan1dan3benar
C.Jikapernyataan2dan4benar
D.Jikapernyataan4sajayangbenar
E.Jikasemuapernyataanbenar
(A)Komponenproteinyangdapatmembentuksystemkomunikasimelaluikontak
fisikadalah.
1.Actinfilamentsebagaianchorprotein

2.Cadherindimersebagaiextracellularprotein
3.Keratinsebagaitransmembranprotein
4.Albuminsebagaiintracellularmatrix
(E)Sistempenghantaransignalmelaluipelepasanmediatorkimiawidapatberupa
1.Endokrin
2.Parakrin
3.Autokrin
4.Sinaptiksignaling
( B)Penyakityangdapatditimbulkanolehperubahanaktivitaspenghantaransignal
adalah..
1.Diabetesmellitus
2.Inflammatorypain
3.Cancer
4.Infectiondesease
(C)Yangbenartentangpenghantaransignalintraselularadalah.
1.Semua secondmessenger akanmengalamiaktivasidenganmekanisme
molecularswitch
2.Penghantaransignaldapatmelaluiendokrin,parakrinatauautokrin
3. Hanya Gprotein coupled receptor yang dapat mentransduksi signal
kimiawiyangdapatditransduksimen
4. Firstmessenger yangberupachemicalsignalakandirubahmenjadi
electricalsignal
()PernyataanyangbenartentangGproteincoupledreceptoradalah.
1.ProteinGinaktifdalambentuktrimerik
2.Aktivasiterusmenerustidakmenimbulkandesensitisasi
3.Reseptorfungsionalhanyaterdapatdimembransel
4.Aktivasireseptorinitidakberkaitandenganaktivitasionchannel

PETUNJUK: Pilihlah jawaban yang benar dan tuliskan jawaban pada tanda ( )
disebelahkirimasingmasingsoaldenganmemperhatikanpetunjuk:
A.Jikapernyataanbenar,alasanbenardanadahubungan
B.Jikapernyataanbenar,alasanbenardantidakadahubungan
C.Jikapernyataanbenar,alasansalah
D.Jikapernyataansalah,alasanbenar
E.Jikapernyataansalah,alasansalah
(A)Cellcommunicationmerupakansistempenghantaransignaldarisatuselkesel
yanglain(V)
SEBAB
Cell communication berfungsi untuk menyampaikan informasi agar
organismemampumempertahankanhidup(V)=A
( E )Selselyangberdekatanharusmempunyaikontakfisikuntukdapatmelakukan
penyampaiansignalatauinformasi(X)
SEBAB
Kontakfisikdapatberupaparakrin,endokrindanautocrinsignaling(X)=E
( C )Aktivasireseptorolehligandakanmenyebabkanaktivasiserangkaianprotein
yangterlibatdalamsignalingpathwaydenganmekanismemolecularswitch
(V)
SEBAB
Protein dalam signaling pathway hanya akan mengalami fosforilasi jika
mendapatkansignal(X)=C
(C)Ikatansteroiddenganreseptorakanmengaktifkanfaktortranskripsiyangdapat
berfungsisebagaiaktivatordaninhibitordalammetabolisme.(V)
SEBAB
Steroidreseptormerupakanreseptoryangberkaitandenganenzim.(X)=C
(C)ReseptorNMDAmerupakanreseptoryangtermasukdalamionchannellinked

receptor(V)
SEBAB
AktivasireseptorNMDAakanmenghasilkanperubahandarisignalkimiawi
menjadisignallistrik(X)