Anda di halaman 1dari 228

http://nonamenino.blogspot.com/2012/03/asuhan-keperawatan-pada-lansia-dengan.

html
MAR

31

ASUHAN KEPERAWATAN PADA LANSIA DENGAN GANGGUAN


PEMENUHAN KEBUTUHAN NUTRISI (kelompok 1)

KEPERAWATAN GERONTIK
ASUHAN KEPERAWATAN PADA LANSIA DENGAN
GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI

DI SUSUN OLEH :
BAMBANG SURYADINOR
NITA RAHMADANI
NOVA ZAHROTUL HAYYA
SUMIRLAN TRISNO
AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTAWARINGIN TIMUR
Jl. Batu Berlian No.11 Sampit

2012
KATA PENGANTAR
Puji syukur kepada Tuhan Yang Maha Esa karena berkat taufik dan
hidayah-Nya, makalah ini dapat diselesaikan. Makalah ini merupakan makalah
pengetahuan bagi mahasiswa/i akper pemkab kotim maupun para pembaca
untuk bidang Ilmu Pengetahuan.
Makalah ini sendiri dibuat guna memenuhi salah satu tugas
kuliah dari dosen mata kuliah Keperawtan Gerontik dengan judul ASUHAN
KEPERAWATAN PADA LANSIA DENGAN GANGGUAN PEMENUHAN
KEBUTUHAN NUTRISI.
Dalam penulisan makalah ini, penulis berusaha menyajikan bahasa yang
sederhana dan mudah dimengerti oleh para pembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih
banyak kekurangan. Oleh karenanya, penulis menerima kritik dan saran yang
positif dan membangun dari rekan-rekan pembaca untuk penyempurnaan
makalah ini. Penulis juga mengucapkan banyak terima kasih kepada rekan-rekan
yang telah membantu dalam penyelesaian makalah ini.
Akhir kata, semoga makalah ini dapat memberikan manfaat kepada
kita semua. Amin.

Sampit,

Maret 2012

Penulis

DAFTAR ISI
KATA
PENGANTAR .....................................................................................................
DAFTAR
ISI ....................................................................................................................
BAB I
PENDAHULUAN
1.1. LATAR
BELAKANG ............................................................................
1

ii
iii

1.2 TUJUAN
PENULISAN ........................................................................
2
1.3
RUMUSAN MASALAH.......................................................................
2
1.4
METODE
PENULISAN.........................................................................
2
1.5
SISTEMATIKA
PENULISAN................................................................
2
BAB II
PEMBAHASAN
2.1. PENGERTIAN........................................................................................
3
2.2 PROSES MENUA...................................................................................
4
2.3 KEBUTUHAN NUTRISI PADA LANSIA...........................................
7
2.4. FAKTOR YANG MEMPENGARUHI KEBUTUHAN GIZI PADA LANSIA
8
2.5. GANGGUAN NUTRISI PADA LANSIA............................................
9
2.6. STATUS GIZI PADA LANSIA............................................................. 11
2.7. ASKEP.................................................................................................... 12
BAB III
PENUTUP
A. KESIMPULAN ....................................................................................... 13
B. SARAN ................................................................................................... 13
DAFTAR PUSTAKA
LAPORAN KASUS

BAB I
PENDAHULUAN
1.1.

Latar Belakang
Manusia Lanjut Usia (MANULA) dimasukkan ke dalam kelompok rentan gizi,
meskipun tidak ada hubungannya dengan pertumbuhan badan , bahkan sebaliknya
sudah terjadi involusi dan degenerasi jaringan dan sel-selnya. Timbulnya kerentanan
terhadap kondisi gizi disebabkan kondisi fisik, baik anatomis maupun fungsionalnya.
Gigi-geligi pada MANULA mungkin sudah banyak yang rusak bahkan copot,
sehingga memberikan kesulitan dalam mengunyah makanan. Maka makanan harus
diolah sehingga makanan tidak perlu digigit atau dikunyah keras-keras. Makanan
yang dipotong kecil-kecil, lunak dan mudah ditelan akan sangat membantu para
MANULA dalam mengkonsumsi makanannya.
Fungsi alat pencernaan dan kelenjar-kelenjarnya juga sudah menurun, sehingga
makanan harus yang mudah dicerna dan tidak memberatkan fungsi kelenjar
pencernaan.makanan yang tidak banyak mengandung lemak, pada umumnya lebih
mudah dicerna, tetapi harus cukup mengandung protein dan karbohidrat. Kadar

serat yang tidak dicerna jangan terlalu banyak, tetapi harus cukup tersedia untuk
melancarkan peristalsis dan dengan demikian melancarkan pula defaecatie, dan
menghindarkan obstipasi.
Patut diingat bahwa keperluan enersi MANULA sudah menurun, jadi jangan di
sediakan seperti masih belum berusia lanjut. Ada baiknya bila mereka dijaga jangan
sampai menjadi kegemukan karena akan lebih mudah menderita berbagai kelainan
atau penyakit gizi yang berhubungan dengan kondisi obesitas. Frekuensi penyakit
Diabetes Mellitus, Cardiovascular diseases terdapat meningkat pada kelompok
MANULA. Yang umum sangat ditakuti ialah kemungkinan meningkat untuk mendapat
penyakit kanker.

1.2.

Tujuan
Setelah membaca makalah ini di harapkan mahasiswa mampu melakukan
Asuhan Keperawatan Dengan Gangguan Nutrisi Pada Lansia

1.3.

Rumusan Masalah

1.
2.

Apa pengertian nutrisi


Apa saja kebutuhan nutrisi pada lansia

3.
4.

Faktor apa saja yang mempengaruhi kebutuhan nutrisi pada lansia


Apa saja gangguan nutrisi pada lansia

5.

Factor apa saja yang mempengaruhi status gizi pada lansia

1.4.

Metode Penelitian
Metode

yang

di

gunakan

dalam

penulisan

makalah

ini

adalah

metode

kepustakaan.

1.5.

Sistematika Penulisan
Sistematika penulisan makalah ini yaitu Halaman Judul, Kata Pengantar, Daftar
Isi, Bab I Pendahuluan yang terdiri dari Latar Belakang, Rumusan Masalah, Tujuan
Penulisan, Metode Penulisan, dan Sistematika Penulisan, Bab II Pembahasan, Bab III
Penutup yang terdiri dari Kesimpulan dan Saran, Daftar Pustaka.

2.7

ASKEP

a.PENGKAJIAN
o Berat badan berhubungan dengan tinggi badan, contoh IMT (indeks massa tubuh)
atau catatan yang tepat
o Perubahan berat badanDifokuskan pada kehilangan atau pertambahan berat badan
saat ini
o Pertumbuhan gigi, Apakah lansia memakai gigi palsu atau apakah mereka memerlukan
gigipalsu? Apakah gigi palsu yang ada hilang atau rusak?
o Kebiasaan makan, Aspek pribadi, budaya, dan agama mengenal asupan nutrisi
o Kemampuan untuk makan, Dapatkah lansia memindahkan makanan dari piring ke
mult dan menelannya dengan baik

o Farmakologi, Apakah klien banyak meminum obat-obatan (termasuk medikasi yang


dilakukan sendiri) yang dapat berakibat buruk terhadap nutrisi.

BAB III
PENUTUP
3.1

KESIMPULAN
Lansia mengalami persoalan khusus tentang nutrisi. Mereka beresiko tinggi
menderita malnutrisi dan lebih rentan terkena dampak malnutrisi. Salah satu
indikator yang sangat penting pada status nutrisi adalah berat badan. Perawat
berperan sangat penting dalam pemenuhan nutrisi lansia terutama di Rumah Sakit.
Setiap orang harus makan. Makanan merupakan bagian yang paling pentingdalam
kehidupan sebagian lansia dan saat-saat bersantap menjadi bagian pentingyang
dialami manula setiap harinya. Makanan juga harus menjadi sumber kesehatan serta
kegembiraan bagi orang-orang yang berusia lanjut ini.

3.2

SARAN

Patut diingat bahwa keperluan enersi MANULA sudah menurun, jadi jangan di
sediakan seperti masih belum berusia lanjut. Ada baiknya bila mereka dijaga jangan
sampai menjadi kegemukan karena akan lebih mudah menderita berbagai kelainan
atau penyakit gizi yang berhubungan dengan kondisi obesitas. Frekuensi penyakit
Diabetes Mellitus, Cardiovascular diseases terdapat meningkat pada kelompok
MANULA.

DAFTAR PUSTAKA

Watson, Roger. 2003. Perawatan Pada Lansia. Jakarta : EGC


Nugroho, Wahyudi. 2000. Keperawatan Gerontik. Jakarta : EGC
Fakultas Kedokteran UI. 2000. Pedoman Pengelolan Kesehatan Pasien
Geriatri Untuk Dokter dan Perawat. Jakarta
Beck, Mary E. 2000. Ilmu Gizi dan Diet Hubungannya dengan Penyakitpenyakit untuk Perawat dan Dokter. Jakarta : Yayasan Essentia Medico
Tarwoto, Wartonah. 2003. Kebutuhan Dasar Manusia dan Proses
Keperawatan. Jakarta : Salemba Medika
Panduan Diagnosa Keperawatan NANDA 2005-2006. Prima Medika

FORMAT PENGKAJIAN INDIVIDU


ASUHAN KEPERAWATAN GERONTIK
Tanggal Pengkajian : 25 Maret 2012
A. DATA BIOGRAFI
Nama

:Tn S

TTL
Jenis Kelamin

:Sampit, 20 Oktober 1945


:laki-laki

Pendidikan
Agama

: SMA

Status Perkawinan
TB / BB

:Duda
: 162 cm, 50 Kg

Penampilan
Alamat

:Rapih danbersih
Ciri ciri tubuh :Kurus
: Jl. Merdeka, Kel. Ketapang
RT 3 RW V

: Islam

Kec.Mentawa Baru Hilir


Kabupaten. Kotawaringin Timur
Orang Yang Dekat
Hubungan
Alamat / Telepon

Telp/ Hp : -

:Ny E
:Anak
: Jl. Merdeka No.45

B. RIWAYAT KEPERAWATAN
1. Genogram

Keterangan

: Laki-laki
: Perempuan
: Meninggal dunia
: Tinggal serumah
: Garis pernikahan
: Garis keturunan
: Klien

2.

RiwayatKeluarga
Klien seorang duda, mempunyai anak satu. Klien hidup bersama anak laki-lakinya. Di
keluarga klien tidak ada yang menderita penyakit seperti diabetes, hipertensi, asma,
TB, atau hepatitis.

C. RIWAYAT PEKERJAAN
Pekerjaan saat ini
Alamat pekerjaan

: Berkebun
: Jl. MajuMundur

Jarak dari rumah


Alat transportasi

: 1km
: Jalan kaki

Pekerjaan sebelumnya
Jarak darirumah

: Swasta
: 3 Km

Alat transportasi
: Sepeda Motor
Sumber-sumber Pendapatan & Kecukupan Terhadap Kebutuhan:
Pendapatan berasal dari hasil berkebun dan dibiayai oleh anak.
D. RIWAYAT LINGKUNGAN HIDUP
Type tempa tinggal
:Rumah
Jenis lantai rumah
Kondisi lantai

:Kayu
:Kering

Tangga rumah
Penerangan

:Tidakada
:Cukup

Tempat tidur
Alatd apur

:Aman
:Rapi

WC
Kebersihan lingkungan

:Aman
:bersih

Jumlah orang yang tinggal dalam satu rumah :Sendiri


Derajat privasi
:Terjaga
Tetangga terdekat
Alamat dan telepon

: Ada
: Jl. Merdeka No. 46

E.

RIWAYAT REKREASI
Hobbi / Minat
KeanggotaanOrganisasi
Liburan / Perjalanan

F.

: Memancing
: Pengajian
: Jalan jalan, berkunjung ketempat Anak

SISTEM PENDUKUNG
Perawat / Bidan / Dokter / Fisioterapi
Jarak Dari Rumah

: Perawat
: 1 Km

RumahSakit
Klinik

: Ada Jarak 5 Km
: Ada Jarak 4 Km

Pelayanan Kes. Dirumah


Makanan Yang dihantarkan

: Tidakada
: Tidakada

Perawatan Sehari-hari Yang Dilakukan Keluarga : Check Up kePuskesmas


G. DISKRIPSI KEKHUSUSAN
Kebiasaan Ritual
: klien shalat 5 waktu, klien kadang menjalankan shalat
tahajud.
Yang Lainnya

: Tidakada

H. STATUS KESEHATAN
Status Kesehatan Umum Selama SetahunYangLalu
Anemia
Status KesehatanSelama 5 Tahun Yang Lalu
KeluhanUtama

: klien pernah menderita


: Tidak ada masalah

Klien mengatakan tidak nafsu makan


Pemahaman & Penatalaksanaan Masalah Kesehatan
puskesmas

: Klien sering berobat ke

Alergi :
Obat-Obatan
Makanan

:Tidakada
:Tidakada

FaktorLingkungan
I.

: Tidakada

AKTIVITAS HIDUP SEHARI-HARI (ADL)


IndeksKATZ
:B
Oksigenisasi
Cairan&Elektrolit

: Baik, RR 16 x/m
: Cukup, KlienMinum6gelas /hr

: Nafsu makan kurang, PolaMakan : 2x/hr, hanya mampu menghabiskan porsi


makanan, konjugtiva anemis, BB sebelumnya= 51 kg, BB saatini 50 kg, klien kurang
makan sayur dan jarang makan buah-buahan, klien hidup sendiri.
Eliminasi
: Baik, BAK 2x/hr BAB 1x/hr
Aktivitas
kegiatan

: Saat pagi klien berkebun, di rumah klien tidak ada

Istirahat & Tidur


Personal Hygiene

: Baik, klien tidur 8 jam/hr


: Baik, Klien Mandi 2x/hr

: Klien tidak ada niat lagi untuk berhubungan, klien tidak ada keinginan untuk
menikah lagi

si

:klien 6 bulan sekali melakukan perjalanan (berkunjung ke rumaha naknya).


J.

PSIKOLOGI, KOGNITIF DAN PERSEPTUAL


Konsep diri
: Klien merasa kehidupannya cukupt erpenuhi
Emosi
Adaptasi

: Stabil
: Baik

Mekanisme Pertahanan Diri : Baik


Status Mental
: Stabil
Tingkat Keasadaran
Afasia
Dimensia
Orientasi

: Compos Mentis
: Tidak
: Tidak
: Normal

Bicara
Bahasa Yang Digunakan

: Normal
:BahasaBanjar

Kemampuan Membaca
Kemampuan Interaksi

:Bisa
:Sesuai

Vertigo
:
Shirt Porteble Mental Status Questionaire (SPMSQ)
Mini Mental State Exam (MMSE)
Geriatrik Depresion Scale
APGAR
K. TINJAUAN SISTEM
KeadaanUmum
:Baik
Tingkat Kesadaran : Compos mentis
Tanda-Tanda Vital : TD
130/90 mmhg
RR
16 x/m
TB
168 cm

: 2 Fungsi Mental Utuh

: 2 Baik
: 4 Baik
: 6 Menengah

Nadi 80 x/m
Suhu 36,5oC
BB
50kg

PENGKAJIAN PERSISTEM
1) PERNAFASAN (B1 : BREATHING)
1. Bentuk Dada
: Simetris
2. SekresidanBatuk
: Tidakada
Nyeriwaktubernapas
: Tidakada
3. PolaNapas
: RR 16 x/m, Reguler
4. BunyiNapas
: Normal (tidakadaRonchi)
5. Pergerakan Dada
: Intercostal
6. TractilFremitis/Fremitus Vokal
:Tidakada
7. Alat Bantu Pernapasan
: Tidakada

2) CARDIOVASCULAR (B2: BLEEDING)


1. Nadi
: Frekuensi
80 x/m
2. Bunyi Jantung
: Normal

nt , Reguler

3.
4.
5.
6.
7.
3)
1.
2.
3.
4.
4)
1.
a.
b.
c.
d.
e.
f.
2.
3.
a.
b.
c.
d.
e.
4.
5.

5)

LetakJantung
: Ictus Cordis teraba pada intercostal V, kira-kira 1 jari medial
darigaris midklavikular
Pembesaran Jantung : Tidakada
NyeriDada
: Tidakada
Edema
: Tidakada
Clubbing Finger
: Tidak
PERSARAFAN (B3: BRAIN)
Tingkat kesadaran :
Compos Mentis
GCS :
Eye : 4
Verbal : 5
Motorik : 6
Total GCS
: 15
Refleks
: Normal
Koordinasi Gerak
: Ya
Kejang
: Tidak
PENGINDERAAN
Mata (Penglihatan)
Bentuk
Pupil
Gerak Bola Mata
Medan Penglihatan
ButaWarna
TekananInraOkuler
Hidung (Penciuman)
Bentuk
GangguanPenciuman
Telinga (Pendengaran)
Aurikel
Membran Tympani
Otorrchea
GangguanPendengaran
Tinitus
Perasa
Peraba

: Normal
: Ishokor
: Normal
: Normal
: Tidak
: Tidak
: Normal
: Tidak
: Normal
: Terang
: Tidak
: Tidak
: Tidak
: Normal
: Normal

PERKEMIHAN - ELIMINASI URI (B4: BLADDER)


Tidak ada nyeri saat berkemih, tidak sering berkemih, tidak ada urin yang tertahan
saat berkemih
MasalahKandungKemih : Tidakadamasalah
Produksi Urine
: 600 ml/hr
Frekuensi : 2x/hr
Warna:Kekuningan
Bau : Amoniak

6) PENCERNAAN-ELIMINASI ALVI (B5: BOWEL)


1. MulutdanTenggorokan
a. Mulut
: Rongga mulut bersih, tidak ada bau mulut
b. Gigi
: Gigi tidak lengkap, tidak ada lubang gigi,
Selaput Lendir Mulut
: Lembab
c. Lidah
: Bersih, ada sariawan
d. Kebersihan Rongga Mulut
: Tidak Berbau
e. Tenggorokan
: Tidak terlihat sulit menelan
f. Abdomen
: Kenyal
g. Pembesaran Hepar
: Tidak

h. Pembesaran Lien
i. Asites

: Tidak
: Tidak

2. Masalah Usus Besar dan Rectum / Anus

BAB 1 x/hr

Tidak ada masalah

Obat Pencahar
: Tidak

Lavemen
: Tidak
7) OTOT, YULANG DAN INTEGUMENT (B6: BONE)
1. OtotdanTulang

Kemampuan Pergerakan Sendi lengan dan Tungkai (ROM)


Bebas

Kemampuan kekuatan otot :


4
4
4
4

Fraktur
: Tidak

Dislokasi
:Tidak

Haemotom : Tidak
2. Integumen
Warna Kulit
: Kuning langsat
Akral
: Hangat
Turgor
: Tidakelastis
Tulang Belakang
: Normal
8) REPRODUKSI
Laki-laki :
Kelamin Bentuk
: Normal
Kebersihan Alat Kelamin
: Bersih
9) ENDOKRIN
1. Faktor Alergi
Manifestasi
Cara Mengatasi
2. Kelainan Endokrin

: Tidak
: Tidakada
: Tidakada
: Tidakada

10) PENGETAHUAN
Pengetahuan klien tentang kesehatan dirinya :
Klien mengetahui tentang kondisi kesehatannya dan klien sering cek up untuk
kesehatannya

ANALISA DATA
NO

KELUHAN

ETIOLOGI

PROBLEM

1.

DS : Klien mengatakan tidak nafsu makan


DO :
Gigi tidak lengkap
Lidah ada sariawan
PolaMakan : 2x/hr,
hanyamampumenghabiskan porsimakanan
Konjugtiva anemis
BB sebelumnya= 51 kg, BB saatini 50 kg
Klien kurang makan sayur dan jarang makan
buah-buahan
klienhidupsendiri

Intake yang
tidakadekuat

Ketidak
seimbangan
nutrisi : nutrisi
kurang dari
kebutuhan tubuh

RENCANA KEPERAWATAN
Dx.
Kep.

No.
1.

1.
2.
3.
4.
5.

Tujuan

Intervensi

Setelah dilakukan
1.
tindakan keperawatan
selama 1x24 jam
diharapkan
ketidakseimbangan 2.
nutrisi : nutrisi kurang
dari kebutuhan tubuh
teratasi dengan
Kriteria hasil :
Nafsu makan
3.
meningkat
Berat badan meningkat
Adanya perubahan pola
makan
Konjungtiva normal 4.
Klien tampak tidak
lemah

Timbang berat badan


setiap hari

Rasional
1. R/mengetahui perubahan
keadaan umum nutrisi pada
klien

Anjurkan makan sedikit 2. R/Dilatasi gaster dapat


tapi sering
terjadi bila pemberian
makan terlalu cepat setelah
periode puasa
Anjurkan makan-makanan3. R/membantu meningkatkan
yang lunak dan mudah
intake makanan
dicerna.

4. Membantu meningkatkan
Anjurkan keluarga untuk
nafsu makan
menyediakan makanan
kesukaan klien.
5. R/ Mencegah terjadinya
5. Anjurkan makan makanan mual dan membantu
yang disajikan dalam
meningkatkan nafsu makan
kondisi hangat

Dx.
Kep.

No.
1. 1
.

Implementasi

Evaluasi

Tgl 25 Maret 2012 (09.00 wib)


1. Menimbang berat badan setiap hari
Hasil : BB = 50 kg
2. Menganjurkan makan sedikit tapi
sering
Hasil :
Anjuran telah di berikan , klien akan
melakukan anjuran.
3. Menganjurkan makan makanan
yang lunak dan mudah dicerna
Hasil :
Klien setuju untuk makan makanan
yang lunak dan mudah dicerna

26 Maret 2012 (09.00 wib)


DS : Saya sudah
menghabiskan setengah
porsi makanan
DO :
K/u baik
Nafsumakanklienmeningka
t
Konjungtiva normal
TD : 100 / 70 mmhg
N : 80 x/m
RR : 20 x/m
S : 36,6 oC
BB 50 kg

4. Menganjurkan keluarga untuk


A : Masalah nutrisi kurang
menyediakan makanan kesukaan
dari kebutuhan tubuh
klien
teratasi sebagian
Hasil :
1. Nafsu makan meningkat
Anjuran telah diberikan, keluarga 2. Adanya perubahan pola
mengungkapkan akan melakukan
makan
apa yang di anjurkan.
3. Konjungtiva normal
4. Klien tampak tidak lemah
5. Menganjurkan makan makanan
yang disajikan dalamkondisi hangat P: Lanjutkan intervensi
Hasil :
Klien setuju untuk makan makanan
yang disajikan dalam kondisi hangat

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

My World and My Life

Tempat berbagi,mengadu,dan
"pamer"

Klasik

Kartu Lipat

Majalah

Mozaik

Bilah Sisi

Cuplikan

Kronologis

1.
MAR

31

MAKALAH ASUHAN KEPERAWATAN GERONTIK PADA Ny. R


DENGAN MASALAH GANGGUAN O2 DAN CO2 (kelompok 5)

LAPORANPENDAHULUAN

ASUHANKEPERAWATANGERONTIKPADANy.R
DENGANMASALAHGANGGUANO2DANCO2

KELOMPOK5:
ADITYATAGAF
DESINOVIANTY
RYANNOORPRATAMA
SUMIANTI
WANTOANDREANTO

AKADEMIKEPERAWATAN
PEMERINTAHKABUPATENKOTAWARINGINTIMUR
JL.BATUBERLIANNO.IITELP.(0531)22960
2012

KATAPENGANTAR
PujisyukurkepadaTuhanYangMahaEsakarenaberkattaufikdanhidayahNya,
makalah ini dapat diselesaikan. Makalah ini merupakan makalah pengetahuan bagi
mahasiswa/iakperpemkabkotimmaupunparapembacauntukbidangIlmuPengetahuan.
Makalahinisendiridibuatgunamemenuhisalahsatutugaskuliahdaridosen
matakuliahKeperawatanAnakIdenganjudulASUHANKEPERAWATANGERONTIK
PADA NY.R DENGAN MASALAH GANGGUANO2 DAN CO2. Dalam penulisan
makalahinipenulisberusahamenyajikanbahasayangsederhanadanmudahdimengertioleh
parapembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih banyak
kekurangan.Olehkarenanya,penulismenerimakritikdansaranyangpositifdanmembangun
dari rekanrekan pembaca untuk penyempurnaan makalah ini. Penulis juga mengucapkan
banyakterimakasihkepadarekanrekanyangtelahmembantudalampenyelesaianmakalah
ini.
Akhirkata,semogamakalahinidapatmemberikanmanfaatkepadakitasemua.Amin.

Sampit,Maret2012

Penulis

DAFTARISI
HALAMANJUDUL...............................................................................................................i
KATAPENGANTAR............................................................................................................ii
DAFTARISI........................................................................................................................iii
BABIPENDAHULUAN
1.1LATARBELAKANG...................................................................................1
1.2TUJUANPENULISAN................................................................................1
1.3RUMUSANMASALAH................................................................................2
1.4METODEPENULISAN...............................................................................2
1.5SISTEMATIKAPENULISAN........................................................................2
BABIIPEMBAHASAN
2.1..LAPORAN PENDAHULUAN ASUHAN KEPERAWATAN GERONTIK PADA NY R DENGAN
GANGGUANO2DANCO2
A.Pengertianoksigenasi...................................................................
B.Tujuanpemberianoksigenasi......................................................
C.Anatomifisiologisistempernafasan...........................................
D.Factoryangmempengaruhisistempernafasan.......................
E.PENATALAKSANAAN...........................................................................
F.MASALAHKEPERAWATAN..................................................................
G.DIAGNOSAKEPERAWATAN.................................................................
H.RENCANAKEPERAWATAN..................................................................
DAFTARKEPUSTAKAAN
2.2..LAPORANKASUSASUHANKEPERAWATANGERONTIKPADANYDENGANGANGGUANo2dan
co2
PENGKAJIAN............................................................................................15
ANALISADATA.........................................................................................18
RENCANAKEPERAWATAN.......................................................................19
BABIIIPENUTUP
3.1KESIMPULAN............................................................................................22
3.2SARAN.....................................................................................................22
DAFTARPUSTAKA

BABI
PENDAHULUAN
A.LatarBelakang

O2danCO2merupakanbagiandarikehidupanmanusia,sehinggakualitas oksigenasi
ikutmenentukankualitashidup.Oksigenasiadalahmemberikanalirangasoksigen(O2)lebih
dari 21 % pada tekanan 1 atmosfir sehingga konsentrasi oksigen meningkat dalam
tubuh.memberikanpengobatansesuaipenyebabdanuntukmemperbaikifungsioksigenasi
sepertidijelaskandalammakalahini.
B.Tujuan
Tujuan

Instruksional

Umum
Setelah mempelajari materi ini, peserta didik diharapkan mampu memberikan asuhan
keperawatanpadapasiendengangangguanpemenuhankebutuhanoksigenasi.
Tujuan

Instruksional

Khusus
Setelah menyelesaikan bab ini, peserta didik akan mampu untuk :
1.

Menjelaskan

pengertian

oksigenasi
2.

Menjelaskan

tujuan

pemberian

oksigen
3. Menguraikan stuktur anatomi sistem pernapasan serta fungsinya
4. Menguraikan fisiologi sistem pernapasan ( ventilasi, difusi dan transportasi )
5. Menjelaskan faktorfaktor yang mempengaruhi pernapasan
6. Menjelaskan masalahmasalah yang timbul dalam pemenuhan kebutuhan oksigen
7.Mengidentifikasitindakankeperawatanuntukmempertahankandanmemenuhikebutuhan
pertukaran

O2

dan

CO2

:
a.

Pengaturan

posisi
b.

Latihan

nafas

dalam
c.

Batuk

efektif
d.

Hidrasi
e.

Inhalasi
f.

Pemberian

O2
g.

Fisioterapi

dada

(vibrasi

dan

perkusi)
h.

Postural

drainage
i.

Massage

punggung
j.

Pengumpulan

dahak
8.

Menjelaskan

pengkajian

fungsi

pernapasan
9. Menjelaskan kemungkinan diagnosa keperawatan yang timbul
10. Menjelaskan perencanaan, tujuan yang akan dicapai secara umum
11.Menjelaskanintervensikeperawatansertaevaluasi

C.Manfaat

1.Bagimahasiswa
Merupakan sumber tambahan informasi dan pengetahuan tentang
permasalahanoksigenasipadamasausialanjutsebagaiacuandalammemberikanpelayanan
keperawatanpadasaatpraktiklapangan.
2.Bagiinstitusidancivitasakademika
Mengukurpengetahuandanpengalamanmahasiswadalammenyusunsuatumakalahdengan
mengambildariberbagaisumberliteraturesertadijadikansebagaisumberbacaantambahan
diperpustakaan
D.RumusanMasalah
1.Apapengertianoksigenasi?
2.Apatujuanpemberianoksigenasi?
3.Apasajaanatomisistempernafasan?
4.Apafisiologisistempernafasan?
5.Apasajafactorfactoryangmempengaruhipernafasan?
E.MetodePenulisan

Metodeyangdigunakandalampenulisanmakalahiniyaitumetodedeskriptifdengan
menggunakan studi melalui pendekatan proses keperawatan dengan langkahlangkah
pengkajian, perumusan diagnosa, perencanaan, pelaksanaan dan evaluasi. Tehnik
pengumpulan data yaitu dengan menggunakan studi kepustakaan yaitu mempelajari
Dokumentasi Keperawatan serta sumbersumber lainnya yang berhubungan dengan judul
makalahdanmasalahyangdibahas
F.SistematikaPenulisan

Sistematika penulisan makalah ini yaitu Kata Pengantar, Daftar Isi, Bab I
PendahuluanyangterdiridariLatarBelakang,RumusanMasalah,TujuanPenulisan,Metode
Penulisan,danSistematikaPenulisan.BabIIPembahasan.BabIIIPenutupyangterdiridari
KesimpulandanSaran.DaftarPustaka.

BABII
PEMBAHASAN

I.PENGERTIAN

OKSIGENASI
Oksigenasi adalah memberikan aliran gas oksigen (O2) lebih dari 21 % pada tekanan 1
atmosfirsehinggakonsentrasioksigenmeningkatdalamtubuh.
II.TUJUAN

PEMBERIAN

OKSIGENASI
1. Untuk mempertahankan oksigen yang adekuat pada jaringan
2.

Untuk

menurunkan

kerja

paruparu
3.Untukmenurunkankerjajantung

III.ANATOMI
A.SaluranNafasAtas

SISTEM

PERNAPASAN

1.

Hidung

Terdiri

atas

bagian

eksternal

dan

internal
Bagian eksternal menonjol dari wajah dan disangga oleh tulang hidung dan kartilago
Bagianinternalhidungadalahronggaberlorongyangdipisahkanmenjadironggahidung
kanan dan kiri oleh pembagi vertikal yang sempit, yang disebut septum
Rongga hidung dilapisi dengan membran mukosa yang sangat banyak mengandung
vaskular

yang

disebut

mukosa

hidung
Permukaanmukosahidungdilapisiolehselselgobletyangmensekresilendirsecaraterus
menerus dan bergerak ke belakang ke nasofaring oleh gerakan silia
Hidung berfungsi sebagai saluran untuk udara mengalir ke dan dari paruparu
Hidungjugaberfungsisebagaipenyaringkotorandanmelembabkansertamenghangatkan
udara

yang

dihirup

ke

dalam

paruparu
Hidungjuga bertanggung jawab terhadap olfaktori (penghidu) karena reseptor olfaktori
terletakdalammukosahidung,danfungsiiniberkurangsejalandenganpertambahanusia
2.Faring
Faringatautenggorokmerupakanstruktursepertitubayangmenghubungkanhidung
danronggamulutkelaring
Faringdibagimenjaditigaregion:nasal(nasofaring),oral(orofaring),danlaring
(laringofaring)
Fungsifaringadalahuntukmenyediakansaluranpadatraktusrespiratoriusdandigestif
3.

Laring
Laringatauorgansuaramerupakanstrukturepitelkartilagoyangmenghubungkan
faring

dan

trakea
Laring sering disebut sebagai kotak suara dan terdiri atas :
Epiglotis : daun katup kartilago yang menutupi ostium ke arah laring selama menelan
Glotis : ostium antara pita suara dalam laring
Kartilagotiroid:kartilagoterbesarpadatrakea,sebagiandarikartilagoinimembentuk
jakun(Adamsapple)
Kartilagokrikoid:satusatunyacincinkartilagoyangkomplitdalamlaring(terletakdibawah
kartilagotiroid)
Kartilagoaritenoid:digunakandalamgerakanpitasuaradengankartilagotiroid
Pitasuara:ligamenyangdikontrololehgerakanototyangmenghasilkanbunyisuara(pita
suara

melekat

pada

lumen

laring)
Fungsi utama laring adalah untuk memungkinkan terjadinya vokalisasi
Laring juga berfungsi melindungi jalan nafas bawah dari obstruksi benda asing dan
memudahkanbatu
4.

Trakea

Disebut

juga

batang

tenggorok
Ujungtrakeabercabangmenjadiduabronkusyangdisebutkarina
B.

Saluran

Nafas

Bawah
1.
Bronkus

Terbagi

menjadi

bronkus

kanan

dan

kiri
Disebut bronkus lobaris kanan (3 lobus) dan bronkus lobaris kiri (2 bronkus)

Bronkus lobaris kanan terbagi menjadi 10 bronkus segmental dan bronkus lobaris
kiriterbagi

menjadi

bronkus

segmental
Bronkus segmentalis ini kemudian terbagi lagi menjadi bronkus subsegmental
yangdikelilingiolehjaringanikatyangmemiliki:arteri,limfatikdansaraf
2.

Bronkiolus
Bronkus segmental bercabangcabang menjadi bronkiolus
Bronkiolus mengadung kelenjar submukosa yang memproduksi lendir yang
membentukselimuttidakterputusuntukmelapisibagiandalamjalannapas
3.

Bronkiolus

Terminalis
Bronkiolus membentuk percabangan menjadi bronkiolus terminalis (yang
tidakmempunyaikelenjarlendirdansilia)
4.

Bronkiolus

respiratori
Bronkiolus terminalis kemudian menjadi bronkiolus respiratori
Bronkiolusrespiratoridianggapsebagaisalurantransisionalantarajalannapaskonduksi
danjalanudarapertukarangas
5.

Duktus

alveolar

dan

Sakus

alveolar
Bronkiolusrespiratorikemudianmengarahkedalamduktusalveolardansakusalveolar
Dankemudianmenjadialveoli
6.

Alveoli

Merupakan

tempat

pertukaran

O2

dan

CO2
Terdapatsekitar300jutayangjikabersatumembentuksatulembarakanseluas70m2

Terdiri

atas

tipe

:
Selsel alveolar tipe I : adalah sel epitel yang membentuk dinding alveoli
SelselalveolartipeII:adalahselyangaktifsecarametabolikdanmensekresisurfaktan
(suatufosfolipidyangmelapisipermukaandalamdanmencegahalveolaragartidakkolaps)
SelselalveolartipeIII:adalahmakrofagyangmerupakanselselfagotosisdanbekerja
sebagaimekanismepertahanan
PARU
Merupakan organ yang elastis berbentuk kerucut

Terletak

dalam

rongga

dada

atau

toraks
Kedua paru dipisahkan oleh mediastinum sentral yang berisi jantung dan
beberapapembuluh

darah

besar

Setiap

paru

mempunyai

apeks

dan

basis
Paru kanan lebih besar dan terbagi menjadi 3 lobus oleh fisura interlobaris
Paru kiri lebih kecil dan terbagi menjadi 2 lobus
Loboslobus tersebut terbagi lagi menjadi beberapa segmen sesuai dengan
segmenbronkusnya
PLEURA
Merupakan lapisan tipis yang mengandung kolagen dan jaringan elastis

Terbagi

mejadi

:
Pleura parietalis yaitu yang melapisi rongga dada
Pleura viseralis yaitu yang menyelubingi setiap paruparu

Diantarapleuraterdapatronggapleurayangberisicairantipispleurayangberfungsiuntuk
memudahkan kedua permukaan itu bergerak selama pernapasan, juga untuk mencegah
pemisahan

toraks

dengan

paruparu
Tekanandalamronggapleuralebihrendahdaritekananatmosfir,haliniuntukmencegah
kolapparuparu
IV.

FISIOLOGI

SISTEM

PERNAPASAN
Bernafas / pernafasan merupkan proses pertukaran udara diantara individu dan
lingkungannya dimana O2 yang dihirup (inspirasi) dan CO2 yang dibuang (ekspirasi).
Prosesbernafasterdiridari3bagian,yaitu:
1. Ventilasi yaitu masuk dan keluarnya udara atmosfir dari alveolus ke paruparu atau
sebaliknya.Proses keluar masuknya udara paruparu tergantung pada perbedaan tekanan
antaraudaraatmosfirdenganalveoli.Padainspirasi,dada,mengembang,diafragmaturundan
volume paru bertambah. Sedangkan ekspirasi merupakan gerakan pasif.
Faktorfaktor

yang

mempengaruhi

ventilasi

:
a.

Tekanan

udara

atmosfir
b.

Jalan

nafas

yang

bersih
c.Pengembanganparuyangadekuat

2.Difusiyaitupertukarangasgas (oksigendankarbondioksida)antaraalveolus dankapiler


paruparu.Proseskeluarmasuknyaudarayaitudaridarahyangbertekanan/konsentrasilebih
besarkedarahdengantekanan/konsentrasiyanglebihrendah.Karenadindingalveolisangat
tipisdandikelilingiolehjaringanpembuluhdarahkapileryangsangatrapat,membranini
kadang

disebut

membran

respirasi.
Perbedaantekananpadagasgasyangterdapatpadamasingmasingsisimembranrespirasi
sangatmempengaruhiprosesdifusi.Secaranormalgradientekananoksigenantaraalveoli
dan darah yang memasuki kapiler pulmonal sekitar 40 mmHg.
Faktorfaktor

yang

mempengaruhi

difusi

:
a.

Luas

permukaan

paru
b.

Tebal

membran

respirasi
c.

Jumlah

darah
d.

Keadaan/jumlah

kapiler

darah
e.

Afinitas
f.Waktuadanyaudaradialveoli
3.Transporyaitupengangkutanoksigenmelaluidarahkeselseljaringantubuhdan
sebaliknya karbondioksida dari jaringan tubuh ke kapiler.
Oksigen perlu ditransportasikan dari paruparu ke jaringan dan karbondioksida harus
ditransportasikan dari jaringan kembali ke paruparu. Secara normal 97 % oksigen akan
berikatan dengan hemoglobin di dalam sel darah merah dan dibawa ke jaringan sebagai
oksihemoglobin. Sisanya 3 % ditransportasikan ke dalam cairan plasma dan selsel.
Faktorfaktor

yang

mempengaruhi

laju

transportasi

:
a.

Curah

jantung

(cardiac

Output

CO)
b.

Jumlah

sel

darah

merah
c.

Hematokrit

darah
d.Latihan(exercise)

V.
1.

2.

3.

4.

5.

6.

FAKTORFAKTOR YANG MEMPENGARUHI PERNAPASAN


Faktorfaktoryangmempengaruhioksigenasiadalah:

Tahap

Perkembangan
Saat lahir terjadi perubahan respirasi yang besar yaitu paruparu yang sebelumnya berisi
cairanmenjadiberisiudara.Bayimemilikidadayangkecildanjalannafasyangpendek.
Bentukdadabulatpadawaktubayidanmasakanakkanak,diameterdaridepankebelakang
berkurang dengan proporsi terhadap diameter transversal. Pada orang dewasa thorak
diasumsikanberbentukoval.Padalanjutusiajugaterjadiperubahanpadabentukthorakdan
polanapas.

Lingkungan
Ketinggian,panas,dingindanpolusimempengaruhioksigenasi.Makintinggidaratan,makin
rendahPaO2,sehinggamakinsedikitO2yangdapatdihirupindividu.Sebagaiakibatnya
individupadadaerahketinggianmemilikilajupernapasandanjantungyangmeningkat,juga
kedalaman

pernapasan

yang

meningkat.
Sebagairesponterhadappanas,pembuluhdarahperiferakanberdilatasi,sehinggadarahakan
mengalir ke kulit. Meningkatnya jumlah panas yang hilang dari permukaan tubuh akan
mengakibatkancurahjantungmeningkatsehinggakebutuhanoksigenjugaakanmeningkat.
Padalingkunganyangdinginsebaliknyaterjadikontriksipembuluhdarahperifer,akibatnya
meningkatkan tekanan darah yang akan menurunkan kegiatankegiatan jantung sehingga
mengurangikebutuhanakanoksigen.

Gaya

Hidup
Aktifitasdanlatihanfisikmeningkatkanlajudankedalamanpernapasandandenyutjantung,
demikianjugasuplayoksigendalamtubuh.Merokokdanpekerjaantertentupadatempat
yangberdebudapatmenjadipredisposisipenyakitparu.

Status

Kesehatan
Padaorangyangsehatsistemkardiovaskulerdanpernapasandapatmenyediakanoksigen
yang cukup untuk memenuhi kebutuhan tubuh. Akan tetapi penyakit pada sistem
kardiovaskulerkadangberakibatpadaterganggunyapengirimanoksigenkeselseltubuh.
Selain itu penyakitpenyakit pada sistem pernapasan dapat mempunyai efek sebaliknya
terhadap oksigen darah. Salah satu contoh kondisi kardiovaskuler yang mempengaruhi
oksigenadalahanemia,karenahemoglobinberfungsimembawaoksigendankarbondioksida
makaanemiadapatmempengaruhitransportasigasgastersebutkedandarisel.

Narkotika
Narkotikasepertimorfindandapatmenurunkanlajudankedalampernapasanketikadepresi
pusatpernapasandimedula.Olehkarenaitubilamemberikanobatobatnarkotikanalgetik,
perawatharusmemantaulajudankedalamanpernapasan.

Perubahan/gangguan

pada

fungsi

pernapasan
Fungsi pernapasan dapat terganggu oleh kondisikondisi yang dapat mempengarhi
pernapasan

yaitu

:
a. Pergerakan udara ke dalam atau keluar paru
b. Difusi oksigen dan karbondioksida antara alveoli dan kapiler paru
c. Transpor oksigen dan transpor dioksida melalui darah ke dan dari sel jaringan.
Gangguanpadarespirasiyaituhipoksia,perubahanpolanapasdanobstruksisebagianjalan
napas.
Hipoksiayaitusuatukondisiketikaketidakcukupanoksigendidalamtubuhyangdiinspirasi
sampaijaringan.Halinidapatberhubungandenganventilasi,difusigasatautransporgas
olehdarahyangdapatdisebabkanolehkondisiyangdapatmerubahsatuataulebihbagian
bagiandariprosesrespirasi.Penyebablainhipoksiaadalahhipoventilasialveolaryangtidak

adekuat sehubungan dengan menurunnya tidal volume, sehingga karbondioksida kadang


berakumulasi

didalam

darah.
Sianosisdapatditandaidenganwarnakebiruanpadakulit,dasarkukudanmembranmukosa
yang disebabkan oleh kekurangan kadar oksigen dalam hemoglobin. Oksigenasi yang
adekuatsangatpentinguntukfungsiserebral.Korteksserebraldapatmentoleransihipoksia
hanyaselama35menitsebelumterjadikerusakanpermanen.Wajahoranghipoksiaakut
biasanyaterlihatcemas,lelahdanpucat.
7.

Perubahan

pola

nafas
Pernapasanyangnormaldilakukantanpausahadanpernapasaninisamajaraknyadansedikit
perbedaan kedalamannya. Bernapas yang sulit disebut dyspnoe (sesak). Kadangkadang
terdapat napas cuping hidung karena usaha inspirasi yang meningkat, denyut jantung
meningkat.Orthopneoyaituketidakmampuanuntukbernapaskecualipadaposisidudukdan
berdirisepertipadapenderitaasma.
8.

Obstruksi

jalan

napas
Obstruksijalannapaslengkapatausebagaiandapatterjadidisepanjangsaluranpernapasandi
sebelahatasataubawah.Obstruksijalannapasbagianatasmeliputi:hidung,pharing,laring
atautrakhea,dapatterjadikarenaadanyabendaasingsepertimakanan,karenalidahyang
jatuh kebelakang (otrhopharing) bila individu tidak sadar atau bila sekresi menumpuk
disaluran

napas.
Obstruksijalannapasdibagianbawahmelibatkanoklusisebagianataulengkapdarisaluran
napas kebronkhus danparuparu.Mempertahankanjalannapas yangterbukamerupakan
intervensikeperawatanyangkadangkadangmembutuhkantindakanyangtepat.Onbstruksi
sebagianjalannapasditandaidenganadanyasuaramengorokselamainhalasi(inspirasi).
VI.

PENGKAJIAN

KEPERAWATAN
Secaraumumpengkajiandimulaidenganmengumpulkandatatentang:
1. Biodata pasien (umur, sex, pekerjaan, pendidikan)
Umur pasien bisa menunjukkan tahap perkembangan pasien baik secara fisik maupun
psikologis, jenis kelamin dan pekerjaan perlu dikaji untuk mengetahui hubungan dan
pengaruhnya terhadap terjadinya masalah/penyakit, dan tingkat pendidikan dapat
berpengaruhterhadappengetahuankliententangmasalahnya/penyakitnya.
2. Keluhan utama dan riwayat keluhan utama (PQRST)
Keluhan utama adalah keluhan yang paling dirasakan mengganggu oleh klien pada saat
perawatmengkaji,danpengkajiantentangriwayatkeluhanutamaseharusnyamengandung
unsurPQRST(Paliatif/Provokatif,Quality,Regio,Skala,danTime)
3.

Riwayat

perkembangan
a.

Neonatus

30

60

x/mnt
b.

Bayi

44

x/mnt
c.

Anak

20

25

x/mnt
d.

Dewasa

15

20

x/mnt
e.Dewasatua:volumeresidumeningkat,kapasitasvitalmenurun
4.

Riwayat

kesehatan

keluarga
Dalamhaliniperludikajiapakahadaanggotakeluargayangmengalamimasalah/penyakit
yangsama.
5.

Riwayat

sosial
Perlu dikaji kebiasaankebiasaan klien dan keluarganya, misalnya : merokok, pekerjaan,
rekreasi,keadaanlingkungan,faktorfaktoralergendll.

6.

Riwayat

psikologis
Disini

perawat

perlu

mengetahui

tentang

:
a. Perilaku / tanggapan klien terhadap masalahnya/penyakitnya
b.

Pengaruh

sakit

terhadap

cara

hidup
c.

Perasaan

klien

terhadap

sakit

dan

therapi
d.Perilaku/tanggapankeluargaterhadapmasalah/penyakitdantherapi
7.Riwayatspiritual
8.

Pemeriksaan

fisik
a.

Hidung

dan

sinus
Inspeksi : cuping hidung, deviasi septum, perforasi, mukosa (warna, bengkak, eksudat,
darah),

kesimetrisan

hidung.
Palpasi

sinus

frontalis,

sinus

maksilaris
b.

Faring
Inspeksi : warna, simetris, eksudat ulserasi, bengkak
c.

Trakhea
Palpasi:dengancaraberdiridisampingkananpasien,letakkanjaritengahpadabagianbawah
trakheadanrabatrakheakeatas,kebawahdankesampingsehinggakedudukantrakhea
dapatdiketahui.

d.

Thoraks
Inspeksi

:
Postur,bervariasimisalnyapasiendenganmasalahpernapasankronisklavikulanyamenjadi
elevasi

ke

atas.
Bentuk dada, pada bayi berbeda dengan orang dewasa. Dada bayi berbentuk
bulat/melingkardengandiameteranteroposteriorsamadengandiametertranversal(1:1).
Pada orang dewasa perbandingan diameter anteroposterior dan tranversal adalah 1 : 2
Beberapakelainanbentukdadadiantaranya:Pigeonchestyaitubentukdadayangditandai
dengandiametertranversalsempit,diameteranteroposteriormembesardansternumsangat
menonjolkedepan.Funnelchestmerupakankelainanbawaandenganciriciriberlawanan
dengan pigeon chest, yaitu sternum menyempit ke dalam dan diameter anteroposterior
mengecil.Barrelchestditandaidengandiameteranteroposteriordantranversalsamaatau
perbandingannya

1.
Kelainan tulang belakang diantaranya : Kiposis atau bungkuk dimana punggung
melengkung/cembungkebelakang.Lordosisyaitudadamembusungkedepanataupunggung
berbentuk cekung. Skoliosis yaitu tergeliatnya tulang belakang ke salah satu sisi.
Polanapas,dalamhaliniperludikajikecepatan/frekuensipernapasanapakahpernapasan
klieneupneayaitupernapasannormaldimanakecepatan1624x/mnt,klientenang,diam
dantidakbutuhtenagauntukmelakukannya,atautachipneayaitupernapasanyangcepat,
frekuensinyalebihdari24x/mnt,ataubradipneayaitupernapasanyanglambat,frekuensinya
kurang dari 16 x/mnt, ataukah apnea yaitu keadaan terhentinya pernapasan.
Perlujugadikajivolumepernapasanapakahhiperventilasiyaitubertambahnyajumlahudara
dalam paruparu yang ditandai dengan pernapasan yang dalam dan panjang ataukah
hipoventilasiyaituberkurangnyaudaradalamparuparuyangditandaidenganpernapasan
yang

lambat.
Perlu juga dikaji sifat pernapasan apakah klien menggunakan pernapasan dada yaitu
pernapasan yang ditandai dengan pengembangan dada, ataukah pernapasan perut yaitu

pernapasan

yang

ditandai

dengan

pengembangan

perut.
Perlujugadikajiritme/iramapernapasanyangsecaranormaladalahreguleratauirreguler,
ataukahklienmengalamipernapasancheynestokesyaitupernapasanyangcepatkemudian
menjadilambatdankadangdiselingiapnea,ataupernapasankusmaulyaitupernapasanyang
cepatdandalam,ataupernapasanbiotyaitupernapasanyangritmemaupunamplitodunya
tidak

teratur

dan

diselingi

periode

apnea.
Perlujugadikajikesulitanbernapasklien,apakahdispneayaitusesaknapasyangmenetap
dankebutuhanoksigentidakterpenuhi,ataukahortopneayaitukemampuanbernapashanya
bila

dalam

posisi

duduk

atau

berdiri.
Perlujugadikajibunyinapas,dalamhaliniperludikajiadanyastertor/mendengkuryang
terjadikarenaadanyaobstruksijalannapasbagianatas,ataustidoryaitubunyiyangkering
dan nyaring dan didengar saat inspirasi, atau wheezing yaitu bunyi napas seperti orang
bersiul,atauralesyaitubunyiyangmendesakataubergelembungdandidengarsaatinspirasi,
ataukah ronchi yaitu bunyi napas yang kasar dan kering serta di dengar saat ekspirasi.
Perlujugadikajibatukdansekresinya,apakahklienmengalamibatukproduktifyaitubatuk
yangdiikutiolehsekresi,ataubatuknonproduktifyaitubatukkeringdankerastanpasekresi,
ataukahhemoptueyaitubatukyangmengeluarkandarah

Statussirkulasi,dalamhaliniperludikajiheartrate/denyutnadiapakahtakhikardiyaitu
denyut nadi lebih dari 100 x/mnt, ataukah bradikhardi yaitu denyut nadi kurang dari 60
x/mnt.
Jugaperludikajitekanandarahapakahhipertensiyaitutekanandaraharteriyangtinggi,
ataukah hipotensi yaitu tekanan darah arteri yang rendah.
Jugaperludikajitentangoksigenasipasienapakahterjadianoxiayaitusuatukeadaandengan
jumlahoksigendalamjaringankurang,atauhipoxemiayaitusuatukeadaandenganjumlah
oksigen dalam darah kurang, atau hipoxia yaitu berkurangnya persediaan oksigen dalam
jaringanakibatkelainaninternalataueksternal,ataucianosisyaituwarnakebirubiruanpada
mukosa membran, kuku atau kulit akibat deoksigenasi yang berlebihan dari Hb, ataukah
clubbingfingeryaitumembesarnyajarijaritanganakibatkekuranganoksigendalamwaktu
yang

lama.
Palpasi

:
Untuk mengkaji keadaan kulit pada dinding dada, nyeri tekan, massa, peradangan,
kesimetrisan

ekspansi

dan

taktil

vremitus.
Taktil vremitus adalah vibrasi yang dapat dihantarkan melalui sistem bronkhopulmonal
selamaseseorangberbicara.Normalnyagetaranlebihterasapadaapeksparudandinding
dadakanankarenabronkhuskananlebihbesar.Padaprialebihmudahterasakarenasuara
priabesar
VII.

DIAGNOSA

KEPERAWATAN
Diagnosa keperawatan yang lazim terjadi pada pasien dengan gangguan pemenuhan
kebutuhan

oksigenasi

diantaranya

adalah

:
1.

Bersihan

jalan

nafas

tidak

efektif
2.

Pola

napas

tidak

efektif
3.

Gangguan

pertukaran

gas
4.

Penurunan

kardiak

output
5.

Rasa

berduka

6.

Koping

tidak

efektif
7.

Perubahan

rasa

nyaman
8.

Potensial/resiko

infeksi
9.

Interaksi

sosial

terganggu
10.Intoleransiaktifitas,dllsesuairesponklien
1.Bersihan

jalan

napas

tidak

efektif
Yaitu tertumpuknya sekresi atau adanya obstruksi pada saluran napas.
Tandatandanya

Bunyi

napas

yang

abnormal

Batuk

produktif

atau

non

produktif

Cianosis

Dispnea

Perubahan

kecepatan

dan

kedalaman

pernapasan
Kemungkinan

faktor

penyebab

:
Sekresi yang kental atau benda asing yang menyebabkan obstruksi

Kecelakaan

atau

trauma

(trakheostomi)
Nyeri abdomen atau nyeri dada yang mengurangi pergerakan dada
Obatobat yang menekan refleks batuk dan pusat pernapasan

Hilangnya

kesadaran

akibat

anasthesi
Hidrasiyangtidakadekuat,pembentukansekresiyangkentaldansulituntukdiexpektoran

Immobilisasi
Penyakitparumenahunyangmemudahkanpenumpukansekresi
2.

Pola

napas

tidak

efektif
YaituresponpasienterhadaprespirasidenganjumlahsuplayO2kejaringantidakadekuat
Tandatandanya

Dispnea

Peningkatan

kecepatan

pernapasan

Napas

dangkal

atau

lambat

Retraksi

dada

Pembesaran

jari

(clubbing

finger)

Pernapasan

melalui

mulut

Penambahan

diameter

anteroposterior

Cianosis,

flail

chest,

ortopnea

Vomitus
Ekspansiparutidaksimetris
Kemungkinan

faktor

penyebab

:
Tidak adekuatnya pengembangan paru akibat immobilisasi, obesitas, nyeri
Gangguan neuromuskuler seperti : tetraplegia, trauma kepala, keracunan obat anasthesi
Gangguanmuskuloskeletalseperti:frakturdada,traumayangmenyebabkankolapsparu
CPPO seperti : empisema, obstruksi bronchial, distensi alveoli

Hipoventilasi

akibat

kecemasan

yang

tinggi
Obstruksijalannapasseperti:infeksiakutataualergiyangmenyebabkanspasmebronchial
atau

oedema
PenimbunanCO2akibatpenyakitparu

3.Gangguan

pertukaran

gas
Yaitu perubahan asam basa darah sehingga terjadi asidosis respiratori dan alkalosis
respiratori.
4.Penurunan

kardiak

output
Tandatandanya

Kardiak

aritmia

Tekanan

darah

bervariasi

Takikhardia

atau

bradikhardia

Cianosis

atau

pucat

Kelemahan,

vatigue

Distensi

vena

jugularis

Output

urine

berkurang

Oedema
Masalahpernapasan(ortopnea,dispnea,napaspendek,ralesdanbatuk)
Kemungkinan

penyebab

:
Disfungsi kardiak output akibat penyakit arteri koroner, penyakit jantung
Berkurangnyavolumedarahakibatperdarahan,dehidrasi,reaksialergidanreaksikegagalan
jantung

Cardiak

arrest

akibat

gangguan

elektrolit
Ketidakseimbanganelektrolitsepertikelebihanpotassiomdalamdarah
VIII.

RENCANA

KEPERAWATAN
1.

Mempertahankan

terbukanya

jalan

napas
A.

Pemasangan

jalan

napas

buatan
Jalannapasbuatan(artificialairway)adalahsuatualatpipa(tube)yangdimasukkankedalam
mulut atau hidung sampai pada tingkat ke2 dan ke3 dari lingkaran trakhea untuk
memfasilitasi

ventilasi

dan

atau

pembuangan

sekresi
Rute

pemasangan

Orotrakheal

mulut

dan

trakhea

Nasotrakheal

hidung

dan

trakhea
Trakheostomi:tubedimasukkankedalamtrakheamelaluisuatuinsisiyangdiciptakanpada
lingkaran

kartilago

ke2

atau

ke3
Intubasiendotrakheal
B.

Latihan

napas

dalam

dan

batuk

efektif
Biasanya dilakukan pada pasien yang bedrest atau post operasi
Cara

kerja

Pasien

dalam

posisi

duduk

atau

baring

Letakkan

tangan

di

atas

dada
Tarik napas perlahan melalui hidung sampai dada mengembang

Tahan

napas

untuk

beberapa

detik
Keluarkan napas secara perlahan melalui mulut dampai dada berkontraksi
Ulangi langkah ke3 sampai ke5 sebanyak 23 kali
Tariknapasdalammelaluihidungkemudiantahanuntukbeberapadetiklalukeluarkan
secara

cepat

disertai

batuk

yang

bersuara

Ulangi

sesuai

kemampuan

pasien

Pada pasien potop. Perawat meletakkan telapak tangan atau bantal pada daerah bekas
operasidanmenekannyasecaraperlahanketikapasienbatuk,untukmenghindariterbukanya
lukainsisidanmenguranginyeri
C.

Posisi

yang

baik
Posisisemifowleratauhighfowlermemungkinkanpengembanganparumaksimalkarena
isi

abdomen

tidak

menekan

diafragma
Normalnyaventilasiyangadekuatdapatdipertahankanmelaluiperubahanposisi,ambulasi
danlatihan
D.

Pengisapan

lendir

(suctioning)
Adalahsuatumetodeuntukmelepaskansekresiyangberlebihanpadajalannapas,suction
dapatdilakukanpadaoral,nasopharingeal,trakheal,endotrakhealatautrakheostomitube.
E.

Pemberian

obat

bronkhodilator
Adalahobatuntukmelebarkanjalannapasdenganmelawanoedemamukosabronkhusdan
spasme otot dan mengurangi obstruksi dan meningkatkan pertukaran udara.
Obatinidapatdiberikanperoral,subkutan,intravena,rektaldannebulisasiataumenghisap
ataumenyemprotkanobatkedalamsalurannapas.
2.

Mobilisasi

sekresi

paru
A.

Hidrasi
Cairandiberikansecaraoraldengancaramenganjurkanpasien22,5literperhari,tetapi
dalammengkonsumsicairanyangbanyakbataskemampuan/cadanganjantung.
B.

Humidifikasi
Pengisapanuappanasuntukmembantumengencerkanataumelarutkanlendir.
C.

Postural

drainage
Adalah posisi khuus yang digunakan agar kekuatan gravitasi dapat membantu di dalam
pelepasansekresibronkhialdaribronkhiolusyangbersarangdidalambronkhusdantrakhea,
dengan maksud supaya dapat membatukkan atau dihisap sekresinya.
Biasanya dilakukan 2 4 kali sebelum makan dan sebelum tidur / istirahat.
Tekniknya

Sebelum

postural

drainage,

lakukan

Nebulisasi

untuk

mengalirkan

sekret

Perkusi

sekitar

menit
Vibrasi 4 5 kali dalam satu periode
Lakukanposturaldrainage,tergantungletaksekretdalamparu.
3.

Mempertahankan dan meningkatkan pengembangan paru


A.Latihannapas
Adalah teknik yang digunakan untuk menggantikan defisit pernapasan melalui
peningkatanefisiensipernapasanyangbertujuanpenghematanenergimelaluipengontrolan
pernapasan
Jenis

latihan

napas

Pernapasan

diafragma

Pursed

lips

breathing

Pernapasan

sisi

iga

bawah

Pernapasan
Pernapasansegmental

iga

dan

lower

back

B.Pemasanganventilasimekanik
Adalahalatyangberfungsisebagaipenggantitindakanpengaliran/penghembusanudara
keruangthoraksdandiafragma.Alatinidapatmempertahankanventilasisecaraotomatis
dalam

periode

yang

lama.
Adaduatipeyaituventilasitekanannegatifdanventilasitekananpositif.
C.Pemasanganchesttubedanchestdrainage
Chesttubedrainage/intrapleuraldrainagedigunakansetelahprosedurthorakik,satu
atau lebih chest kateter dibuat di rongga pleura melalui pembedahan dinding dada dan
dihubungkan

ke

sistem

drainage.
Indikasinyapadatraumaparuseperti:hemothoraks,pneumothoraks,openpneumothoraks,
flailchest.
Tujuannya

:
Untukmelepaskanlarutan,bendapadat,udaradarironggapleuraatauronggathoraksdan
rongga

mediastinum
Untukmengembalikanekspansiparudanmenatakembalifungsinormalkardiorespirasi
padapasienpascaoperasi,traumadankondisimedisdenganmembuattekanannegatifdalam
rongga

pleura.
Tipenya

:
a.

The

single

bottle

water

seal

system
b.

The

two

bottle

water
c.Thethreebottlewater
4. Mengurangi / mengoreksi hipoksia dan kompensasi tubuh akibat hipoksia
Dengan

pemberian

O2

dapat

melalui

Nasal

canule

Bronkhopharingeal

khateter

Simple

mask

Aerosol

mask

trakheostomy

collars
ETT(endotrakhealtube)
5. Meningkatkan transportasi gas dan Cardiak Output
Dengan resusitasi jantung paru (RJP), yang mencakup tindakan ABC, yaitu :
A : Air way adalah mempertahankan kebersihan atau membebaskan jalan napas
B:Breathingadalahpemberiannapasbuatanmelaluimulutkemulutataumulutkehidung
C:Circulationadalahmemulaikompresijantungataumemberikansirkulasibuatan
Jadi secara umum intervensi keperawatan mencakup di dalamnya :
a.

Health

promotion

Ventilasi

yang

memadai

Hindari

rokok

Pelindung

masker

saat

bekerja
Hindari inhaler, tetes hidung, spray (yang dapat menekan nervus 1)
Pakaianyangnyaman
b.

Health

restoration

and

maintenance
Mempertahankan jalan napas dengan upaya mengencerkan sekret

Teknik

batuk

dan

postural

drainage

Suctioning
Menghilangkanrasatakutdenganpenjelasan,posisifowler/semifowler,significantother
Mengatur istirahat dan aktifitas dengan memberikan HE yang bermanfaat, fasilitasi
lingkungan, tingkatkan rasa nyaman, terapi yang sesuai, ROM
Mengurangiusahabernapasdenganventilasiyangmemeadai,pakaiantipisdanhangat,
hindari makan berlebih dan banyak mengandung gas, atur posisi
Mempertahankannutrisidanhidrasijugadenganoralhygienedanmakananyangmudah
dikunyah

dan

dicerna
Mempertahankan eliminasi dengan memberikan makanan berserat dan ajarkan latihan
Mencegahdanmengawasipotensialinfeksidenganmenekankanprinsipmedikalasepsis

Terapi

O2

Terapi

ventilasi
Drainagedada
IX.

IMPLEMENTASI

KEPERAWATAN

DAN

EVALUASI
Implementasikeperawatansesuaidenganintervensidanevaluasidilakukansesuaitujuandan
kriteriatermasukdidalamnyaevaluasiproses.

FORMATPENGKAJIANINDIVIDU
ASUHANKEPERAWATANGERONTIK
TanggalPengkajian:25Maret2012

A.DATABIOGRAFI

Nama:NyR
TTL:26November1939
JenisKelamin:perempuanGol.Darah:O
Pendidikan:SD
Agama:Islam
StatusPerkawinan:Janda
TB/BB:160cm,44kg
Penampilan:Rapi,berjilbabCiriciritubuh:Kurus,kulitsawomatang
Alamat:Kel.KotaBesiHuluRT02/RW05
Kec.KotaBesiTelp/HP08125086514
Kab.Kotamadya
OrangYangDekat:Anak
Hubungan:Ibudananak
Alamat/Telpon:Kel.KotaBesiHuluRT02/RW05

B.RIWAYATKEPERAWATAN
1.

Genogram

Keterangan:: Laki laki: Garis


Keturunan
:Perempuan.......:TinggalSerumah
: Garis Hubungan:
Meninggal
2.RiwayatKeluarga
Dalam keluarga klien tidak ada yang mnderita penyakit menurun seperti DM,hipertensi,
asma,dll.TidakadapulayangmnderitapenyakitmenularsepertiTBC.

C.RIWAYATPEKERJAAN

Pekerjaansaatini:saatiniklienbekerjasebagaipetani
Alamatpekerjaan:
Jarakdarirumah:1km
Alattransportasi:jalankaki
Pekerjaansebelumnya:sebelumnyaklienbekerjasebagaipetanijuga
Jarakdarirumah:1km
Alattransportasi:jalankaki

Sumbersumberpendapatan&kecukupanterhadapkebutuhan:pendapatankliendidapatdarihasilpanen,
danjugabiasanyadidapatdarianakanaknyayangsudahbekerja.

D.RIWAYATLINGKUNGANHIDUP
Jenislantairumah:Kayu
Kondisilantai:Kering
Tanggarumah:Ada:aman(adapegangan)
Penerangan:cukup
Tempattidur:aman(pagarpembatas,tidakterlalutinggi)
Alatdapur:tertatarapi
WC:Ada:aman(posisiduduk,adapegangan)
Kebersihanlingkungan:bersih(tidakadabarangmembahayakan)
Jumlahorangyangtinggaldalamsaturumah:5orang
TetanggaTerdekat:Ada

E.RIWAYATREKREASI
HobbyatauMinat:berkebun,bertani,menjahit,memasak
Keanggotaanorganisasi:ketuaarisankampong,anggotaarisankeluarga
LiburanatauPerjalanan:pernahmemunaikanibadahHaji

F.SISTEMPENDUKUNG

Perawat/Bidan/Dokter/Fisioterafi*:perawat
Jarakdarirumah:500meter
RumahSakit:tidakada
Klinik:ada,jarak1km
PelayananKesehatanDirumah:tidakada
Makananyangdihantarkan:tidakada
Perawatanseharihariyangdilakukankeluarga:tidakada

G.DESKRIPSIKEKHUSUSAN

KebiasaanRitual:klienbiasanyatiapmalamjumatmenyiapkansesajianuntukleluhur
Yanglainnya:

H.STATUSKESEHATAN

StatusKesehatanumumSelamasetahunyanglalu:asma,rematik,vertigo
Statuskesehatanumumselama5tahunyanglalu:asma,batukbatuk
KeluhanUtama:asma
1.Provocative/Paliative:sesaknafas
2.Quality/Quantity:sepertitertusuktusuk
3.Region:uluhati
4.SeverityScale:5(skalasedang)
5.Timing:hilangtimbul
Pemahaman&PenatalaksanaanMasalahKesehatan:biasanyabilatimbulklienminumobatyangtelahdi
anjurkandanseringminumairhangat.
Obatobatan:

NO
1.
2.
3.

NAMAOBAT
Salbutamol2mg
dexametason
Vit.C

DOSIS
3x1
3x1
3X1

KETERANGAN

Alergi(CatatanAgentdanReaksiSpesifik):
Obatobatan:tidakada
Makanan:tidakada
FaktorLingkungan:cuacadingin,debu,polusi
Penyakityangdiderita:asma,rematik,vertigo

I.AKTIVITASHIDUPSEHARIHARI(ADL)

IndeksKATZ:A
Oksigenasi:
CairandanElektrolit:klienminumairputih1500mlperhari,didampingitehdankopi
Nutrisi:klienmakannasi,lauk,dansayur3kalisehari
Eliminasi:BAK3kaliperhari,BAB1kaliperhari
Aktivitas:tiaphariklienpergikesawahuntukbertani
IstirahatdanTidur:istirahatkliencukup,tidurseharikira210jam
PersonalHygiene:klienmampumandi,BAB,BAKsendiritanpabantuan
eksual:kebutuhanseksualtidakterpenuhikarenasuamikliensudahlamameninggal

J.PSIKOLOGI,KOGNITIFDANPERSEPTUAL

KonsepDiri:klienmampumenerimabahwadirinyaseoranglansia
Emosi:stabil
Adaptasi:klienmampuberadaptasidenganlingkungansekitar
Statusmental:baik
TingkatKesadaran:composmentis
Dimensia:tidak
Orientasi:normal
Bicara:normal
Bahasayangdigunakan:jawa,indonesia
Kemampuanmembaca:bisa
Kemampuaninteraksi:sesuai
Vertigo:ya
ShortPortebleMentalStatusQuestionaire(SPMSQ)=
MiniMentalStateExam(MMSE)=
GeriatrikDepresionScale=
APGAR=

K.TINJAUANSISTEM

KeadaanUmum:Baik
TingkatKesadaran:Composmentis
TandatandaVital:TD130/90mmHgNadi:88x/menit
RR26X/menitSuhu:36,20c
TB:160cmBB:44Kg

PENGKAJIANPERSISTEM
PERNAFASAN(B1:BREATHING)
1.Bentukdada:Simetris
2.SekresidanBatuk
Batuk:ya
Sputum:tidakada
Nyeriwaktubernafas:ya
3.Polanafas

a.FrekwensiNafas:28x/menit
Irguler
HiperVentilasi
4.Bunyinafas
a.Normal
vesikulerdi.........................................
Bronchialdi..............................................
Bronchovesikulerdi.....................................
b.Abnormal
Stridorlokasi............................
Strerorlokasi...............................
Wheezinglokasi..........................
Raleslokasi...............
Ronchilokasi....................
Krepitasilokasi.................................
FrictionRaplokasi.......................
c.ResonenLokal
Pectoreloguy
Bronchofoni
Egofoni
5.Pergerakandada
IntercostalSupra

ClaviculaTracheal

TagLainlain
SubsternalSuprasternalFlailChest
6.TractilFremitis/FremitusVokal
Meningkatlokasi
Menurunlokasi
Lainlain
7.AlatBantuPernafasan
NasalBagandMaskTracheostomi
MaskerRespirator
CARDIOVASKULER(B2:BLEEDING)
1.Nadi
Frekuensi88x/menit
RegulerKuat
2.BunyiJantung
Normal
3.LetakJantung
Ictuscordisterabapada.................
4.PembesaranJantung
tidak
5.NyeriDada

Ya
6.Edema:TidakAda
7.ClubbingFinger
Tidak
PERSYARAFAN(B3:BRAIN)
TingkatKesadaran:
ComposMentis
1.GCS:
Eye:4Verbal:5Motorik:6
TotalGCS:15
2.Refleks
Normal
3.KoordinasiGerak:Ya
4.KejangTidak
5.Lainlain..........................................
PENGINDERAAN(PERSEPSISENSORI)
1.Mata(Penglihatan)
a.Bentuk
Normal
b.Visus.....................
Pupil:
Isokor
c.GerakbolaMata:
Normal
d.MedanPenglihatan:
Normal
e.ButaWarna
Tidak
f.

Tekananintraokuler
Meningkat

2.Hidung(Penciuman)
a.
Bentuk:Normal
b.

GangguanPenciuman:Tidak

3.Telinga(Pendengaran)
a.
Aurikel:Normal
b.Membrantympani
Terang
c.Otorrhoea:
Ya,jenis.......................Tidak
d.

GangguanPendengaran:Tidak

e.

Tinitus:Tidak

4.Perasa

Normal
5.Peraba
Normal
PERKEMIHANELIMINASIURI(B4:BLADDER)
MasalahKandungKemih
Tidakadamasalah
ProduksiUrine250ml/hariFrekuensi5.x/hari
Warnakuningpekat,BauamoniakLainlain....................................

PENCERNAANELIMINASIALVI(B5:BOWEL)
1.MulutdanTenggorokan
a.Mulut
SelaputLendirMulut
Lembab
b.Lidah
bersih
c.

KebersihanRonggaMulut

TidakBerbauGigiBersih
d.Tenggorokan:
tidakadasakitmenelan
e.Abdomen
Kenyal
Nyeritekan,tidakada
Benjolan,tidakada
f.

Pembesaranhepartidak

g.

PembesaranLientidak

h.

Asitestidak

i.Lainlain.............................
2.Masalahususbesardanrektum/anus
BAB1X/hari
Tidakadamasalah
OTOT,TULANGDANINTEGUMENT(B6:BONE)
1.OtotdanTulang
Kemampuanpergerakansendilengandantungkai(ROM)
Terbatas
Kemampuankekuatanotot
Fraktur
Tidak
Dislokasi

Tidak

Haemotom
Tidak
2.Integumen
WarnaKulit:sawomatangAkral:hangat
Turgor:TidakElastic

REPRODUKSI
Perempuan:
Payudara
BentukSimetris
Benjolantidak
Kelamin
Bentuknormal
Keputihantidak

ENDOKRIN
1.FaktorAlergi

Tidak

Manifestasi:tidakada
CaraMengatasi:tidakada
2.Kelainanendokrin:tidakada
PENGETAHUAN:
Pengetahuankliententangkesehatandirinya:klienmengetahuijikadirinyamempunyaipenyakitasma
biasanyaminumobatyangdianjurkandanjugaminumairhangatsaatterasanyeri

Sampit,25Maret2012
Mahasiswayangmengkaji,

.........................................
NIM.
ANALISADATA

NO

DATA

ETIOLOGI

PROBLEM

1.DS:Klienmengatakansayasesak
nafasbilacuacadingindanada
debu

kerusakan
membranealveoli

Gangguanpertukarangas
O2danCO2

DO:KlienNampaksesaknafas
disertaibatukkering
tidakadasputum
frekuensinafas28x/mnt
typepernafasankusmaul
terdengarbunyironchipada
apexparukiri/kanan

No.
1.

RENCANAKEPERAWATAN

Dx.
Tujuan
Intervensi
Rasional
Kep.
GangguanpertukaranO2 1.Kajidanmonitor
1.Sebagaiindicatoradanya
1
danCO2teratasi
frekuensinafas
gangguannafasdan
dengancriteria:
indicatordalamtindakan
Kilenmengatakan
selanjutnya
sesaknafasberkurang
atauhilang
2.Berkurangnyatekanan
Klientidakbatuklagi 2.Beriposisiyang
diafragmakeatassehingga
Frekuensinafasdalam
menyenangkansesuai
ekspresiparumaksimal
batasnormal(1618
dengankeinginanklien.
sehinggakliendapat
x/mnt)
(posisisemifowler)
bernafasdenganleluasa
3.Batukyangefektif
3.Ajarkanklienuntukbatuk merupakansalahsatucara
efektif
yangbaikdanefektifuntuk
mengeluarkansecret.
4.Menurunkanjumlah
konsumsiataukebutuhan
4.klkienuntukmembatasi
selamaperiodepenurunan
aktifitas
pernafasansehinggadapat
menurunkangejala
gangguanpertukarangasO2
danCO2.
5.Untukmempertahankan
sirkulasiO2danCO2

5.PertahankansirkulasiO2
dalamruangan

Dx.
Kep.

No.
1.1
.

Implementasi
1.Mengkajidanmonitorfrekuensinafas

Evaluasi
S:Klienmengatakansayamasih
seringsesaknafas

2.memberiposisiyangmenyenangkansesuai
dengankeinginanklien.(posisisemifowler)O:KlienNampaksesaknafasdisertai
3.mengajarkanklienuntukbatukefektif
batukkering
4.menganjurkanklienuntukmembatasi
aktifitas
5.mempertahankansirkulasiO2dalam
ruangan

tidakadasputum
frekuensinafas28x/mnt
typepernafasankusmaul
terdengarbunyironchipadaapex
parukiri/kanan

BABIII
PENUTUP
3.1KESIMPULAN
LansiamengalamipersoalankhusustentanggangguanO2danCO2,itutidakjauhdaripenyebab
penurunanfungsitubuhdanfactorusia.Kitatentunyamengetahuifungsitubuhsangatmemerlukan O2
danCO2yangdisurveymelaluisystemKardiovaskuler,apabiladalamsytemkardiovaskulertergganggu
tentuakanmengganggudalampertukarangasO2danCO2keberbagaijaringantubuh.Akhirakhirini
banyakmasalahyangterjadidikotakotabesardalammasalahkesehatanudara,terutamapolusiyang
semakinharisemakinmengkhawtirkankarenamerusakkesehatanterutamaterhadapmanula.

3.2SARAN
Perlu diingat dalam masalah kesehatan pernapasan dalam hal O2 dan CO2 sangat penting dijaga
karena2halinisangatpentingdandiperlukandalamsystemhidup.MakadariituKitaharusmenjagasejak
dini. Banyak cara agar kita hidup selalu sehat baik itu dengan gaya hidup yang tidak sehat perlu
ditinggalkan, konsumsi makanan dengan gizi yang seimbang, dan olahraga teratur. Semua yang kita
akukanpadamasamudaakankitapetiksaattua.

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

2.
MAR

31

ASUHAN KEPERAWATAN GERONTIK DENGAN MASALAH


PSIKOSOSIAL (kelompok6)
OLEH :
HENDRYANTO
IDA KUSUMADINATA
SYARIFAH NUR HASANAH. A

KATAPENGANTAR
PujisyukurkehadiratTuhan Yang MAhaEsa, atasberkat, rahmaddanhidayahNya,
sehinggakamidapatmenyelesaikanmakalahdenganjudulPsikologiPadaLansia
Dalampenyusunanmakalahini kami banyakmengalamiberbagaimasalah,
atasbantuandandukungandariberbagaipihak,makalahinidapatselesai.
Dalamkesempatanini kami banyakmengucapkanterimakasihkepadarekan
rekanmahasiswasertadosenAkperyangbanyakmembantudalampenyelesaianmakalahini.
Kami menyadaridalampenulisanmakalahinimasihjauhdarisempurna, olehkarenaitu
saran

dankritik

yang

sifatnyamembangunsangat

kami
harapkanuntukpenyempurnaanmakalahinidansemogabermanfaatbagikitasemua.

Sampit,maret2012
TimPenulis

DAFTARISI
KATA
PENGANTAR..........................................................................................................i
DAFTAR
ISI.......................................................................................................................ii
BABIPENDAHULUAN
1.1LATAR
BELAKANG..................................................................................1
1.2TUJUAN
PENULISAN.............................................................................1
1.3METODE
PENULISAN.............................................................................1
1.4SISTEMATIKA
PENULISAN.....................................................................1
BABIIPEMBAHASAN
2.1DEFINISI..................................................................................................
2.2ETIOLOGI.................................................................................................
2.3ASUHANKEPERAWATAN......................................................................
BABIIIPENUTUP
3.1KESIMPULAN.........................................................................................
DAFTARPUSTAKA

BABI
PENDAHULUAN
1.1.LATARBELAKANG
Penuaanadalahkonsekuensiyangtidakdapatdihindari.Walaupunprosespenuaan
benar adanya dan merupakan sesuatu yang normal, tetapi pada kenyataannya proses ini
menjadibebanbagioranglaindibadingkandenganproseslainyangterjadi.Perawatyang

akanmerawatlansiaharusmengertisesuatutentangaspekpenuaanyangnormaldantidak
normalsertamengetahuikonsepgangguanpsikologipadalansia.
1.2.TUJUANPENULISAN
Penulisan makalah bertujuan agar pembaca mengetahui dan memahami konsep
psikologi pada lansia.Untuk para perawat agar dapat mengaplikasikan pengetahuan yang
didapatkedalamprakteklapangan.
1.3.METODEPENULISAN
Dalampenulisanmakalahinikamimenggunakanmetodekepustakaan.
1.4.SISTEMATIKAPENULISAN
Sistematikapenulisanyaitu:BABIPENDAHULUAN,BABIIPEMBAHASAN,
BABIIIPENUTUP.

BABII
PEMBAHASAN

2.1.PENGERTIAN
Prosesmenua(lansia)adalahprosesalamiyangdisertaiadanyapenurunankondisi
fisik, psikologis maupun sosial yang saling ber interaksi satu sama lain. Keadaan itu
cenderungberpotensimenimbulkanmasalahkesehatansecaraumummaupunkesehatanjiwa
secarakhususpadalansia.
Masalahkesehatanjiwalansiatermasukjugadalammasalahkesehatanyangdibahas
padapasienpasienGeriatridanPsikogeriatriyangmerupakanbagiandariGerontologi,yaitu
ilmuyangmempelajarisegalaaspekdanmasalahlansia,meliputiaspekfisiologis,psikologis,
sosial,kultural,ekonomidanlainlain(Depkes.RI,1992:6)
Sementara Psikogeriatri adalah cabang ilmu kedokteran jiwa yang mempelajari
masalahkesehatanjiwapadalansiayangmenyangkutaspekpromotof,preventif,kuratifdan
rehabilitatifsertapsikososialyangmenyertaikehidupanlansia.
PsikologiLansia
Ada4ciriyangdapatdikategorikansebagaipasienGeriatridanPsikogeriatri,yaitu:
1.Keterbatasanfungsitubuhyangberhubungandenganmakinmeningkatnyausia.
2.Adanyaakumulasidaripenyakitpenyakitdegeneratif
3.Lanjutusiasecarapsikososialyangdinyatakankrisisbila:a)Ketergantunganpadaorang
lain(sangatmemerlukanpelayananoranglain),b)Mengisolasidiriataumenarikdiridari
kegiatan kemasyarakatan karena berbagai sebab, diantaranya setelah menajalani masa
pensiun,setelahsakitcukupberatdanlama,setelahkematianpasanganhidupdanlainlain.
4.Halhal yang dapat menimbulkan gangguan keseimbangan (homeostasis) sehingga
membawa lansia kearah kerusakan / kemerosotan (deteriorisasi) yang progresif terutama
aspek psikologis yang mendadak, misalnya bingung, panik, depresif, apatis dsb. Hal itu
biasanya bersumber dari munculnya stressor psikososial yang paling berat, misalnya

kematian pasangan hidup, kematian sanak keluarga dekat, terpaksa berurusan dengan
penegakhukum,atautraumapsikis.
ASPEKASPEKPSIKOLOGISPADAPENUAAN
Aspekpsikologis pada lansia tidak dapat langsung tampak.Pengertian yang salah tentang
lansiaadalahbahwamerekamempunyaikemampuanmemorydankecerdasanmentalyang
kurang.Berikutaspekpsikologispadapenuaan:
A.Kepribadian,intelegensidansikap
Tes intelegensi dengan jelas memperlihatkan adanya penurunan kecerdasan pada
lansia.Lansiaseringkalimempertahankansikapyangkuat,sehinggasikapnyalebihstabildan
sedikitsulituntukdiubah.
B.Teoriaktivitasdanpelepasan
Teoripelepasan:Lansiasecaraberangsurangsurmengurangiaktivitasnyadanbersama
menarikdiridarimasyarakat.
Teoriaktivitas:Sebagaiorangyangtelahberumur,merekameninggalkanbentukaktivitas
yangpasti,danmengkompensasidenganmelakukanbanyakaktivitasyangbaru.
PERUBAHANASPEKPSIKOSOSIAL
Padaumumnyasetelahorangmemasukilansiamakaiamengalamipenurunanfungsi
kognitif dan psikomotor. Fungsi kognitif meliputi proses belajar, persepsi, pemahaman,
pengertian,perhatiandanlainlainsehinggamenyebabkanreaksidanperilakulansiamenjadi
makinlambat.Sementarafungsipsikomotorik(konatif)meliputihalhalyangberhubungan
dengan dorongan kehendak seperti gerakan, tindakan, koordinasi, yang berakibat bahwa
lansiamenjadikurangcekatan.
Denganadanyapenurunankeduafungsitersebut,lansiajugamengalamiperubahan
aspekpsikososialyangberkaitandengankeadaankepribadianlansia.Beberapaperubahan
tersebutdapatdibedakanberdasarkan5tipekepribadianlansiasebagaiberikut:
1.TipeKepribadianKonstruktif(Constructionpersonalitiy),biasanyatipeinitidakbanyak
mengalamigejolak,tenangdanmantapsampaisangattua.
2.Tipe Kepribadian Mandiri (Independent personality), pada tipe ini ada kecenderungan
mengalamipostpowersindrome,apalagijikapadamasalansiatidakdiisidengankegiatan
yangdapatmemberikanotonomipadadirinya.
3.Tipe Kepribadian Tergantung (Dependent personalitiy), pada tipe ini biasanya sangat
dipengaruhi kehidupan keluarga, apabila kehidupan keluarga selalu harmonis maka pada
masa lansia tidak bergejolak, tetapijikapasangan hidupmeninggal makapasangan yang
ditinggalkanakanmenjadimerana,apalagijikatidaksegerabangkitdarikedukaannya.
4.TipeKepribadianBermusuhan(Hostilitypersonality),padatipeinisetelahmemasukilansia
tetapmerasatidakpuasdengankehidupannya,banyakkeinginanyangkadangkadangtidak
diperhitungkansecaraseksamasehinggamenyebabkankondisiekonominyamenjadimorat
marit.
5.TipeKepribadianKritikDiri(SelfHatepersonalitiy),padalansiatipeiniumumnyaterlihat
sengsara,karenaperilakunyasendirisulitdibantuoranglainataucenderungmembuatsusah
dirinya.
PERUBAHANDALAMPERANSOSIALDIMASYARAKAT
Akibat berkurangnya fungsi indera pendengaran, penglihatan, gerak fisik dan
sebagainyamakamunculgangguanfungsionalataubahkankecacatanpadalansia.Misalnya
badannya menjadi bungkuk, pendengaran sangat berkurang, penglihatan kabur dan
sebagainya sehingga sering menimbulkan keterasingan.Hal itu sebaiknya dicegah dengan
selalumengajakmerekamelakukanaktivitas,selamayangbersangkutanmasihsanggup,agar

tidak merasa terasing atau diasingkan. Karena jika keterasingan terjadi akan semakin
menolakuntukberkomunikasidenganoranglaindankdangkadangterusmunculperilaku
regresisepertimudahmenangis,mengurungdiri,mengumpulkanbarangbarangtakberguna
sertamerengekrengekdanmenangisbilaketemuoranglainsehinggaperilakunyaseperti
anakkecil.
Dalam menghadapi berbagai permasalahan di atas pada umumnya lansia yang
memilikikeluargabagiorangorangkita(budayaketimuran)masihsangatberuntungkarena
anggota keluarga seperti anak, cucu, cicit, sanak saudara bahkan kerabat umumnya ikut
membantumemelihara(care)denganpenuhkesabarandanpengorbanan.Namunbagimereka
yangtidakpunyakeluargaatausanaksaudarakarenahidupmembujang,ataupunyapasangan
hidup namun tidak punya anak dan pasangannya sudah meninggal, apalagi hidup dalam
perantauansendiri,seringkalimenjaditerlantar.
KEPERAWATANGERONTIKGERIATRINURSING
Geriatrinursingadalahspesialiskeperawatanlanjutusiayangdapatmenjalankanperannya
padatiapperananpelayanandenganmenggunakanpengetahuan,keahlian,danketerampilan
merawatuntukmeningkatkanfungsioptimallanjutusiasecarakomprehensif.Karenaitu,
perawatanlansiayangmenderitapenyakitdandirawatdiRSmerupakanbagiandarigerontic
nursing.
PENDEKATANPERAWATANLANJUTUSIA
A.Pendekatanfisik
Perawatanfisiksecaraumumbagiklienlanjutusiaada2bagianyaitu:
Klienlanjutusiayangmasihaktif,yangmasihmampubergeraktanpabantuanoranglain.
Klienlanjutusiayangpasifatautidakdapatbangunyangmengalamikelumpuhanatau
sakit.
B.Pendekatanpsikis
Perawatanmempunyaiperananyangpanjanguntukmengadakanpendekatanedukatifpada
klien lanjut usia, perawat dapat berperan sebagai supporter, interpreter terhadap segala
sesuatuyangasing,sebagaipenampungrahasiapribadidansebagaisahabatyangakrab.
C.Pendekatansosial
Mengadakan diskusi, tukar pikiran, dan bercerita merupakan upaya perawatan dalam
pendekatansosial.Memberikesempatanberkumpulbersamadengansesamaklienlanjutusia
untukmenciptakansosialisasimereka.
D.Pendekatanspiritual
Perawatharusbisamemberikanketenangandankepuasanbatindalamhubungannyadengan
tuhanatauagamayangdianutnya,terutamajikakliendalamkeadaansakitataumendekati
kematian.
MASALAHKEPERAWATANPSIKOSOIALPADALANSIA:
Berdukadisfungsional,
Ketidakberdayaan,
Gangguanpolatidur,
Resikoterhadapcedera,
Perubahannutrisi,
Defisitperawatandiri,
Ansietas.
TUJUAN&TINDAKAN
Tujuan:mengajarkanklienuntukberseponsemosionalyangadaptif.

Tindakan:
Lingkunganaman,
Cegahterjadinyakecelakaan,
Hubungansalingpercayaperawatklien,
Doronguntukmengekspresikanpengalamanyangmenyakitkanuntukmengurangiintensitas
masalah,
Ubahpikirannegatifdanidentifikasiaspekpositif(kemampuan,keberhasilan),
Bantumengubahpersepsiyangsalah/negatifmenjadipositif,
Beripujian,
Libatkandalamkegiatandaninteraksisosial,
Meningkatkanstatuskesehatan:perawatandiri,istirahat,makan,minum.
BABIII
PENUTUP
A.KESIMPULAN
Prosesmenua(lansia)adalahprosesalamiyangdisertaiadanyapenurunankondisifisik,
psikologismaupunsosialyangsalingberinteraksisatusamalain.Keadaanitucenderung
berpotensi menimbulkan masalah kesehatan secara umum maupun kesehatan jiwa secara
khususpadalansia.
Aspekpsikologispadalansiatidakdapatlangsungtampak.Pengertianyangsalahtentang
lansiaadalahbahwamerekamempunyaikemampuanmemorydankecerdasanmentalyang
kurang.OlehkarenaituUntukparaperawatagardapatmengaplikasikanpengetahuanyang
didapatkedalamprakteklapangan.
DAFTARPUSTAKA
Carpenito, L. Diagnosa Keperawatan Aplikasi Pada Praktek Klinis, Edisi ke6, EGC,
Jakarta,2000.
Nugroho,Wahjudi.KeperawatanGerontik,Edisike2,EGC,Jakarta2000.
Leeckenotte,AnneteGlesler.PengkajianGerontologi,Edisike2,EGC,Jakarta,1997.
Watson,Roger.PerawatanLansia,Edisike3,EGC,Jakarta2003
CONTOH ASKEP PSIKOSOSIAL PADA LANSIA
I. PENGKAJIAN
A. DATA BIOGRAFI
Nama
Jenis Kelamin

: Ny.R
: Perempuan

Golongan Darah
Tempat Tanggal Lahir

:: Pembuang,

Pendidikan Terakhir
Agama

: SD
: Islam

Status Perkawinan
TB/BB

: Janda
: 130 cm

Penampilan
Alamat

: Rapi, berjalan agak lambat sudah ada tanda kifosis


: Baamang, RT 2, RW 1

Orang yang mudah Dihub.


Alamat & telepon

: Juai
: 085752752487

A. Riwayat Keluarga
Genogram :

B. Riwayat Pekerjaan
Pekerjaan saat ini

: Tidak ada

Alamat pekerjaan
:Berapa Jarak Dari Rumah : Alat Transportasi
Pekerjaan Sebelumnya

:: Memantat

Berapa jarak dari rumah


Alat Transportasi

: 100 meter
: Tidak ada (jalan kaki)

Sumber-sumber pendapatan dan kecukupan terhadap kebutuhan:cukup untuk kebutuhan sehari-hari.


C. Riwayat Lingkungan Hidup
Type tempat tinggal : Permanen
Jenis Lantai : tanah, x tegel,
porselin,
Kondisi lantai :
Tangga Rumah :

licin, x lembab,

lainya. Sebutkan !papan

kering,

lainnya. Sebutkan !.............................

Tidak ada x
Ada : aman (ada pegangan),
tidak aman
Penerangan : x cukup,
kurang
Tempat Tidur : x aman, (pagar pembatas, tidak terlalu tinggi),
Alat dapur : x
WC :

berserakan,

tidak aman

tertata rapi,

Tidak ada
x Ada : x aman (posisi duduk, ada pegangan), tidak aman (lantai licin, tidak ada pegangan)
Kebersihan lingkungan :x bersih (tidak ada yang membahayakan),
tidak bersih dan tidak aman
(pecahan kaca, gelas, paku,dll.)
Jumlah orang yang tinggal dalam satu rumah :5 orang
Derajat Privasi
:Baik
Tetangga Terdekat :Suriansyah
Alamat dan Telpon :D. Riwayat Rekreasi
Hobbi/Minat
Keanggotaan dalam organisasi
Liburan/perjalanan

: Memasak
:PKK
:-

E. System Pendukung
Perawat/Bidan/dokter/fisiotherapi :Perawat dan bidan
Jarak dari rumah

:2 KM

Rumah Sakit
Klinik

: RSUD Dr. MURJANI Jaraknya 15 KM


:

Pelayanan kesehatan di rumah


Makanan yang dihantarkan

:Tidak ada
:Nasi, Sayur, dan Lauk.

Perawat sehari-hari yang dilakukan keluarga


Lain-lain
:F. Diskripsi Kekhususan
Kebiasaan ritual

:Menyediakan Makanan.

:Klien sudah tidak sholat lagi, karena sudah tua.

Yang lainnya

: Sering memberi sesajen di air.

G. Status Kesehatan
:Klien tidak pernah sakit yan serius yang harus diopname dirumah sakit, namun klien sering merasa pusing, dan
nyeri-nyeri di kakinya.
:P : Destruksi sendi, Q : menusuk-nusuk, R ; Kaki, S : 3 (Sedang) T : kadang-kadang.
Obat-obatan :

N
O

NAMA OBAT

DOSIS

KET

Alergi :
Obat-obatan
:Tidak Ada
Makanan
:Tidak Ada
Faktor Lingkungan
:Tidak Ada
Penyakit yang diderita : Reumatik
H. Aktifitas Hidup Sehari-hari

Indeks Katz :A
an elektrolit :RR = 18x/menit, dada simetris, tidak ada sianosis, minum air kopi dan air putih 600 cc/hari.
Nutrisi:Klien makan 3x/hari, sekali makan 1 sendok nasi.
Eliminasi:BAK 2x/hari, BAB 1x/hari
Aktifitas:klien dapat melakukan aktifitas sendiri tanpa bantuan, namun secara postur klien semestinya memakai
tongkat karena sudah ada tanda kifosis.
dan Tidur: Klien tidur malam selama 7 jam, tidur siang selama 1 jam.
Personal hygiene: Klien mandi 2x/hari.
Seksual: merasa sudah tidak ada lagi kepikiran masalah seksual karena merasa
sudah tidak memilliki pasangan lagi.

dirinya sudah tua dan

I. Psikologis, Kognitif dan perceptual


Konsep Diri
: Klien merasa kurang percaya diri apabila tidak ada keluarganya disampingnya.
Emosi
: Klien Tidak pernah menunjukan emosi yang berlebihan.

Adaptasi
: Klien sangat akrab dengan penghuni rumah dan tetangganya, namun agak
malu-malu dengan penulis.
Mekanisme pertahanan diri : Bila ada masalah klien selalu mengutarakan masalahnya kepada
anak dan cucunya.
Status Mental:
Tingkat Kesadaran:kompos mentis
Afasia: Tidak ada, klien dapat dengan jelas berbicara
Dimentia
:xya,
tidak
Orientasi
: x normal,
bingung,
tidak ada respon
Bicara
: x normal,
gagap,
afasia,
Blocking
Bahasa yang digunakan : Banjar
Kemampuan membaca : x bisa,
tidak
Kemampuan interaksi : x sesuai,
tidak. Sebutkan!
Pendengaran
: x normal,
terganggu kanan/kiri,
alat bantu pendengaran

Penglihatan
: xnormal,
kacamata,
lensa kontak,
terganggu kanan/kiri,
kanan/kiri,
kabur kanan/kiri, lainnya. Sebutkan!
Vertigo
:
ya,
tidak
Short Portable Mental Status Quenstionare
:
Mini-Mental State Exam (MMSE)
:Gangguan Intelektual Ringgan
Inventaris Depresi Beck
:Kemungkinan Defresi

J. Pengkajian Fisik
1. Data Klinik
Keadaan umum
Tingkat Kesadaran
GCS
Tinggi Badan
Temperatur
Tekanan Darah

:
: Baik,
:CM
:M = 4, V = 5, P = 6, (15)
:130cm
6
:36 cNadi
6
: 80x/menit.
:120/90mmHg

2. Pernapasan dan sirkulasi :


Frekuensi napas
:18x/menit
Kualitas
: : normal,
Batuk
:
ya,
Auskultasi
:

Lobus kanan atas


:
normal,

Lobus kiri atas


:
normal,

Lobus kanan bawah :


normal,

Lobus kiri bawah


:
normal,

Berat badan : 36 Kg.

dangkal,
cepat
tidak, Jelaskan, kadang-kadang
pucat,
pucat,
pucat,
pucat,

menurun,
menurun,
menurun,
menurun,

tidak ada,
tidak ada,
tidak ada,
tidak ada,

suara tidak normal


suara tidak normal
suara tidak normal
suara tidak normal

3. Metabolik Integumen
Kulit :
Warna :
normal,
pucat,
cianosis,
kunin,
lainnya! Bintik-bintik hitam
Turgor :
norma,
menurun
Lecet: tidak,
ya !sebutkan.................
Bengkak: tidak,
ya !sebutkan.............
Bercak: tidak,
ya !sebutkan................
Mulut
Gusi : normal,
putih,
lecet,
lainnya................
Gigi :
normal, lainya! Sebutkan beberapa ada.
Skore Norton : jelas, 19 (kecil sekali/tidak terjadi)

buta

4. Persarafan Sensori
Pupil : sama,
tidak sama, sebutkan, disebelah kanan ada selaput putih
Reaksi terhadap cahaya

Kiri : ya,
tidak

Kanan : ya
tidak
Mata :
jelas,
berair, kabur,
lainnya. Sebutkan.....................

5. Muskuloskeletal
Range of motion
: penuh,
tidak.sebutkan..............
Keseimbangan
: Stabil,
tidak stabil.sebutkan..............
Menggenggam
Kanan
: Kuat,
Lemah
Kiri
:
Kuat,
Lemah
Kekuatan otot kaki
:
Kanan : Kuat,
lemah
Kiri :
Kuat,
lemah
K. Pengetahuan
Pengetahuan klien tentang kesehatan dirinya:
Klien mengatakan jarang sakit. Hanya sewaktu-waktu nyeri di kaki dan pusing

ANALISA DATA
NO. DATA

ETIOLOGI

PROBLEM

1.

Social ekonomi

ansietas

DS : saya cemas dg anak-anak


saya yang masih belum kerja dan
berkeluarga
DO : - anak ke- 3 dan ke-4 belum
bekerja dan berkeluarga
Klien sering termenung
Susah tidur krg lbih sehari Cuma 5
jam
Nafsu makan menurun
Kebutuhan sehari-hari terpenuhi
dg cukup

Diagnosakeperawatan:
Ansietas berhubungan dengan social ekonomi
Ditandai dengan:
DS : saya cemas dg anak-anak saya yang masih belum kerja dan berkeluarga

DO : - anak ke- 3 dan ke-4 belum bekerja dan berkeluarga


Klien sering termenung
Susah tidur krg lbih sehari Cuma 5 jam
Nafsu makan menurun
Kebutuhan sehari-hari terpenuhi dg cukup
RENCANA KEPERAWATAN

Dx.
Kep.

No.
1.

Tujuan

Intervensi

Rasional

Selama dilakukan
1.
tindakan keperawatan 2.
diharapkan cemas klien
teratasi dengan kriteria3.
hasil:
Menunjukan ekspresi 4.
tenang
Waktu tidur trpenuhi
5.
Nafsu makan
meningkat

Kaji tingkat cemas klien 1.respon ndividu dapat


Catat pembatasan focus
bervariasi tergantung pada
pikiran
pola kultural yang
Observasi pola bicara klien dipelajari.Persepsi yang
apakah cepat atau lambat
menyimpang dari situasi
Diskusikan dengan klien
mungkin dapat
tentang apa yang
memperbesar perasaan.
dicemaskan oleh klien
2.Penyempitan focus
Tanyakan mekanisme
umumnya merefleksikan
koping yang digunakan
rasa takut
oleh klien jika sedang
3.Menyediakan petunjuk
cemas
lengenai factor-faktor
6. Pertahankan kontak sering seperti tingkat
dengan klien untuk
ansietas,kemampuan untuk
mendengarkan klien
memahami tingkat
bercerita
kerusakan otak ataupun
perbedaan bahasa
4.pasien mungkin perlu
menolak realitas sampai
siap untuk menghadapinya
5.Mungkin dapat menghadapi
situasi dg baik pada waktu
itu
6.Untuk memantapkan
hubungan & meningkatkan
ekspresi perasaan

IMPLEMENTASI

Dx.
Kep.

No.
1. 1
.

Implementasi
1. Mengaji tingkat cemas klien
2. Mencatat pembatasan focus pikiran

Evaluasi
S : Makasih sudah mau
mendengarkan cerita saya

3. Mengobservasi pola bicara klien apakah cepat


atau lambat
4. Mendiskusikan dengan klien tentang apa yang
dicemaskan oleh klien
5. Menanyakan mekanisme koping yang
digunakan oleh klien jika sedang cemas
6. Mempertahankan kontak sering dengan klien
untuk mendengarkan klien bercerita

O: - klien tampak senang bercerita


masalahnya
Klien tersenyum
Klien mempunyai teman cerita
yaitu Cucunya
A: masalah teratasi sebagian

P: lanjutkan intervensi
1. Kaji tingkat cemas klien
2. Catat pembatasan focus pikiran
3. Observasi pola bicara klien apakah
cepat atau lambat
4. Diskusikan dengan klien tentang
apa yang dicemaskan oleh klien
5. Tanyakan mekanisme koping yang
digunakan oleh klien jika sedang
cemas
6. Pertahankan kontak sering dengan
klien untuk mendengarkan klien
bercerita

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

3.
MAR

31

MAKALAH KEPERAWATAN GERONTIK PERSONAL HYGIENE


PADA LANSIA (kelompok 10)
MAKALAH

KEPERAWATAN GERONTIK

PERSONAL HYGIENE PADA LANSIA

KELOMPOK 10:

Eny Novianti
Harianto
Melinda Lestari

AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTA WARINGIN TIMUR
JL. BATU BERLIAN NO.II TELP. (0531) 22960
2012

BAB II
PEMBAHASAN

KONSEP DASAR PERSONAL HYGIENE


Dalam kehidupan sehari-hari kebersihan merupakan hal yang sangat penting dan harus
diperhatikan karena kebersihan akan mempengaruhi kesehatan dan psikis seseorang. Kebersihan itu
sendiri dangat dipengaruhi oleh nilai individu dan kebiasaan. Hal-hal yang sangat berpengaruh itu di
antaranya kebudayaan, sosial, keluarga, pendidikan, persepsi seseorang terhadap kesehatan, serta
tingkat perkembangan.
Pengertian
Personal hygiene berasal dari bahasa Yunani yaitu personal yang artinya perorangan dan
hygiene berarti sehat. Kebersihan seseoang adalah suatu tindakan untuk memelihara kebersihan dan
kesehatan seseoran untuk kesejahteraan fisik dan psikis (Tarwoto, 2004).
Kebersihan diri adalah upaya individu dalam memelihara kebersihan diri yang meliputi
kebersihan rambut, gigi dan mulut, mata, telinga, kuku, kulit, dan kebersihan dalam berpakaian dalam
meningkatkan kesehatan yang optimal (Effendy, 1997).
Klasifikasi
Menurut Tarwoto (2004), macam-macam personal hygiene antara lain:
1.
Perawatan kulit kepala dan rambut

2.

Perawatan mata

3.
4.
5.
6.
7.
8.
1.
2.
3.
4.
5.
6.

1.
2.
3.
4.
5.
6.

1.

2.

3.

4.

5.

Perawatan hidung
Perawatan telinga
Perawatan kuku kaki dan tangan
Perawatan genetalia
Perawatan kulit seruruh tubuh
Perawatan tubuh secara keseluruhan
Menurut Effendy (1997), jenis kebersihan diri antara lain:
Kebersihan rambut
Kebersihan gigi dan mulut
Kebersihan mata
Kebersihan telinga
Kebersihan kuku
Kebersihan kulit
Tujuan
Meningkatkan derajat kesehatan seseorang
Memelihara kebersihan diri seseorang
Memperbaiki personal hyiene yang kurang
Mencagah penyakit
Meningkatkan rasa percaya diri
Menciptakan keindahan
Faktor factor yang dapat mempengaruhi
Citra tubuh
Gambaran individu terhadap dirinya sangat mempengaruhi kebersihan diri. Misalnya, karena adanya
perubahan fisik sehingga individu tidak peduli terhadap kebersihannya.
Praktik sosial
Pada anak-anak selalu dimanja dalam kebersihan diri, maka kemungkinan akan terjadi perubahan
pola Personal Hygiene.
Status sosioekonomi
Personal Hygiene memerlukan alat dan bahan seperti sabun, pasta gigi, sikat gigi, sampo, alat mandi
yang semuanya memerlukan uang untuk menyediakannya.
Pengetahuan
Pengetahuan Personal Hygiene sangat penting karena pengetahuan yang baik dapat meningkatkan
kesehatan. Misalnya pada pasien penderita DM ia harus menjaga kebersihan kakinya.
Budaya
Di sebagian masyarakat jika individu sakit tertentu maka tidak boleh dimandikan.

6.

Kebiasaan seseorang
Ada kebiasaan seseorang yang menggunakan produk tertentu dalam perawatan dirinya seperti
penggunaan sabun, sampo, dan lain-lain.
7. Kondisi fisik
Pada keadaan sakit tertentu kemampuan untuk merawat diri berkurang dan perlu bantuan untuk
melakukannya.
Dampank yang sering timbul

1.

Dampak Fisik

Banyak gangguan kesehatan yang diderita seseorang karena tidak terpeliharanya kebersihan
perorangan dengan baik. Gangguan fisik yang sering terjadi adalah gangguan integritas kulit,
gangguan membrane mukosa mulut, infeksi pada mata dan telinga, dan gangguan fisik pada kuku.
2. Dampak Psikososial
Masalah social yang berhubungan dengan Personal Hygiene adalah gangguan kebutuhan rasa
nyaman, kebutuhan dicintai dan mencintai, kebutuhan harga diri, aktualisasi diri dan gangguan
interaksi sosial.
B. PERSONAL HYGIENE Pada lansia
Memenuhi kebutuhan kebersihan diri pada lansia adalah suatu tindakan perawatan sehari
hari yang harus diberikan kepada klien lanjut usia terutama yang berhubungna dengan kebershan
perorangan (Personal Hygiene), yaitu antara lain kebersihan mulut dan gigi, kebersihan kulit dan
badan, kebersihan kepala, rambut dan kuku, serta kebersihan tempat tidur dan posisi tidur (Nugror,
1995).
Perawatan secara umum bagi lansia terbagi 2, yaitu:
1. Mereka yang masih aktif
Dimana keadaan fisiknya mampu bergerak tanpa bantuan orang lain sehingga kebutuhan sehari
hari dapat terenuhi.
2. Mereka yang pasif
Mereka yang keadaan fisiknya memerlukan pertolongan orang lain, seperti sakit atau lumpuh.

1.

2.

3.

4.

5.

6.

Bagi mereka yang masih aktif, hal hal yang perlu di perhatikan antara lain:
Mandi
Mandi agar dibatasi karena kulit lansia biasanya mengering. Hal ini disebabkan kelenjar kulit yang
mengeluarkan lemak mulai kurang bekerja. Maka sehabis mandi kulit lansia sebaiknya diolesi baby oil
terutama di lengan, siku, ketiak, paha, dan sebagainya.
Kebersihan mulut
Kenersihan mulut adalah sangat penting. Perlu diingat atau dibantu para lansia untuk menyikat gigi
yang hanya tinggal beberapa buah. Gigi palsu perlu mendapat perhatian khusus, dibersihkan dengan
sabun dan sikat. Untuk menghilangkan bau gigi palsu direndam dalam air hangat yang telah dibubuhi
obat pembersih mulut beberapa tetes selama 5 10 menit, setelah itu bilas sampai bersih dari sabun
dan bubuk pembersih mulut tersebut. Sebaiknya jangan mencuci gigi palsu di bawah air mengalir
untuk mencegah bahaya gigi palsu terjatuh dan pecah.
Perawatan rambut
Lanjut usia terutama wanita kadang kadang mengalami kesulitan dalam mencuci rambut sehingga
perlu mendapat bantuan perawat atau ank cucunya. Sama halnya dengan kulit, rambut orang lansia
juga kehilngan lemaknya sehingga sehabis keramas perlu diberi conditioner. Setelah selesai mencuci
rambut harus segera dikeringkan agar lansia tidak kedinginan.
Perawatan kuku
Kuku jari tangan dan kaki perlu mendapatkan perawatan, Menggunting kuku jangan terlalu pendek
dan jangan sampai terluka karena luka pada orang tua lebih sulit sembuh.
Pakaian
Pakaian hendaknya jangan terbuat dari bahan yang kasar. Dasar pakainan harus lunak, harus mudah
dikenakan dan dibersihkan. Pakaian lansia dijaga agar tetap rapi karena cenderung para lansia tidak
peduli lagi terhadap pakaiannya. Lansia lebih enak dengan piyama tipis jangan pakaian dari wool
karena bias terjadi iritasi.
Mata

Elastisitas lensa mata pada lansia berkurang akibatnya tulisan kecil terlihat kabur pada jarak normal,
sedangkan pada jarak jauh akan terlihat terang. Gejala yang tidak normal antara lain:
Penglihatan menjadi ganda
Bintik hitam atau ada daerah yang gelap
Sakit pada mata
Terlihat ada warna atau terang disekitar ujung ujung objek
Mata yang kemerahan
Tiba tiba kehilangan melihat dengan jelas
7. Lingkungan
Suasana lingkungan harus disesuaikan. Bila memungkinkan jagalah kelembapan ruang tidur atau
ruangan lainnya dirumah dengan memasang humidifier. Perubahan temperature secara tiba tiba
harus dihindarkan.

1.
2.
3.

Bagi mereka yang pasif


Bagi lansia yang terus beristirahat di tempat tidur, kebersihan di tempat tidur perlu tetap diperhatikan,
yaitu:
Diusahakan agar bantal tidak terlalu keras atau lembek
Latihan bangun dan tidur dengan usaha sendiri agar oto badan tetap aktif dan menghindarkan pegal
pegal serta atrofi otot
Letak tidur diatur antara lain:
Letak guling dibawah lutut
Berikan bantal angin yang berbentuk cincin untuk mencegah lecet pada tumit dan bokong
Letak tidur dimiringkan bergantian pada sisi kana atau kiri
Pada letak atau posisi setengah duduk, di bagian kepala tempat tidur diberi sandaran atau papah.

Ada beberapa faktor yang mempengaruhi personal hygiene pada lansia antara lain:
1. Faktor
Pengetahuan
Menurut Purwanto (1999) dalam Friedman (1998), domain kognitif berkaitan dengan pengetahuan
yang bersifat intelektual (cara berpikir, berabstraks, analisa, memecahkan masalah dan lain-lain).
Yang meliputi pengetahuan (knowledge), pemahaman (comperehension), penerapan (aplication),
analisa
(analysis),
sintesis
(synthesis)
dan
evaluasi
(evaluation).
Individu dengan pengetahuan tentang pentingnya kebersihan diri akan selalu menjaga kebersihan
dirinya untuk mencegah dari kondisi / keadaan sakit (Notoatmodjo, 1998).
2. Kondisi
Fisik
Lansia
dan
Psikis
Lansia
Semakin lanjut usia seseorang, maka akan mengalami kemunduran terutama di bidang kemampuan
fisik, yang dapat mengakibatkan penurunan peranan-peranan sosialnya. Hal ini mengakibatkan
timbulnya gangguan di dalam mencukupi kebutuhan hidupnya. Sehingga dapat meningkatkan
bantuan
orang
lain
(Nugroho,
2000).
Menurut Zainudin (2002) penurunan kondisi psikis pada lansia bisa disebabkan karena Demensia di
mana lansia mengalami kemunduran daya ingat dan hal ini dapat mempengaruhi ADL (Activity of
Daily Living yaitu kemampuan seseorang untuk mengurus dirinya sendiri), dimulai dari bangun tidur,
mandi berpakaian dan seterusnya.
3. Faktor
Ekonomi
Menurut Geismer dan La Sorte (1964) dalam Friedman (1998), besar pendapatan keluarga akan
mempengaruhi kemampuan keluarga untuk menyediakan fasilitas dan kebutuhan-kebutuhan yang
diperlukan untuk menunjang hidup dan kelangsungan hidup keluarga.
4. Faktor
Budaya
Kebudayaan dan nilai pribadi mempengaruhi kemampuan perawatan hygiene. Seorang dari latar

belakang kebudayaan berbeda memiliki praktik perawatan diri yang berbeda. Keyakinan yang didasari
kultur sering menentukan definisi tentang kesehatan dan perawatan diri (Potter dan Ferry, 2005).
5. Faktor
Lingkungan
Lingkungan mencakup semua faktor fisik dan psikososial yang mempengaruhi atau berakibat
terhadap kehidupan dan kelangsungan hidup lingkungan berpengaruh terhadap kemampuan untuk
meningkatkan dan mempertahankan status fungsional, dan meningkatkan kesejahteraan (Potter dan
Ferry, 2005).
6. Faktor
Citra
Tubuh
Citra tubuh merupakan konsep subjektif seseorang tentang penampilan fisiknya. Personal hygiene
yang baik akan mempengaruhi terhadap peningkatan citra tubuh individu (Stuart & Sundeen, 1999
dalam Setiadi 2005).
7. Faktor
Peran
Keluarga
Keluarga secara kuat mempengaruhi perilaku sehat setiap anggotanya begitu juga status kesehatan
dari setiap individu mempengaruhi bagaimana fungsi unit keluarga dan kemampuan untuk mencapai
tujuan. Pada saat kepuasan keluarga terpenuhi tujuannya melalui fungsi yang adekuat, anggota
keluarga tersebut cenderung untuk merasa positif mengenai diri mereka sendiri dan keluarga mereka
(Potter dan Ferry, 2005).
C. DIAGNOSA DAN INTERVENSI KEPERAWATAN
1. Kurang perawatan diri, makan berhubungan degan penurunan kemampuan visual dan motorik,
keleamahan otot
Intervensi :
Pastikan dari klien atau anggota keluarga makanan apa yang disukai atau tidak disukai klien.
Ciptakan lingkungan nyaman untuk makan yang tidak memgganggu
Pertahankan suhu makanan yang konstan ( makanan panas, dingin)
Berikan teknik pengurangan nyeri, sejak nyeri mempengaruhi nafsu makan dan kemampuan untuk
makan sendiri
Berikan kebersihan oral sebelum dan sesudah makan
Dorong klien untuk menggunakan gigi palsu dan kacamata
Tempatkan klien dalam posisi paling normal yang sesuai dengan ketidakmampuan fisiknya (terbaik
dalam posisi duduk di kursi dengan meja)
Berikan kontak sosial selama makan
Untuk kekurang-kurangan yang nampak
- Pilih tempat makan dengan warna yang berbeda untuk membantu memmbedakan artikel (misal baki
merah, piring putih )
- Pastikan pola makan yang biasanya dari individu dan berikan artikel makan sesuai dengan yang
disukai (atau atur artikel makan dalam pola makan yang menyerupai jam); catat pada rencana
pengaturan perawatan yang digunakan (misal, daging jam 6, kentang jam 9, sayur - sayur jam 12)
- Dorong makan dengan menggunakan tangan ( missal, makan - makanan roti, daging, buah, hot dog)
untuk meningkatkan kemandirian
Untuk meningkatkan jumlah maksimum kemandirian, berikan alat bantu adaptif yang diperlukan
- Perlindungan piringu ntuk menghindari terdorongnya makanan keluar dari piring
- Alat bantu hisap dibawah piring atau mangkok untuk menstabilkan
- Ganggang bantalan pada alat makanan untuk meamanan memegang
- Belatan pergelangan atau tangan dengan klem untuk memegang alat makan
- Cangkir minuman khusus
- Pisau atau alat pemotong

Bantu dengan pengadaan jika dibutuhkan: alat pembuka, serbet, sediaan bumbu, alat pemotong
daging, roti, mentega
Untuk klien dengan kekurangan kognitif
Berikan lingkungan tenang terisolasi sampai klien dapat untuk makan dan tidak mudah mengalihkan
perhatian dari tugas
Orientasikan individu atau klien terhadap lokasi dan tujuan dari perlengkapan untuk makan
Tempatkan individu atau klien pada posisi paling normal untuk makan, secara fisik klien dapat makan
Dorong individu atau klien untuk menjalani tugas, tetapi waspada terhadap kelemahan, frustasi, atau
agitasi

Untuk individu atau klien yang sangat ketakutan akan keracunan


- Biarkan klien untuk membuka makanan kaleng
- Makan satu potong roti dulu
- Pastikan mendapatkan gaya makanan keluarga
Kaji untuk meyakinkan bahwa individu dan keluarga memahami alasan dan tujuan seluruh intervensi
2. Kurang perawatan diri, mandi / hygiene berhubungan dengan penurunan kemampuan visual dan
motorik, kelemahan otot
Intervensi :
Dorong individu untuk menggunakan lensa koretif yang diresepkan atau alat bantu pendengaran
Pertahankan kehangatan suhu kamar mandi, pastikan suhu air yang disukai klien
Berikan privasi selama mandi rutin
Berikan seluruh perlengkapan mandi dalam batas yang mudah dicapai
Berikan keamanan dalam kamar mandi (lantai tidak licin, batang pegangan)
Jika klien secara fisik mampu, dorong penggunaan bak mandi atau pancuran, tergantung pada
fasilitas yang ada dirumah (klien harus latihan di RS dalam persiapan pulang ke rumah)
Berikan peralatan adaptif jika dibutuhkan
- Kursi atau tempat duduk tidak ada sandaran sewaktu mandi dengan bak mandi atau pancuran
- Pemegang spon yang panjang untuk mencapai punggung atau ekstremitas bawah
- Tempat pegangan pada dinding kamar mandi jika dibutuhkan untuk mobilisasi
- Papan mandi untuk pindah kekursi
- Alas atau keset kaki yang tidak licin pada lantai kamar mandi, bak mandi atau pancuran
- Sarung tangan pencuci dengan kantong untuk sabun
- Sikat gigi yang sudah teradaptasi
- Alat pencukur
- Pemegang semprotan pancuran
Untuk individu dengan kemunduran kognitif:
- Berikan waktu konsisten untuk mandi rutin sebagai bagian dari suatu program struktur untuk
membantu menurukan ansietas
- Pertahankan intruksi sederhana dan hindari pengalihan, orientasi tujuan adanya perlengkapan mandi
- Jika klien tidak dapat untuk memandiakan keseluruhan tubuh, biarkan klien memandikan satu bagian
tubuhnya sampai dikerjakan dengan benar, berikan umpan balik positif terhadap keberhasilan
- Aktivitas pengawasan dilakukan samapi klien dapat dengan aman melaksanakan tugas yang tidak
dibantu
- Dorong perhatian terhadap tugas, tetapi waspada terhadap kelelahan yang dapat meningkatkan
ansietas

Pastikan fasilitas mandi di rumah tersedia dan bantu dalam menentukkan jika ada berbagai
kebutuhan beradaptasi, rujuk keterapi ekupasi atau pelayanaan sosial untuk membantu dalam
mendapatkan pelengkapan yang dibutuhkan

3. Kurang perawatan diri berpakaian atau berdandan berhubungan dengan penurunan kemampuan
visual dan motorik, kelemahan otot
Intervensi :
Dorong individu untuk menggunakan lensa korektif yang diresepkan atau alat bantu pendengaran
Tingkatkan kemandirian dalam mengenakan pakaian melalui latihan ters menerus dan tidak dibantu
Pilih pakaian yang tidak sempit, dengan lengan baju besar dan celana pendek serta bukan bagian
depan
Sediakan waktu yang cukup untuk mengenakan pakaian dan melepaskan pakaian, sejak tugas dapat
melemahkan, membuat nyeri atau mengalami kerusakan
Renacanakan individu untuk belajar dan mendemonsrtasikan satu bagian dari aktivitas sebelum
berkembang lebih lanjut
Susun pakaian dalam urutan dimana mereka menggunakannya
Berikan bantuan dalam mengenakan pakaian jika di perlukan (umumnya beberapa bantuan yang
digunakan termasuk gantungan pakaian, penarik ritsleting, kancing, sendok sepatu yang panjang,
pengikat sepatu yang elastis
Dorong individu atau klien untuk menggunakan pakaian atau luar biasa daripada pakaian malam
Berikan privasi selama menggunakan pakaian rutin
Untuk individual dengan kemunduran kognitif
- Tentukan suatu waktu rutin yang konsisten dalam mengenakan pakaian untuk memberikan suatau
program terstruktr untuk menurunkan ansietas
- Pertahankan instruktsi sederhana dan ulangi instruksi tersebut dengan sering, hindari pengalihan
- Perkenalkan satu aksesoris pakaian pada suatu waktu
- Dorong perhatian terhadap tugas, waspada terhadp kelelahan dimana dapat meningkatkan ansietas
Kaji pemahaman dan pengetahuan individu serta keluarga terhadap instruksi dan rasional diatas
FORMAT PENGKAJIAN INDIVIDU
ASUHAN KEPERAWATAN GERONTIK
Tanggal pengkajian : 28 Maret 2012
Jam 08.00 WIB
A. DATA BIOGRAFI
Nama
TTL
Jenis kelamin
Golongan darah
Pendidikan
Agama
Status perkawinan
TB / BB
Penampilan
Ciri ciri tubuh
Alamat

: Ny. H
: Sampit, 10 November 1942
: Perempuan
: O
: : Islam
: Kawin / Janda
: 151 cm / 51 kg
: Tampak tidak rapi dan tidak terawat
: Rambut beruban, kulit keriput, badan agak bungkuk.
: Kel. Baamang
RT / RW : 07 / 03
Kec. Baamang Tengah
Telp / Hp : Kabupaten / Kotamadya : Kotawaringin Timur

Orang yang dekat


Hubungan
Alamat / Telpon

: Ny. E
: Anak kandung
: Baamang Tengah

B. RIWAYAT KEPERAWATAN
1. Genogram

Keterangan :
keturunan

Pasien

Perempuan

Laki laki

Garis

Tinggal serumah
Garis

hubungan

Meninggal

2. Riwayat Keluarga
Klien anak ke 3 dari 4 bersaudara
Klien seorang janda dan mempunyai 6 orang anak
Klien tinggal bersama 1 orang anaknya
C. RIWAYAT PEKERJAAN
Pekerjaan saat ini
: Alamat pekerjaan
: Jarak dari rumah
: Alat transportasi
: Pekerjaan sebelumnya
: Jarak dari rumah
: Alat transportasi
: Sumber sumber pendapatan & kecukupan terhadap kebutuhan : Klien mendapat uang bulanan
dari anak - anaknya
D. RIWAYAT LINGKUNGAN HIDUP
Tipe tempat tinggal
: Permanen (rumah pribadi)
Jenis lantai rumah
: Papan

Kondisi lantai
: Kering
Tangga rumah
: Tidak ada
Penerangan
: Cukup
Tempat tidur
: Aman, tidak tinggi
Alat dapur
: Rapi
WC
: Aman, lantai tidak licin
Kebersihan lingkungan
: Cukup baik
Jumlah orang yang tinggal dalam satu rumah : 2 orang
Derajat privasi
: Cukup terjaga
Tetangga terdekat
: Ny. M
Alamat / Telpon
: Baamang Tengah
E. RIWAYAT REKREASI
Hobbi / Minat
Keanggotaan organisasi
Liburan / Perjalanan

: Berkebun
: : Keluar kota (mengunjungi anak)

F. SISTEM PENDUKUNG
Perawat / Bidan / Dokter / Fisioterapi
Jarak dari rumah
Rumah Sakit
Klinik
Pelayanan kesehatan di rumah
Makanan yang dihantarkan
Perawatan sehari hari yang dilakukan keluarga
Lain lain

: L (perawat)
: 1 km
: RSUD DR. MURJANI / 3 km
: PKM BMG I / 1,5 km
: : : : -

G. DISKRIPSI KEKHUSUSAN
Kebiasaan ritual
: Klien beragama Islam, melaksanakan solat 5 waktu.
Yang lainnya
: H. STATUS KESEHATAN
Status kesehatan umum selama setahun yang lalu

: Klien sering merasa lemah dan cepat lelah jika


beraktifitas banyak.
Status kesehatan umum selama 5 tahun yang lalu : Klien tidak ada menderita penyakit berat.
Paling hanya
sakit kepala, demam, batuk, atau flu
biasa.
Keluhan Utama
1. Provocative / Paliative
: 2. Quality / Quantity
: 3. Region
: 4. Severity Scale
: 5. Timing
: Pemahaman & penatalaksanaan masalah kesehatan
: Jika sakit klien biasa membeli obat di
warung
Obat obatan
-

Alergi (Catatan agent dan reaksi spesifik)


Obat obatan
: Makanan
: Faktor lingkungan
: Penyakit yang diderita
I.

AKTIVTAS HIDUP SEHARI HARI (ADL)


Indeks KATZ
: A
Oksigenasi
: Baik, tidak ada alat bantu
Cairan & Elektrolit
: Minum 6 gelas / hari, 250 ml / gelas
Nutrisi
: Nafsu makan baik, makan 3x/hari
Eliminasi
: Lancar, tidak ada gangguan
Aktivitas
: Mandiri namun terbatas karena klien merasa lemah dan cepat lelah
Istirahat & Tidur
: Tidur siang 1 jam, tidur malam 7 jam
Personal Hygiene
: Kurang baik, tampak tidak rapi, dan tidak terawat
Seksual
: Tidak ada keinginan untuk berhubungan lagi karena merasa sudah
tua
Rekreasi
: Mengunjungi anak di luar kota

J.

PSIKOLOGI, KOGNITIF, DAN PERSEPTUAL


Konsep diri
: Baik
Emosi
: Stabil
Adaptasi
: Baik
Mekanisme pertahanan diri
: Baik
Status mental
: Baik
Tingkat kesadaran
: Composmentis
Afasia
: Tidak ada
Dimensia
: Tidak ada
Orientasi
: Normal
Bicara
: Normal
Bahasa yang digunakan
: Banjar
Kemampuan membaca
: Kurang / terbatas
Kemampuan interaksi
: Baik
Vertigo
: Tidak ada
Short Portable Mental Status Questionaire (SPMSQ)
Mini-Mental State Exam (MMSE)
Geriatrik Depression Scale
APGAR

K. TINJAUAN SISTEM
Keadaan umum
Tingkat kesadaran
Tanda tanda vital

: Baik
: Composmentis
: TD 130 / 80 mmHg
N 72 x/m
RR 20 x/m
S 36,4

: 6 (Kerusakan Intelektual Sedang)


: 6 (Gangguan Intelektual Sedang)
: Skor 4
: 6 (Sedang)

TB 151 kg
BB 51 kg

PENGKAJIAN PERSISTEM
PERNAFASAN (B1: BREATHING)
1. Bentuk Dada
2. Sekresi dan Batuk
3. Pola Nafas
a. Frekuensi nafas
4. Bunyi Nafas
b. Normal
c. Abnormal
d. Resonen lokal
5. Pergerakan dada
6. Tractil Fremitus/Fremitus Lokal
7. Alat Bantu Pernafasan

:
:
:
:
:
:

CARDIOVASCULAR (B2: BLEEDING)


1. Nadi
Frekuensi
2. Bunyi jantung
3. Letak jantung
4. Pembesaran jantung
5. Nyeri dada
6. Edema
7. Clubbing finger
PERSARAFAN (B3: BRAIN)
Tingkat Kesadaran: Composmentis
1. GCS
Eye: 4
Verbal: 5
Total GCS: 14
2. Refleks
3. Koordinasi gerak
4. Kejang
5. Lain-lain

1.
a.
b.
c.
d.
e.
f.
g.
2.
a.
b.
3.

Simetris
Tidak Ada

20x/m dan teratur


Vesikuler di semua lapang paru
: Simetris
: : -

72x/m dan reguler


Normal
Normal
: Tidak
: Tidak
: Tidak
: Tidak
:
:

Motorik: 6
:

Normal
Ya
: Tidak
: -

PENGINDERAAN (PERSEPSI SENSORI)


Mata (Penglihatan)
Bentuk
: Normal
Visus
: Pupil
: Isokor
Gerak bola mata
: Normal
Medan penglihatan
: Menyempit
Buta warna
: Tidak
Tekanan Intra Okuler
: Tidak
Hidung (Penciuman)
Bentuk
: Normal
Gangguan Penciuman
: Tidak
Telinga (Pendengaran)

a.
b.
c.
d.
e.
4.
5.

Aurikel
Membran tympani
Otorrhae
Gangguan Pendengaran
Tinitus
Perasa
Peraba

Normal
: Keruh
: Tidak
: Ya
: Ya
: Normal
: Normal

PERKEMIHAN-ELIMINASI URI (B4: BLADDER)


Masalah kandung kemih
: Sering
Produksi urine
: 1000 ml/hari
Frekuensi
: 4 5 x/hari
Warna
: Kuning Jernih
Bau
: Amoniak
PENCERNAAN-ELIMINASI ALVI (B5: BOWEL)
1. Mulut dan Tenggorokan
a. Mulut
: Selaput lendir mulut lembab
b. Lidah
: Hiperemik
c. Kebersihan Rongga Mulut
: Berbau
d. Tenggorokan
: Tidak ada sakit menelan
e. Abdomen
: Kenyal
f.
Pembesaran Hepar
: Tidak
g. Pembesaran Lien
: Tidak
h. Asites
: Tidak
2. Masalah Usus Besar dan Rectum/Anus
BAB
: 1 x/hari, Tidak ada masalah
Obat pencahar
: Tidak
Lavemen
: Tidak
OTOT, TULANG, DAN INTEGUMEN (B6: BONE)
1. Otot dan Tulang
Kemampuan pergerakan sendi lengan dan tungkai (ROM): Bebas
Kemampuan kekuatan otot:
- Tidak ada fraktur
- Tidak ada dislokasi
- Tidak ada haematom
2. Integumen
Warna kulit
: Hiperpigmentasi
Akral
: Hangat
Turgor
: Tidak Elastik
Tulang belakang
: Kiposis
REPRODUKSI
Perempuan:
Payudara
Kelamin

:
:

Bentuk simetris, tidak ada benjolan


Bentuk normal, tidak ada keputihan, klien menopause

ENDOKRIN
Klien tidak memiliki kelainan endokrin
PENGETAHUAN
Pengetahuan klien tentang kesehatan dirinya: klien menyadari dirinya sudah lansia, merasa lemah
dan sering cepat lelah sehingga terbatas dalam melakukan perawatan diri.

ANALISA DATA
No.
1.

Data
DS : Saya merasa lemah dan sering cepat
lelah bila beraktivitas jadi untuk perawatan
diri ya seadanya saja
DO : - K/U Baik
- Tampak tidak rapi, kotor, dan tidak terawat
- Rambut putih, kulit keriput

Etiologi

Problem

KelemahAn otot

Kurang perawatan diri

I.

PRIORITAS MASALAH
1. Kurang perawatan diri

II.
DIAGNOSA KEPERAWATAN
1. Kurang perawatan diri b/d penurunan kelemahan otot

RENCANA KEPERAWATAN

Dx.
Kep.

No.
1.

Tujuan

Intervensi

Rasional

Setelah dilakukan tindakan 1. Anjurkan klien mandi 2x sehari 1.


keperawatan selama 1 x 24
dan ajarkan klien memakai baby
jam, klien mampu
oil setiap habis mandi
2.
melakukan perawatan diri 2. Anjurkan klien menyikat gigi
dengan kriteria hasil :
minimal setiap mandi
3.
1. Klien tampak bersih, rapi, 3. Anjurkan klien mencuci rambut
dan terawat
rutin 3x seminggu, memakai 4.
2. Klien tampak sehat
conditioner dan anjurkan untuk 5.
minta bantuan orang terdekat /
anak
4. Anjurkan klien menyisir
6.
rambutnya tiap hari dan ditata
rapi
5. Anjurkan klien minta bantuan 7.
pada orang terdekat / anak untuk
memotong kuku bila panjang,
bila bisa mandiri ingatkan untuk
hati hati dan jangan terlalu
pendek atau sampai
menimbulkan luka
6. Anjurkan klien untuk memakai
pakaian yang tidak berbahan
kasar, tidak tebal, mudah dan
nyaman dipakai
7. Berikan penkes tentang
pentingnya melakukan
perawatan diri / menjaga
kebersihan diri bagi lansia

Menjaga kebersihan dan


kelembaban kulit
Menjaga kebersihan dan
kesegaran mulut
Menjaga kebersihan rambut dan
kelembaban kulit kepala
Menjaga kerapianrambut
Menjaga kebersihan kuku,
menghindari terjadi luka karena
akan sulit sembuh
Menjaga kenyamanan dan
menjaga agar selalu rapi dan tidak
terjadi iritasi
Meningkatkan pengetahuan dan
kesadaran klien akan pentingnya
tetap melakukan perawatan diri /
menjaga kebersihan diri meskipun
sudah lansia

IMPLEMENTASI

Dx.
Kep.

No.
1. 1
.

Implementasi
1. Menganjurkan klien mandi 2x sehari dan mengajarkan
klien memakai baby oil setiap habis mandi
2. Menganjurkan klien menyikat gigi minimal setiap
mandi
3. Mengnjurkan klien mencuci rambut rutin 3x seminggu,
memakai conditioner dan menganjurkan untuk minta
bantuan orang terdekat / anak

Evaluasi
Tanggal 28 Maret 2012
Jam 17.00 WIB
S : Saya sudah mulai mencoba
menjalankan anjuran anjuran untuk
perawatan diri saya dan saya meminta
bimbingan dari anak saya karena saya

4. Mengnjurkan klien menyisir rambutnya tiap hari dan


sudah tua begini tidak bisa melakukannya
ditata rapi
sendiri
5. Menganjurkan klien minta bantuan pada orang
terdekat / anak untuk memotong kuku bila panjang,
O:
bila bisa mandiri ingatkan untuk hati hati dan jangan - Klien tampak bersih, rapi, dan terawat
terlalu pendek atau sampai menimbulkan luka
- Klien tampak sehat
6. Menganjurkan klien untuk memakai pakaian yang tidak
berbahan kasar, tidak tebal, mudah dan nyaman
A : Masalah teratasi
dipakai
7. Memberikan penkes tentang pentingnya melakukan
P : Lanjutkan intervensi
perawatan diri / menjaga kebersihan diri bagi lansia

BAB III
PENUTUP
3.1

KESIMPULAN
Dalam kehidupan sehari-hari kebersihan merupakan hal yang sangat penting dan harus
diperhatikan karena kebersihan akan mempengaruhi kesehatan dan psikis seseorang. Kebersihan itu
sendiri dangat dipengaruhi oleh nilai individu dan kebiasaan. Hal-hal yang sangat berpengaruh itu di
antaranya kebudayaan, sosial, keluarga, pendidikan, persepsi seseorang terhadap kesehatan, serta
tingkat perkembangan.
Memenuhi kebutuhan kebersihan diri pada lansia adalah suatu tindakan perawatan sehari
hari yang harus diberikan kepada klien lanjut usia terutama yang berhubungna dengan kebershan
perorangan (Personal Hygiene), yaitu antara lain kebersihan mulut dan gigi, kebersihan kulit dan
badan, kebersihan kepala, rambut dan kuku, serta kebersihan tempat tidur dan posisi tidur.

3.2

SARAN
Perawat mempunyai peranan dalam memberikan pendidikan kesehatan tentang kebersihan
diri, yaitu sebagai family advocacy. Perawat berperan sebagai pendamping bagi keluarga baik bagi
lansia maupun keluarganya ketika dihadapkan pada suatu masalah termasuk dalam hal kebersihan
diri. Perawat sebagai conselor perawat di mana perawat dapat memberikan ide atau pendapat
kepada lansia dan kepada keluarga sebagai pelaksana asuhan keperawatan. Perawat memberikan
asuhan dengan kebutuhan perawat sebagai pendidikan memberikan pendidikan kesehatan yang
sesuai dengan kebutuhan lansia.

DAFTAR PUSTAKA
Carpenito, L. J, 2000. Diagnosa Keperawatan. Edisi 8. Jakarta : EGC
Nugroho, 2000. Keperawatan Gerontik. Edisi 2. Jakarta : EGC Kedokteran
Setiabudhi, T & Hardiwinoto, 1999. Panduan Gerontologi Tinjauan Dari Berbagai Aspek
Menjaga Keseimbangan Kualitas Hidup Para Lanjut Usia, Jakarta : PT. Gramedia Pustaka
Utama
Tarwoto & Wartonah, 2004. Kebutuhan Dasar Manusia dan Proes Keperawatan. Edisi 4. Jakarta :
EGC

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

2
MAR

31

Asuhan Keperawatan GErontik dengan Masalah Cairan dan


Elektrolit (kelompok9)
KELOMPOK 8 :

GILANG RAMADAN
ISTIQOMAH
NOVITA SARI
RETNO WULANDARI RIPHA
BAB I
PENDAHULUAN
1.1

Latar Belakang
Air (H 0) merupakan komponen utama yang paling banyak terdapat di dalam
tubuhmanusia. Sekitar 60% dari total berat badan orang dewasa terdiri dari air.
Namun bergantung kepadakandungan lemak & otot yang terdapat di dalam tubuh,
nilai persentase ini dapat bervariasiantara 50-70% dari total beratbadan orang
dewasa.Oleh karenaitu maka tubuh yang terlatih &terbiasa berolahraga sepertitubuh
seorang atlet biasanyaakan mengandung lebih banyakair jika dibandingkan tubuh
nonatlet.
Di dalam tubuh, sel-selyang mempunyai konsentrasi airpaling tinggi antara
lain adalahsel-sel otot dan organ-organ padarongga badan, seperti paru-paruatau
jantung, sedangkan sel-selyang mempunyai konsentrasi airpaling rendah adalah selseljaringan seperti tulang atau gigi. Konsumsi cairanyang ideal untuk memenuhi
kebutuhan harian bagitubuh manusiaadalahmengkonsumsi1 ml air untuksetiap 1
kkalkonsumsi energy tubuhataudapat juga diketahui berdasarkan estimasi
totaljumlah air yang keluar dari dalam tubuh. Secara rataratatubuh orang dewasa
akan kehilangan 2.5 Lcairan per harinya. Sekitar 1.5 L cairan tubuh keluarmelalui
urin, 500 ml melalui keluarnya keringat, 400ml keluar dalam bentuk uap air melalui
prosesrespirasi (pernafasan) dan 100 mlkeluar bersama dengan feces(tinja).
Sehingga berdasarkan estimasi ini, konsumsi antara 8-10gelas (1 gelas 240 ml)
biasanyadijadikan sebagai pedomandalam pemenuhan kebutuhancairan perharinya.

1.2

Rumusan Masalah
Rumusan masalah yang akan dibahas dalam makalah ini adalah:
1. Bagaimana anatomi cairan tubuh?
2. Apa pengertian dari cairan tubuh
3. Apapenyebab terjadinya ketidakseimbangan volume cairan?
4. Bagaimana patofisiologinya?
5. Apasaja tanda dan gejalanya?
6. Sebutkan klasifikasinya?
7. Apa saja pemeriksaan diagnostic?
8. Bagaimana penatalaksanaanna?
9. Apa saja diagnosa keperawatannya?
10. Bagaiamana asuhan keperawatannya?

1.3

Tujuan Penulisan
Makalah ini dibuat dengan tujuan untuk memberikan penjelasan tentang cairan
dan elektrolit. Selain itu, makalah ini juga untuk memenuhi salah satu tugas dari
dosen mata kuliah Keperawatan Gerontik.

1.4

Metode Penulisan
Metode penulisan yang digunakan dalam penulisan makalah ini berupa tinjauan
pustaka dari berbagai macam sumber data yang memiliki kaitan dengan asuhan
keperawatan gerontik baik melalui buku kepustakaan ataupun melalui kepustakaan
dari media elektronik/dunia maya (internet).

1.5

Sistematika Penulisan
Sistematika penulisan makalah ini yaitu Halaman Judul, Kata Pengantar, Daftar
Isi, Bab I Pendahuluan yang terdiri dari Latar Belakang, Rumusan Masalah, Tujuan
Penulisan, Metode Penulisan, dan Sistematika Penulisan, Bab II Pembahasan, Bab
III Penutup yang terdiri dari Kesimpulan, Daftar Pustaka.

BAB II
PEMBAHASAN
2.1

ANATOMI CAIRAN TUBUH


Air merupakan bagian terbesar pada tubuh manusia, persentasenya dapat berubahtergantung
pada umur, jenis kelamin dan derajat obesitas seseorang. Pada bayi usia< 1tahun cairan tubuh
adalah sekitar 80-85% berat badan dan pada bayi usia > 1 tahunmengandung air sebanyak 7075 %. Seiring dengan pertumbuhan seseorang persentasejumlah cairan terhadap berat badan
berangsur-angsur turun yaitu pada laki-laki dewasa50-60% berat badan, sedangkan pada wanita
dewasa 50 % berat badan.Hal ini terlihatpada tabel berikut :

Tabel.1 Perubahan cairan tubuh total sesuai usia

Usia

Kilogram Berat (%)

Bayi premature

80

3 bulan

70

6 bulan

60

1-2 tahun

59

11-16 tahun

58

Dewasa

58-60

Dewasa dengan obesitas

40-50

Dewasa kurus

70-75

Dikutip dari : Garner MW: Physiology and pathophysiology of the body


fluid, St.Louis,1981, Mosby.

a.

b.

Perubahan jumlah dan komposisi cairan tubuh, yang dapat terjadi


padaperdarahan, luka bakar, dehidrasi, muntah, diare, dan puasa preoperatif
maupun perioperatif, dapat menyebabkan gangguan fisiologis yang berat.Jika
gangguan tersebut tidak dikoreksi secara adekuat sebelum tindakan anestesi dan
bedah, maka resikopenderita menjadi lebih besar.Seluruh cairan tubuh
didistribusikan
ke
dalam
kompartemen
intraselular
dankompartemen
ekstraselular.Lebih jauh kompartemen ekstraselular dibagi menjadi cairan
intravaskular dan intersisial.
Cairan intraselular
Cairan yang terkandung di antara sel disebut cairan intraselular. Pada
orangdewasa, sekitar duapertiga dari cairan dalam tubuhnya terdapat di
intraselular(sekitar 27 liter rata-rata untuk dewasa laki-laki dengan berat badan
sekitar 70kilogram), sebaliknya pada bayi hanya setengah dari berat badannya
merupakancairan intraselular.
Cairan ekstraselular
Cairan yang berada di luar sel disebut cairan ekstraselular. Jumlah relatif
cairanekstraselular berkurang seiring dengan usia. Pada bayi baru lahir, sekitar
setengahdari cairan tubuh terdapat di cairan ekstraselular. Setelah usia 1 tahun,
jumlahcairan ekstraselular menurun sampai sekitar sepertiga dari volume total.
Inisebanding dengan sekitar 15 liter pada dewasa muda dengan berat rata-rata
70kg.
Cairan ekstraselular dibagi menjadi:
Cairan Interstitial
Cairan yang mengelilingi sel termasuk dalam cairan interstitial, sekitar 11-12 liter
pada orang dewasa.Cairan limfe termasuk dalam volumeinterstitial.Relatif terhadap
ukuran tubuh, volume ISF adalah sekitar 2 kalilipat pada bayi baru lahir
dibandingkan orang dewasa.
Cairan Intravaskular

Merupakan cairan yang terkandung dalam pembuluh darah (contohnyavolume


plasma). Rata-rata volume darah orang dewasa sekitar 5-6Ldimana 3 liternya
merupakan plasma, sisanya terdiri dari sel darah merah,sel darah putih dan platelet.
Cairan Transeluler
Merupakan cairan yang terkandung diantara rongga tubuh tertentu
sepertiserebrospinal, perikardial, pleura, sendi sinovial, intraokular dan
sekresisaluran pencernaan.Pada keadaan sewaktu, volume cairan transeluleradalah
sekitar 1 liter, tetapi cairan dalam jumlah banyak dapat masuk dankeluar dari ruang
transeluler.

Selain air, cairan tubuh mengandung dua jenis zat yaitu elektrolit dan non
elektrolit.
Elektrolit
Merupakan zat yang terdisosiasi dalam cairan dan menghantarkan arus listrik.
Elektrolit dibedakan menjadi ion positif (kation) dan ion negatif (anion). Jumlah
kationdan anion dalam larutan adalah selalu sama (diukur dalam miliekuivalen).
o Kation
Kation utama dalam cairan ekstraselular adalah sodium (Na +), sedangkankation
utama dalam cairan intraselular adalah potassium (K +).Suatusistem pompa terdapat
di dinding sel tubuh yang memompa keluar sodiumdan potassium ini.

o Anion
Anion utama dalam cairan ekstraselular adalah klorida (Cl -) danbikarbonat (HCO3 ),
sedangkan anion utama dalam cairan intraselularadalah ion fosfat (PO 4 ).Karena
kandungan elektrolit dalam plasma dan cairan interstitial pada intinyasama maka
nilai elektrolit plasma mencerminkan komposisi dari cairan ekstraselulertetapi tidak
mencerminkan komposisi cairan intraseluler.
a) Natrium
Natrium sebagai kation utama didalam cairan ekstraseluler dan paling berperan
didalam mengatur keseimbangan cairan. Kadar natrium plasma: 135-145mEq/liter.
Kadarnatrium dalam plasma diatur lewat beberapa mekanisme:
- Left atrial stretch reseptor
- Central baroreseptor
- Renal afferent baroreseptor
- Aldosterone (reabsorpsi di ginjal)
- Atrial natriuretic factor
- Sistem renin angiotensin
-Sekresi ADH
-Perubahan yang terjadi pada air tubuh total (TBW=Total Body Water)
-

3-

Kadar natrium dalam tubuh 58,5mEq/kgBB dimana + 70% atau


40,5mEq/kgBB dapatberubah-ubah.Ekresi natrium dalam urine 100-180mEq/liter,

b)

c)

d)

e)

2.1

faeces 35mEq/liter dankeringat 58mEq/liter. Kebutuhan setiap hari = 100mEq (6-15


gram NaCl).
Natrium dapat bergerak cepat antara ruang intravaskuler dan interstitial
maupunke dalam dan keluar sel. Apabila tubuh banyak mengeluarkan natrium
(muntah,diare)sedangkan pemasukkan terbatas maka akan terjadi keadaan
dehidrasi disertai kekurangannatrium. Kekurangan air dan natrium dalam plasma
akan diganti dengan air dan natriumdari cairan interstitial. Apabila kehilangan cairan
terus berlangsung, air akan ditarik daridalam sel dan apabila volume plasma tetap
tidak dapat dipertahankan terjadilahkegagalan sirkulasi.
Kalium
Kalium merupakan kation utama (99%) di dalam cairan ekstraseluler
berperanpenting di dalam terapi gangguan keseimbangan air dan elektrolit. Jumlah
kalium dalamtubuh sekitar 53 mEq/kgBB dimana 99% dapat berubah-ubah
sedangkan yang tidak dapatberpindah adalah kalium yang terikat dengan protein
didalam sel.Kadar kalium plasma 3,5-5,0 mEq/liter, kebutuhan setiap hari 1-3
mEq/kgBB.Keseimbangan kalium sangat berhubungan dengan konsentrasi
H+ ekstraseluler. Ekskresikalium lewat urine 60-90 mEq/liter, faeces 72 mEq/liter dan
keringat 10 mEq/liter.
Kalsium
Kalsium dapat dalam makanan dan minuman, terutama susu, 80-90%
dikeluarkanlewat faeces dan sekitar 20% lewat urine. Jumlah pengeluaran ini
tergantung pada intake,besarnya tulang, keadaan endokrin. Metabolisme kalsium
sangat dipengaruhi olehkelenjar-kelenjar paratiroid, tiroid, testis, ovarium, dan
hipofisis. Sebagian besar (99%)ditemukan didalam gigi dan + 1% dalam cairan
ekstraseluler dan tidak terdapat dalamsel.
Magnesium
Magnesium ditemukan di semua jenis makanan.Kebutuhan unruk pertumbuhan +10
mg/hari.Dikeluarkan lewat urine dan faeces.
Karbonat
Asam karbonat dan karbohidrat terdapat dalam tubuh sebagai salah satu hasilakhir
daripada
metabolisme.Kadar
bikarbonat
dikontrol
oleh
ginjal.
Sedikit
sekalibikarbonat yang akan dikeluarkan urine. Asam bikarbonat dikontrol oleh paruparu dansangat penting peranannya dalam keseimbangan asam basa.
Non elektrolit
Merupakan zat seperti glukosa dan urea yang tidak terdisosiasi dalam cairan. Zat
lainya termasuk penting adalah kreatinin dan bilirubin.

PENGERTIAN CAIRAN TUBUH


Cairan adalah volume air bisa berupa kekurangan atau kelebihan air. Air tubuh lebih banyak
meningkat tonisitus adalah terminologi guna perbandingan osmolalitas dari salah satu cairan
tubuh yang normal. Cairan tubuh terdiri dari cairan eksternal dan cairan internal. Volume cairan
intrasel tidak dapat diukur secara langsung dengan prinsip difusi oleh karena tidak ada bahan

yang hanya terdapat dalam cairan intrasel. Volume cairan intrasel dapat diketahui dengan
mengurangi jumlah cairan ekternal, terdiri dari cairan tubuh total.
Cairan dan elektrolit sangat diperlukan dalam rangka menjaga kondisi tubuh tetap sehat.
Keseimbangan cairan dan elektrolit di dalam tubuh adalah merupakan salah satu bagian dari
fisiologi homeostatis. Keseimbangan cairan dan elektrolit melibatkan komposisi dan perpindahan
berbagai cairan tubuh. Cairan tubuh adalah larutan yang terdiri dari air ( pelarut) dan zat tertentu
(zat terlarut). Elektrolit adalah zat kimia yang menghasilkan partikel-partikel bermuatan listrik
yang disebut ion jika berada dalam larutan. Cairan dan elektrolit masuk ke dalam tubuh melalui
makanan, minuman, dan cairan intravena (IV) dan didistribusi ke seluruh bagian tubuh.
Keseimbangan cairan dan elektrolit berarti adanya distribusi yang normal dari air tubuh total dan
elektrolit ke dalam seluruh bagian tubuh. Keseimbangan cairan dan elektrolit saling bergantung
satu dengan yang lainnya; jika salah satu terganggu maka akan berpengaruh pada yang lainnya.

2.2

PENYEBAB TERJADINYA CAIRAN TUBUH


Defisit volume cairan ekstraselular merupakan perubahan cairan tubuh yangpaling umum
terjadi pada pasien bedah. Penyebab paling umum adalah kehilangan cairandi gastrointestinal
akibat muntah, penyedot nasogastrik, diare dan drainase fistula.
Penyebab lainnya dapat berupa kehilangan cairan pada cedera jaringan lunak,
infeksi,inflamasi jaringan, peritonitis, obstruksi usus, dan luka bakar. Keadaan akut,
kehilangancairan yang cepat akan menimbulkan tanda gangguan pada susunan saraf pusat
danjantung. Pada kehilangan cairan yang lambat lebih sdapat ditoleransi sampai defisi
volumecairan ekstraselular yang berat terjadi.

2.3

PATOFISIOLOGI CAIRAN DAN ELEKTROLIT

Proses Pergerakan Cairan Tubuh


Perpindahan air dan zat terlarut di antara bagian-bagian tubuh melibatkan
mekanisme transpor pasif dan aktif. Mekanisme transpor pasif tidak membutuhkan
energi sedangkan mekanisme transpor aktif membutuhkan energi.Difusi dan
osmosis adalahmekanisme transpor pasif.Sedangkan mekanisme transpor aktif
berhubungan dengan pompa Na-K yang memerlukan ATP.
Proses pergerakan cairan tubuh antar kompertemen dapat berlangsung secara:
a) Osmosis
Osmosis adalah bergeraknya molekul (zat terlarut) melalui membrane
semipermeabel (permeabel selektif) dari larutan berkadar lebih rendah menuju
larutanberkadar lebih tinggi hingga kadarnya sama. Seluruh membran sel dan
kapiler permeable terhadap air, sehingga tekanan osmotik cairan tubuh seluruh
kompartemen sama.Membran semipermeabel ialah membran yang dapat dilalui air
(pelarut), namun tidakdapat dilalui zat terlarut misalnya protein.
Tekanan osmotik plasma darah ialah 285+ 5 mOsm/L. Larutan dengan
tekananosmotik kira-kira sama disebut isotonik (NaCl 0,9%, Dekstrosa 5%, Ringer

laktat).Larutan dengan tekanan osmotik lebih rendah disebut hipotonik (akuades),


sedangkanlebih tinggi disebut hipertonik.
b) Difusi
Difusi ialah proses bergeraknya molekul lewat pori-pori. Larutan akan bergerak
darikonsentrasi tinggi ke arah larutan berkonsentrasi rendah. Tekanan hidrostatik
pembuluhdarah juga mendorong air masuk berdifusi melewati pori-pori tersebut.Jadi
difusitergantung kepada perbedaan konsentrasi dan tekanan hidrostatik.
c) Pompa Natrium Kalium
Pompa natrium kalium merupakan suatu proses transpor yang memompa ionnatrium
keluar melalui membran sel dan pada saat bersamaan memompa ion kalium dariluar
ke dalam. Tujuan dari pompa natrium kalium adalah untuk mencegah
keadaanhiperosmolar di dalam sel.

2.4

TANDA DAN GEJALA KETIDAKSEIMBANGAN CAIRAN DAN ELEKTROLIT

Perubahan cairan tubuh


Perubahan cairan tubuh dapat dikategorikan menjadi 3, yaitu :
1. Perubahan volume

Tabel.3 Tanda-tanda klinis dehidrasi


Symptom/Sign
Mild

Dehydration

Moderate

Dehydration
Severe
Dehydration
Obtunded

Level of
consciousness*
Capillary refill*

Alert

Lethargic

2 Seconds

2-4 Seconds

Membranes*

Normal

Dry

Greater than 4
seconds, cool limbs
Mucous
Parched, cracked

Tears*

Normal

Decreased

Absent

Heart rate

Slight increase

Increased

Very increased

Respiratory rate

Normal

Increased

Blood pressure

Normal

Pulse

Normal

Normal, but
orthostasis
Thready

Increased and
hyperpnea
Decreased

Skin turgor

Normal

Slow

Faint or impalpable
Tenting

Fontanel

Normal

Depressed

Sunken

Eyes

Normal

Sunken

Very sunken

Urine output

Decreased

Oliguria

Oliguria/anuria

* Best indicators of hydration statuss


Tabel. 4 Derajat dehidrasis
Dehidrasi

Dewasa

Anak

Ringan

4%

4%-5%

Sedang

6%

5 % - 10 %

Berat

8%

10 % - 15 %

Shock
15-20%
15 % - 20%
asi Dewasa
Terapi untuk dehidrasi (rehidrasi) dilakukan dengan mempertimbangkan kebutuhan
cairan untuk rumatan, defisit cairan dan kehilangan cairan yang sedang
berlangsung.
Beberapa pendekatan terangkum dalam tabel 5.
Tabel.5 Pendekatan pada masalah cairan dan elektrolit
Tabel.6 Rumatan cairan menurut rumus Holliday-Segar
Strategi untuk rehidrasi adalah dengan memperhitungkan defisit cairan,
cairan rumatanyang diperlukan dan kehilangan cairan yang sedang berlangsung
disesuaikan.
Cararehidrasi:
1) Nilai status rehidrasi (sesuai tabel 4 di atas), banyak cairan yang diberikan (D)
=derajat dehidrasi (%) x BB x 1000 cc
2) Hitung cairan rumatan (M) yang diperlukan (untuk dewasa 40 cc/kgBB/24 jamatau
rumus holliday-segar seperti untuk anak-anak)
3) Pemberian cairan :
o 6 jam I = D + M atau 8 jam I = D + M (menurut Guillot)
o 18 jam II = D + M atau 16 jam II = D + M (menurut Guillot)
Kelebihan volume
Kelebihan volume cairan ekstraselular merupakan suatu kondisi akibat iatrogenic
(pemberian cairan intravena seperti NaCl yang menyebabkan kelebihan air dan
NaClataupun pemberian cairan intravena glukosayang menyebabkan kelebihan air)
ataupundapat sekunder akibat insufisiensi renal (gangguan pada GFR), sirosis,
ataupun gagaljantung kongestif.Kelebihan cairan intaseluler dapat terjadi jika terjadi
kelebihancairan tetapi jumlah NaCl tetap atau berkurang.

2. Perubahan konsentrasi
- Hiponatremia
Jika < 120 mg/L maka akan timbul gejala disorientasi, gangguan mental,
letargi,iritabilitas, lemah dan henti pernafasan, sedangkan jika kadar < 110 mg/L
makaakan timbul gejala kejang, koma. Hiponatremia ini dapat disebabkan
oleheuvolemia (SIADH, polidipsi psikogenik), hipovolemia (disfungsi tubuli
ginjal,diare, muntah, third space losses, diuretika), hipervolemia (sirosis, nefrosis).
Keadaan ini dapat diterapi dengan restriksi cairan (Na+ 125 mg/L) atau NaCl3%
ssebanyak (140-X)xBBx0,6 mg dan untuk pediatrik 1,5-2,5 mg/kg.
Koreksi hiponatremia yang sudah berlangsung lama dilakukan scara
perlahanlahan,sedangkan untuk hiponatremia akut lebih agresif. Untuk menghitung
Naserum yang dibutuhkan dapat menggunakan rumus:
Na= Na1 Na0 x TBW
keterangan :
Na = Jumlah Na yang diperlukan untuk koreksi (mEq)
Na1 = 125 mEq/L atau Na serum yang diinginkan
Na0 = Na serum yang actual
TBW = total body water = 0,6 x BB (kg)
- Hipernatremia
Jika kadar natrium > 160 mg/L maka akan timbul gejala berupa perubahanmental,
letargi, kejang, koma, lemah. Hipernatremi dapat disebabkan olehkehilangan cairan
(diare, muntah, diuresis, diabetes insipidus, keringatberlebihan), asupan air kurang,
asupan natrium berlebihan. Terapi keadaan iniadalah penggantian cairan dengan
5% dekstrose dalam air sebanyak {(X-140) xBB x 0,6}: 140.
- Hipokalemia
Jika kadar kalium < 3 mEq/L. Dapat terjadi akibat dari redistribusi akut kaliumdari
cairan ekstraselular ke intraselular atau dari pengurangan kronis kadar totalkalium
tubuh. Tanda dan gejala hipokalemia dapat berupa disritmik jantung,perubahan EKG
(QRS segmen melebar, ST segmen depresi, hipotensi postural,kelemahan otot
skeletal, poliuria, intoleransi glukosa. Terapi hipokalemia dapatberupa koreksi faktor
presipitasi (alkalosis, hipomagnesemia, obat-obatan), infuspotasium klorida sampai
10 mEq/jam (untuk mild hipokalemia ;>2 mEq/L) atauinfus potasium klorida sampai
40 mEq/jam dengan monitoring oleh EKG (untukhipokalemia berat;<2mEq/L disertai
perubahan EKG, kelemahan otot yanghebat).Rumus untuk menghitung defisit
kalium:
K = K1 K0 x 0,25 x BB
Keterangan :
K = kalium yang dibutuhkan
K1 = serum kalium yang diinginkan
K0 = serum kalium yang terukur
BB = berat badan (kg)
- Hiperkalemia

Terjadi jika kadar kalium > 5 mEq/L, sering terjadi karena insufisiensi renal atauobat
yang membatasi ekskresi kalium (NSAIDs, ACE-inhibitor, siklosporin,diuretik). Tanda
dan gejalanya terutama melibatkan susunan saraf pusat(parestesia, kelemahan otot)
dan sistem kardiovaskular (disritmik, perubahanEKG). Terapi untuk hiperkalemia
dapat berupa intravena kalsium klorida 10%dalam 10 menit, sodium bikarbonat 50100 mEq dalam 5-10 menit, atau diuretik,hemodialisis.
1) Perubahan komposisi
- Asidosis respiratorik (pH< 3,75 dan PaCO2> 45 mmHg)
Kondisi ini berhubungan dengan retensi CO 2 secara sekunder untuk
menurunkanventilasi alveolar pada pasien bedah. Kejadian akut merupakan akibat
dariventilasi
yang
tidak
adekuat
termasuk
obstruksi
jalan
nafas,
atelektasis,pneumonia, efusi pleura, nyeri dari insisi abdomen atas, distensi
abdomen danpenggunaan narkose yang berlebihan. Manajemennya melibatkan
koreksi yangadekuat dari defek pulmonal, intubasi endotrakeal, dan ventilasi
mekanis bilaperlu. Perhatian yang ketat terhadap higiene trakeobronkial saat post
operatif adalah sangat penting.
- Alkalosis respiratorik (pH> 7,45 dan PaCO 2 < 35 mmHg)
Kondisi ini disebabkan ketakutan, nyeri, hipoksia, cedera SSP, dan ventilasi
yangdibantu.Pada fase akut, konsentrasi bikarbonat serum normal, dan
alkalosisterjadi sebagai hasil dari penurunan PaCO 2 yang cepat. Terapi ditujukan
untukmengkoreksi masalah yang mendasari termasuk sedasi yang sesuai,
analgesia,penggunaan yang tepat dari ventilator mekanik, dan koreksi defisit
potasium yangterjadi.
- Asidosis metabolik (pH<7,35 dan bikarbonat <21 mEq/L)
Kondisi ini disebabkan oleh retensi atau penambahan asam atau
kehilanganbikarbonat.Penyebab yang paling umum termasuk gagal ginjal, diare,
fistula ususkecil, diabetik ketoasidosis, dan asidosis laktat.Kompensasi awal yang
terjadiadalah peningkatan ventilasi dan depresi PaCO2.Penyebab paling umum
adalahsyok, diabetik ketoasidosis, kelaparan, aspirin yang berlebihan dan
keracunanmetanol.Terapi sebaiknya ditujukan terhadap koreksi kelainan yang
mendasari.
Terapi bikarbonat hanya diperuntukkan bagi penanganan asidosis berat dan
hanyasetelah kompensasi alkalosis respirasi digunakan.
- Alkalosis metabolik (pH>7,45 dan bikarbonat >27 mEq/L)
Kelainan ini merupakan akibat dari kehilangan asam atau penambahan
bikarbonatdan diperburuk oleh hipokalemia.Masalah yang umum terjadi pada pasien
bedahadalah
hipokloremik,
hipokalemik
akibat
defisit
volume
ekstraselular.Terapiyang digunakan adalah sodium klorida isotonik dan penggantian
kekuranganpotasium. Koreksi alkalosis harus gradual selama perode 24 jam
denganpengukuran pH, PaCO2 dan serum elektrolit yang sering.
2.5

KLASIFIKASI CAIRAN DAN ELEKTROLIT

Dehidrasi
Dehidrasi sering dikategorikan sesuai dengan kadar konsentrasi serum darinatrium
menjadi
isonatremik
(130-150
mEq/L),
hiponatremik
(<139
mEq/L)
atauhipernatremik (>150 mEq/L). Dehidrasi isonatremik merupakan yang paling
seringterjadi (80%), sedangkan dehidrasi hipernatremik atau hiponatremik sekitar 510% darikasus.
1) Dehidrasi Isotonis (isonatremik) terjadi ketika kehilangan cairan hampir samadengan
konsentrasi natrium terhadap darah. Kehilangan cairan dan natrium besarnyarelatif
sama dalam kompartemen intravaskular maupun kompartemen ekstravaskular.
2) Dehidrasi
hipotonis
(hiponatremik)
terjadi
ketika
kehilangan
cairan
dengankandungan natrium lebih banyak dari darah (kehilangan cairan hipertonis).
Secara garisbesar terjadi kehilangan natrium yang lebih banyak dibandingkan air
yang hilang. Karenakadar natrium serum rendah, air di kompartemen intravaskular
berpindah kekompartemen ekstravaskular, sehingga menyebabkan penurunan
volume intravaskular.
3) Dehidrasi
hipertonis
(hipernatremik)
terjadi
ketika
kehilangan
cairan
dengankandungan natrium lebih sedikit dari darah (kehilangan cairan hipotonis).
Secara garisbesar terjadi kehilangan air yang lebih banyak dibandingkan natrium
yang hilang. Karenakadar natrium tinggi, air di kompartemen ekstraskular berpindah
ke kompartemenintravaskular, sehingga meminimalkan penurunan volume
intravaskular.
2.6

PEMERIKSAAN DIAGNOSTIK
1. Pemeriksaan gangguan keseimbangan asam basa dalam darah dengan menentukan pH dan
cadangan alkali atau lebih tepat lagi dengan pemeriksaan gas darah menurut ASTRUP (bila
memungkinkan)
2. Pemeriksaan eletrolit terutama kadar Natrium, Kalium, dan Fofor dalam serum.

2.7

PENATALAKSANAAN
Asupan dan kehilangan cairan dan elektrolit pada keadaan normal
Homeostasis cairan tubuh yang normalnya diatur oleh ginjal dapat berubah olehstres
akibat operasi, kontrol hormon yang abnormal, atau pun oleh adanya cedera padaparu-paru,
kulit atau traktus gastrointestinal.
Pada keadaan normal, seseorang mengkonsumsi air rata-rata sebanyak 2000-2500ml
per hari, dalam bentuk cairan maupun makanan padat dengan kehilangan cairan rata-rata 250
ml dari feses, 800-1500 ml dari urin, dan hampir 600 ml kehilangan cairan yangtidak disadari
(insensible water loss) dari kulit dan paru-paru.
Kepustakaan lain menyebutkan asupan cairan didapat dari metabolisme oksidatifdari
karbohidrat, protein dan lemak yaitu sekitar 250-300 ml per hari, cairan yang diminum setiap hari
sekitar 1100-1400 ml tiap hari, cairan dari makanan padat sekitar800-1000 ml tiap hari,
sedangkan kehilangan cairan terjadi dari ekskresi urin (rata-rata1500 ml tiap hari, 40-80 ml per

jam untuk orang dewasa dan 0,5 ml/kg untuk pediatrik),kulit (insensible loss sebanyak rata-rata 6
ml/kg/24 jam pada rata-rata orang dewasa yang mana volume kehilangan bertambah pada
keadaan demam yaitu 100-150 ml tiapkenaikan suhu tubuh 1 derajat celcius pada suhu tubuh di
atas 37 derajat celcius dansensible loss yang banyaknya tergantung dari tingkatan dan jenis
aktivitas yang dilakukan), paru-paru (sekitar 400 ml tiap hari dari insensible loss), traktus
gastrointestinal (100-200 ml tiap hari yang dapat meningkat sampai 3-6 L tiap hari jika terdapat
penyakitdi traktus gastrointestinal), third-space loses.

Tabel.2 Rata-rata harian asupan dan kehilangan cairan pada orang dewasaID GAINS FLUID
LOSES

2.8

FLUID GAINS

FLUID LOSES

Oxidative 300 ml

Kidneys 1200-1500 ml

Metabolism

Skin 500-600 ml

Oral fluids 1100-1400 ml

Lungs 400 ml

Solid foods 800-1000 ml

GI tract 100-200 ml

TOTAL 2200-2700 ml

TOTAL 2200-2700 ml

DIAGNOSA KEPERAWATAN

ANALISA DATA
No.

Keluhan / Data
Data objektif :
1. Klien merasa lemah
2. Klien
merasa
haus
berlebihan
Data subjektif :
1. Kelemahan
2. Haus

Etiologi
Diare;
kehilangan
cairan
lambung;
secara diaphoresis;
polyuria.

Problem
Ketidakseimbangan
volume
cairan
kurang
dari
kebutuhan tubuh

3. Penurunan turgor kulit / penurunan


intensitas tidur
4. Membrane mukosa / kulit kering
5. Peningkatan
denyut
nadi,
penurunan
tekanan
darah,
penurunan volume / tekanan nadi
6. Pengisian vena menurun
7. Perubahan status mental
8. Konsentrasi urine meningkat
9. Temperature tubuh meningkat
10. Hemtokrit tinggi
11. Kehilangan berat badan seketika
2.1

ASUHAN KEPERAWATAN GERONTIK

FORMAT PENGKAJIAN INDIVIDU


ASUHAN KEPERAWATAN GERONTIK
A. DATA BIOGRAPI
Nama
: Ny. R
TTL
: 6 agustus -1942
Jenis Kelamin : perempuan
GOL.darah: O
Pendidikan
: SD
Agama
: islam
TB/BB
: 153 Cm,
42 kg
Penampilan
: rapi,bersih
ciri-ciri tubuh: rambut beruban
Alamat
: kel: basirih hulu RT/RW: 5 / 3
kec: mentaya hilir selatan
kabupaten: kotawaringin timur
Orang Terdekat : anak
Hubungan
: keluarga
Alamat/telp
: JL. Mujahidin / 085752xxxx
B. RIWAYAT KEPERAWATAN
1. Genogram
xxxx

keterangan :

: laki-laki
: perempuan

------

: garis keturunan
: garis serumah

: garis hubungan
x
: meninggal
: klien
2. Riwayat Keluarga
Aklien adalah anak ke-2 dari 3 bersaudara.klien berasal dari keluarga yang tidak
berada.orang tua klien sudah meninggal,dan suami klien sudah meninggal 5 tahun
yang lalu.klien tinggal bersama ke-2 anaknya. orang tua laki-laki klien meninggal
karena hipertensi dan ibu klien meniggal karena sakit.
C. RIWAYAT PEKERJAAN
Pekerjaan saat ini
:
Alamat pekerjaan
:
Jarak dari rumah
:
Alat transportasi
:
Jarak dari rumah
: 4000 km
Alat transportasi
: jalan kaki
Sumber-sumber pendapatan dan kecukupan terhadap kebutuhan
: untuk
memenuhi kebutuhan sehari-hari dipenuhi oleh anak klien dan klien tinggal bersama
anaknya.
D. RIWAYAT LINGKUNGAN HIDUP
Type tempat tinggal
: kayu
Jenis lantai rumah
: kayu
Kondisi lantai
: kering
Tangga rumah
: tidak ada
Penerangan
: cukup
Tempat tidur
: tidak aman
Alat dapur
: tertata rapi
WC
: ada (tidak aman, lantai licin tidak ada pegangan)
Kebersihan lingkungan : bersih (tidak ada barang yang membahayakan)
Jumlah orang yang tinggal dalam satu rumah : 7 orang
Derajat privasi
: klien merasa cukup dihargai dirumah
Tetangga terdekat
: ny S hubungan : keluarga
Alamat/tlfn
: jl. Mujahidin / 085349xxxx
E.RIWAYAT REKREASI
Hobby/minat
: klien suka memasak dan membuat kue
Keanggotaan Organisasi
: Tidak Ada
Liburan/perjalanan
: klien lebih sering berdiam diri dirumah dan jarang
melakukan refresing
F. SISTEM PENDUKUNG
Perawat : disekitar rumah klien tnggal salah seorang tenaga kesehatan puskesmas
Jarak dari rumah : 1000 km
Klinik : 5000 km
Pelayanan kesehatan dirumah : tidak ada
Makanan yang dihantarkan
: tidak ada
Perawatan sehari-hari yang dilakukan keluarga : tidak ada
Lainnya : klien masih mampu melakukan aktivitas sehari hari secara mandiri

G. DISKRIPSI KEKHUSUSAN
Kebiasaan ritual : klien shalat 5 waktu dan menjalankan puasa ramadhan
H. STATUS KESEHATAN
Status kesehatan umum selama setahun yang lalu
: klien mengatakan sering
mengeluh pusing dan kurang nafsu makan
Status kesehatan umum selama 5 tahun yang lalu
: klien mengatakan pernah
mengalami diare.
Keluhan utama : diare
1. Provocative :
2. Quality/quantity:
3. Region
:
4. Severity scale :
5. Timing
:
Pemahaman dan penatalaksanaan masalah kesehatan :
Obat obatan :
No.
1.

Nama obat
NEO ENTROSTOP

Dosis
2X1

Keterangan
Obat anti diare

Alergi (catatan agent dan reaksi spesifik)


Obat-obatan
: tidak ada
Makanan : tidak ada
Factor lingkungan : tidak ada
Penyakit yang diderita
Hipetensi, lainnya : batuk,pilek,demam ,panas sakit kepala
I. AKTIVITAS HIDUP SEHARI-HARI (ADL)
Indeks KATZ : A / B / C / D / E / F / G
Oksigenasi
: klien tidak menggunakan O2
Cairan & elektrolit
: air putih 1800 ml
Nutrisi
: klien makan 3x sehari
Eliminasi
: klien BAB 5x/ hari, BAK 3X
Aktivitas
: klien dapat beraktivitas dengan baik
Istirahat & tidur
: klien tidur 6 7 jam
Seksual
: klien tidak berkeinginan lagi untuk melakukan hubungan
suamiIstri
Rekreasi
: klien jarang rekreasi dan sering dirumah

J. PSIKOLOGI, KOGNITIF, DAN PERSEPTUAL


Konsep diri
: baik
Emosi
: stabil
Adaptasi
: klien dapat beradaptasi dengan keluarga dan tetangga

Mekanisme pertahanan diri: klien dapat mempertahankan diri dengan baik


Status mental
Tingkat kesadaran
: compos mentis
Afasia
: tidak
Dimensia
: tidak
Orientasi
: normal
Bicara
: normal
Bahasa yang digunakan:bahasa banjar
Kemampuan membaca : bisa
Kemampuan interaksi : sesuai
Vertigo
: tidak
Short portable mental status quetionaire (SPMSQ)
: 0 2 fungsi
menta utuh
Mini mental state exam (MMSQ)
:0 2 kesalahan : baik
Geriatrik depresion scale
:skor 5 9 =kemungkinan
depresi
Apgar
: rendah
K. TINJAUAN SISTEM
Keadaan umum
: baik
Tingkat kesadaran
: compos mentis
Tanda- tanda vital
: TD : 110/80 mmHg
NADI : 88 x/m
RR : 20 x/m
SUHU : 36,5 0C
TB : 153 cm
BB : 42 kg
PENGKAJIAN PERSISTEM
PERNAFASAN (B1 : BREATHING)
1. bentuk dada

Simetris
funne chestl
asimetris
pigeons chest
barrel chest

2. sekresi dan batuk


batuk:
ya
tidak

sputum:
ya
tidak
warna :
nyeri waktu bernafas : tidak
3. pola nafas
a. frekwensi nafas : 20 x/ menit
4. bunyi nafas
a. normal
vasikuer disemua lapangan dada

: regular

bronchial di manubrium sternum


broncho vesikuler di intracosta 2 dipercabanga bronchus
5. pergerakan dada : intercostal
6. tractil fremitis / fremitus vocal : tidak meningkat dan tidak menurun
7. alat bantu pernafasan : tidak ada
CARDIOVASCULAR (B2 : BLEEDING)
1. Nadi

frekuensi : 88 x/menit
regular
kuat
irregular
lemah

2. Bunyi jantung
Normal
Tambahan
Ada
Tidak,jelaskan
3.Letak jantung
ictus cordis teraba pada
4. Pembesaran jantung

Ya
Tidak
5.Nyeri Dada

Ya
Tidak
6.Edema
Palpebra
anasarka
ekstremitasatas

asites
tidak ada
ekstremitas bawah
7. Clubbing Finger

Ya
Tidak
PERSARAFAN (B3: Brain)

Tingkat Kesadaran:
compos mentis apatis
samnolen
sopor
koma
1. GCS:
Eye: 4
Verbal: 5
Motorik: 6
Total GCS: 15
2. Refleks

Normal
parese hemi parese
Babinsky
paraplegi
tetraplegia

3.koodinasi gerak :
ya
tidak
4. kejang
: ya
tidak

5.lain-lain :
PENGINDERAAN (persepsi sensori)
1. Mata (penglihatan)

a. Bentuk
Normal
enoftalmus
eksoptalmus
lain
b. visus
c. pupil
iskor
unisokor
miosis
midriasis
d. Gerak bola mata :

normal
menyempit
e. Medan penglihatan:
f. Buta warna :

Ya,jenis
tidak
g. Tekanan Intra Okuler :

meningkat
tidak
2. Hidung (Penciuman)
a. bentuk

b. gangguanpenciuman
3. Telinga (Pendengaran)

a. aurikel :
normal

b. membrane tympani
terang
keruh
intake
perforasi
c. otorrhoea
ya,jenis

d. gang guan pendengaran :

e. tinnitus :
ya
4. perasa

normal
tremor

5. peraba

refleks cahaya
positif

: normal
:

denasi

ya

anomaly

negative

tidak

keterangan

kemerahan

ya

tidak

tidak

parese

lain-lain,sebutkan

normal

kelainan,sebutkan

PERKEMIHAN ELIMINASI URI (B4 : BLADDER)


masalah kandung kemih

tidak ada masalah menetes


incosntinensia
oliguria
nyeri
retensi
polyuria
panas
hematuria
dysuria
sering
nokturia
pasang kateter
sistostomi
nokturia
produksi urine: 1800 ml/hari
frekuensi : 5x/hari
warna
: kuning
bau : amoniak
PENCERNAAN ELIMINASI ALVI( B5: BOWEL)
1. Mulut dan tengorokan
a.mulut
selaput lendir mulut

lembab
merah
stomatitis
b. lidah
hiperemik
kotor
lain lain
c. kebersihan rongga mulut
tidak berbau
berbau
gigi bersih
gigi kotor
d. tenggorokan
sakit menelan/ nyeri menelan
sulit menelan
lain-lain
e. abdomen
kenyal
tegang
kembung
nyeri tekan, lokasi

benjolan, lokasi
f. pembasaran hepar : ya
tidak
g. pembesaran lien
: ya
tidak

h. asites
:
ya
tidak
i. lain-lain
2.masalah usus besar dan rectum / anus
BAB :5X/hari

tidak ada masalah


diare
menelan
konstipasi
faeses berdarah
colostomy
inkontinensia
feses berlendir wasir lain-lain

obat pencahar : ya
tidak

lavamen
: ya
tidak

OTOT, TULANG DAN INTEGUMEN (B6: BONE)

1. otot dan tulang


kemampuan pergerakan sendi lengan dan tungkai (ROM)

bebas
terbatas
kemampuan kekuatan otot

tidak
ya
lokasi
dislokasi

tidak
ya
lokasi
haematom

tidak
ya
lokasi
2. integument
warna kulit :

ikterik
seasonik
pucat
kemerahan

akral:
hangat
panas
dingin kering
dingin basah

hyperpigmentasi
turgor :
elastic
tidak elastic
tulang belakang
lordosi:
kiposis:
scoliosis:
REPRODUKSI
laki-laki :
kelamin bentuk
:
kebersihan alat kelamin
perempuan
payudara
bentuk
:
simetris
benjolan :
ya
kelamin
bentuk
:
normal
keputihan
: ada
siklus haid 28 hari
ENDOKRIN

1. factor alergi
ya
tidak
manifestasi
:
cara mengatasi :
2.kelainan endokrin

lain-lain ,sebutkan

normal
tidak normal,keterangan
:
bersih
kotor
keterangan
asimetris
tidak
tidak
tidak

keterangan

tidak ada kelainan pada endokrin

PENGETAHUAN
pengetahuan klien tentang kesehatan dirinya :
klien saat merasa sakit langsung kepuskesmas diantar keluarganya

SHORT PORTABLE MENTAL STATUS QUESTIONNAIRE (SPMSQ)


PENILAIAN UNTUK MENGETAHUI FUNGSI INTELEKTUAL LANSIA
Nama klien
: Ny.R
Tanggal
: 29 maret - 2012

Jenis Kelamin : perempuan


Agama
Alamat

Umur

: islam

: 70 tahun
Suku

: banjar

: kel: basirih hulu

Pewawancara :

SKOR
+
-

NO Pertanyaan

Jawaban

1.
2.
3.
4.
5.
6.
7.

29 maret 2012
Kamis
Rumah
Jl. sarigading
72 tahun
?
SBY

8.
9.
10.

Nama klien

: Ny.R

No.Reg
Ruang

:
:

Tanggal berapa hari ini ?


Hari apa sekarang ini?
Apa nama tempat ini?
Dimana alamat anda?
Berapa umur anda?
Kapan anda lahir?
Siapa
nama
presiden
Indonesia
sekarang?
Siapa presiden sebelumnya?
Siapa nama kecil ibu anda?
Kurang 3 dari 20 dan tetap pengurangan
3 dari setiap angka baru,semua secara
menurun!

Mega wati
Siti halimah
15 5= 10
25 - 5 =10
21 - 5 = 16

MINI MENTAL SKORE


NO
1.
2.
3.
4.

PERTANYAAN
Tanggal berapa hari ini? (dd/mm/hh)
Hari apa hari ini?
Apakah nama tempat ini?
Berapa no.telp,bila tidak ada,no. rumah /jalan

BENAR

SALAH

5.
6.
7.
8.
9.
10.

Berapakah usia anda?


Kapan anda lahir? (tanggal/bulan/tahun)
Siapa nama presiden Indonesia sekarang?
Siapa nama presiden sebelumnya?
Siapa nama ibumu sebelum menikah?
20 dikurang 3 dan seterunya?

JUMLAH KESALAHAN
0-2 Kesalahan

: Baik

3-4 kesalahan
5-7 kesalahan

:Gangguan Intelektual Ringan


: Gangguan Intelektual Sedang

8-10 kesalahan
: Gangguan Intelektual Berat
HASIL :0 2 kesalahan : baik

Nama klien

:Ny.R

No. Reg
Ruang

:
:

INDEKS KATZ ( AKS)


Katz A

Katz B
Katz C
Katz D
Katz E
Katz F

Mandiri dalam :
1. Mandi
2. Berpakaian
3. Ke Toilet,
4. Berpindah
5. Kontinen BAK/BAB
6. Makan
Mandiri, untuk 5 fungsi diatas
Mandiri,kecuali mandi
Mandri, kecuali mandi, Berpakaian,& 1 fungsi diatas
Mandri, kecuali mandi, Berpakaian,Ke Toilet & 1 fungsi
diatas
Mandri, kecuali mandi, Berpakaian,Ke Toilet, Berpindah&
1 fungsi diatas

Katz G

Ketergantungan untuk semua 6 fungsi diatas

Nama Klien : Ny.R


No. Reg
:
Ruang
:

GERIATRIC DEPRESSION SCALE (SKALA DEPRESI)


NO
1.
2.
3.
4.
5.
6.
7.
8.
9.

10.

11.
12.
13.

PERTANYAAN
APAKAH ANDA SEBENARNYA PUAS DENGAN
KEHIDUPAN ANDA?
APAKAH ANDA TELAH MENINGGALKAN BANYAK
KEGIATAN DAN MINAT / KESENANGAN ANDA?
APAKAH ANDA MERASA KEHIDUPAN ANDA
KOSONG?
APAKAH ANDA MERASA SERING BOSAN?
APAKAH ANDA MEMPUNYAI SEMANGAT YANG
BAIK SETIAP SAAT?
APAKAH ANDA MERASA TAKUT SESUATU YANG
BURUK AKAN TERJADI PADA ANDA?
APAKAH ANDA MERASA BAHAGIA UNTUK
SEBAGIAN BESAR HIDUP ANDA?
APAKAH ANDA MERASA SERING TIDAK
BERDAYA?
APAKAH ANDA LEBIH SERING DIRUMAH DARI
PADA PERGI KELUAR DAN MENGERJAKAN
SESUATU HAL YANG BARU?
APAKAH ANDA MERASA MEMPUNYAI BANYAK
MASALAH DENGAN DAYA INGAT ANDA
DIBANDINGKAN KEBANYAKAN ORANG?
APAKAH ANDA PIKIR BAHWA HIDUP ANDA
SEKARANG MENYENANGKAN?
APAKAH ANDA ME RASA TIDAK BERHARGA
SEPERTI PERASAAN ANDA SAAT INI?
APAKAH ANDA MERASA PENUH SEMANGAT?

JAWABAN
TIDAK

YA

YA

YA

TIDAK

YA

TIDAK

YA
YA

YA

TIDAK

TIDAK

YA

APAKAH ANDA MERASA BAHWA KEADAAN ANDA


TIDAK ADA HARAPAN?
15. APAKAH ANDA PIKIR BAHWA ORANG LAIN LEBIH
BAIK KEADAANNYA DARI PADA ANDA?
*) SETIAP
JAWABAN
YANG
SESUAI
MERUPAKAN
( SATU)KETERANGAN :
SKOR 5-9
: KEMUNGKINANA DEPRESI
SKOR 10 ATAU LEBIH : DEPRESI
HASIL : skor 5 9 = kemungkinan depresi
14.

Nama klien
No.Reg

:Ny.R
:

Ruang

YA
YA
SKOR

SKORE NORTON
NO

KEADAAN PASIEN

1.

KONDISI FISIK UMUM

2.

3.

4.

5.

SKOR

Baik

Lumayan

Buruk

Sangat Buruk

KESADARAN
Komposmentis

Apatis

Konfus/spoor

Stupor/koma

AKTIVITAS
Ambualan

Ambualan dengan bantuan

Hanya bisa duduk

Tiduran

MOBILITAS
Bergerak bebas

Sedikit terbatas

Sangat terbatas

Tiduran

INKONTINENSIA
Tida ada

Kadang-kadang

Sering inkontinensia urine

Inkontinensia alvi dan urine

KATEORI SKOR
16-20 : kecil sekali /tidak terjadi
12-15 :kemungkinan terjadi kecil
< 12 :kemungkinan besar terjadi
HASIL : 19, kecil sekali / tidak terjadi

Nama klien
No. Reg

:Ny.R
:

Ruang

APGAR
NO
URAIAN
1
Saya puas bahwa saya dapat kembali kepada
keluarga (teman-teman) saya untuk membantu pada
waktu sesuatu menyusahkan saya
2
Saya puas dengan cara keluarga saya (temanteman) saya membicarakan sesuatu dengan saya
dan mengungkapkan masalah dengan saya
3.
Saya puas bahwa keluarga (temen-temen) saya
menerima dan mendukung keinginan saya untuk
melakukan aktivitas atau arah baru
4.
Saya puas dengan cara keluarga (temen-temen)
saya mengekspresikan afek dan berespons terhadap
emosi-emosi saya, seperti marah, sedih atau
mencintai
5.
Saya puas dengan cara temen-temen saya dan saya
menyediakan waktu bersama-sama

Penilaian
Peryataan-peryataan yang dijawab :
selalu
: skore 2
kadang-kadang
:skore 1
hampir tidak pernah :skore 0
>3 = tinggi
4-6= menengah / sedang
7-10= rendah

FUNGSI
Adaptation

SKORE
2

Partnership 1

Growth

Affection

Resolve

Total

ANALISA DATA
No.
1.

1.
2.
3.
4.
5.
6.
7.
8.
9.

I.

Keluhan / Data
DO : Klien mengatakan, Saya berak cair
terus menerus kurang lebih 5x hari ini.

Etiologi
Diare

DS :
k/u lemah
Klien nampak haus
Membrane mukosa kering
TTV :
TD = 110/80 mmHg RR = 20 x/m
S = 36,5 oC
N = 88 x/m
BB sebelum sakit = 45 kg
BB sesudah sakit = 42 kg
TB = 153 cm
Minum = 1800 ml/hari
BAB = 5x/hari

Problem
Ketidakseimbangan
volume
cairan
kurang
dari
kebutuhan tubuh

PRIORITAS MASALAH

1. Ketidakseimbangan volume cairan kurang dari kebutuhan tubuh


II.

DIAGNOSA KEPERAWATAN

1. Ketidakseimbangan volume cairan kurang dari kebutuhan tubuh berhubungan


dengan diare.
RENCANA KEPERAWATAN

Dx.
Kep.

No.
1.

Tujuan

Setelah
dilakukan
tindakan
1.
keperawatan selama
1
x
24
jam
diharapkan
cairan
dalam tubuh klien
terpenuhi
dengan
criteria hasil :
1. Mempertahankan
urine output sesuai
dengan usia dan
berat badan, berat
jenis urine normal,
2.
hematokrit normal.
2. Tanda tanda vital
dalam batas normal

Intervensi
Mandiri :
Pantau masukan
haluaran

Pantau tanda vital

Rasional
dan
1. Dengan
pemantauan
tersebut dapat dievaluasi
keaktifan terapi.

2. Perubahan tekanan darah


dan nadi dapat digunakan
perkiraan kasar darah
atau
menunjukkan
perubahan pada klien.

3. Tidak ada tanda


tanda
dehidrasi,
elastisitas turgor kulit
baik,
membrane
3. Untuk mengetahui sedini
mukosa
lembab,
mungkin
seandainya
tidak ada rasa haus
3. Monitor adanya tanda terjadi dehidrasi.
yang berlebihan.
tanda dehidrasi.
4. Menyeimbangkan output
yang berlebihan.
4. Anjurkan untuk minum
1500 2500 ml / hari.
5. Agar klien menjadi lebih
nyaman dengan adanya
5. Dorong keluarga untuk keluarga
yang
membantu klien makan. memperhatikan
nutrisinya.
6.
6. Tawarkan snack (jus /
buah buahan segar)
atau
makanan
kesukaannya.

Agar klien merasa tertarik


dan
memakannya
maupun
meminumnya
dengan harapan dapat
membantu
kebutuhan
nutrisinya.

Kolaborasi :
7. Mengetahui
apakah
7. Pertahankan
cairan cairan tersebut masuk ke
parenteral dan elektrolit. dalam
tubuh
secara
periodic agar tidak terjadi
diare misalnya.

IMPLEMENTASI

Dx.
Kep.

No.
1. 1
.

Implementasi

Evaluasi
S = Klien mengatakan, Saya
berak cair terus menerus
kurang lebih 5x hari ini.

1
1. Memantau masukan dan haluaran
Hasil :
Intake :
Minum = 1800 ml/hari
Output :
BAB = 800 ml/hari
IWL =
630 ml/hari +
= 1430 ml/hr
BC : I O = 1800 1430
= + 270 ml/hari
2. Memantau tanda vital
Hasil :

O=
k/u lemah
Klien nampak haus
Membrane mukosa kering
TTV :
TD = 110/80 mmHg
RR = 20 x/m
S = 36,5 oC
N = 88 x/m
5. BB sebelum sakit = 45 kg
6. BB sesudah sakit = 42 kg
1.
2.
3.

4.

TTV :
TD = 110/80 mmHg
RR = 20 x/m
S = 36,5 oC
N = 88 x/m

7. TB = 153 cm
8. Minum = 1800 ml/hari
9. BAB = 5x/hari
10. IWL = 630 ml/hari

A = Masalah
keperawatan
ketidakseimbangan
volume
3. Monitor adanya tanda tanda dehidrasi.
cairan kurang dari kebutuhan
Hasil : klien nampak haus, membrane tubuh belum teratasi.
mukosa kering.
4. Menganjurkan untuk minum 1500
2500 ml / hari.
P = Lanjutkan intervensi :
Hasil : minum = 1800 ml/hari
Mandiri :
1. Monitor masukan dan haluaran
5. Mendorong keluarga untuk membantu
2. Monitor tanda vital
klien makan.
3. Observasi adanya tanda
Hasil : keluarga klien tidak ada yang tanda dehidrasi.
membantu klien makan.
4. Evaluasi jumlah minum klien
antara 1500 2500 ml / hari.
6. Tawarkan snack (jus / buah buahan Kolaborasi :
segar) atau makanan kesukaannya.
5. Evaluasi cairan parenteral dan
Hasil : klien makan makanan yang telah elektrolit.
disediakan anaknya.

7. Mempertahankan cairan parenteral dan


elektrolit.
Hasil : klien sering minum air putih atau
air teh.

BAB III
PENUTUP
1.1 KESIMPULAN
Air merupakan bagian terbesar pada tubuh manusia, persentasenya dapat
berubahtergantung pada umur, jenis kelamin dan derajat obesitas seseorang. Pada
bayi usia< 1tahun cairan tubuh adalah sekitar 80-85% berat badan dan pada bayi
usia > 1 tahunmengandung air sebanyak 70-75 %. Seiring dengan pertumbuhan
seseorang persentasejumlah cairan terhadap berat badan berangsur-angsur turun
yaitu pada laki-laki dewasa50-60% berat badan, sedangkan pada wanita dewasa 50
% berat badan.

DAFTAR PUSTAKA
1. Pandey CK, Singh RB. Fluid and electrolyte disorders. Indian J.Anaesh.
2003;47(5):380-387.
2. Kaswiyan U. Terapi cairan perioperatif. Bagian Anestesiologi dan Reanimasi.
Fakultas KEdokteran Unpad/ RS. Hasan Sadikin. 2000.
3. Holte K, Kehlet H. Compensatory fluid administration for preoperative
dehydrationdoes
it improve outcome? Acta Anaesthesiol Scand. 2002; 46: 1089-93
4. Keane PW, Murray PF. Intravenous fluids in minor surgery. Their effect on
recovery
from anaesthesia. 1986; 41: 635-7.
5. Heitz U, Horne MM. Fluid, electrolyte and acid base balance. 5 th ed. Missouri:
Elsevier-mosby; 2005.p3-227
6. Guyton AC, Hall JE.Textbook of medical physiology. 9 th ed. Pennsylvania: W.B.
saunders company; 1997: 375-393
7. Latief AS, dkk. Petunjuk praktis anestesiologi: terapi cairan pada pembedahan.
Ed.
Kedua. Bagian anestesiologi dan terapi intensif, FKUI. 2002
8. Mayer H, Follin SA. Fluid and electrolyte made incredibly easy. 2 nd ed.
Pennsylvania:
Springhouse; 2002:3-189.
9. Schwartz SI, ed. Principles of surgery companion handbook. 7 th ed. New york:
McGraw-Hill; 1999:53-70.
10. Silbernagl F, Lang F. Color atlas of pathophysiology. Stuttgart: Thieme; 2000:
122-3.
11. Lyon Lee. Fluid and Electrolyte Therapy. Oklahoma State University - Center for
Veterinary Health. 2006. (Diakses tanggal 29 September2007). Tersedia dari:
http://member.tripod.com/~lyser/ivfs.htm
12. Leksana E. Terapi cairan dan elektrolit. Smf/bagian anestesi dan terapi intensif
FK
Undip: Semarang; 2004: 1-60.
13. Barash PG, Cullen BF, Stoelting RK. Handbook of clinical anesthesia. 5th ed.
Philadelphia: Lippincot williams and wilkins; 2006: 74-97.
14. Sunatrio S. Resusitasi cairan. Jakarta: Media aesculapius;2000:1-58.
15. Ellsbury DL, George CS. Dehydration. eMed J [serial online] 2006 Mar [dikutip 6
Okt 2007]. Tersedia dari: URL: http://www.emedicine.com/CHILD/topic925.htm.
16. Fakultas Kedokteran Unpad. Protokol Tindakan Bedah. Bandung. 2003
17. Grsaber MA. Terapi cairan, elektrolit dan metabolik. Ed.2. Farmedia; 2003: 1740.

Diposkan 31st March 2012 oleh Inka Februaria

Tambahkan komentar

3
MAR

31

ASUHAN KEPERAWATAN GANGGUAN ISTIRAHAT DAN TIDUR


PADA LANSIA (kelompok9)
ASUHAN KEPERAWATAN GANGGUAN ISTIRAHAT DAN TIDUR PADA LANSIA
DI SUSUN OLEH :
AHMAD RIZKI FAUJI
RISTI WULANDARI
SITI ROHANA
YOGA ADI SAPUTRA
MOHAMAD ARIFIN
AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTAWARINGIN TIMUR
Tahun 2012
SAMPIT

KATA PENGANTAR
Puji syukur kepada Tuhan Yang Maha Esa karena berkat rahmad dan
hidayah-Nya, makalah ini dapat diselesaikan. Makalah ini merupakan makalah
pengetahuan bagi mahasiswa/I Akper Pemkab Kotim maupun para pembaca untuk
bidang Ilmu Pengetahuan.
Makalah ini sendiri dibuat guna memenuhi salah satu tugas kuliah dari
dosen mata kuliah keperawatan Gerontik dengan judul Asuhan Keperawatan
Kebutuhan Istirahat dan Tidur . Dalam penulisan makalah ini penulis berusaha
menyajikan bahasa yang sederhana dan mudah dimengerti oleh para pembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih banyak
kekurangan. Oleh karenanya, penulis menerima kritik dan saran yang positif dan
membangun dari rekan-rekan pembaca untuk penyempurnaan makalah ini.
Penulis juga mengucapkan banyak terima kasih kepada rekan-rekan yang
telah membantu dalam penyelesaian makalah ini.
Akhir kata, semoga makalah ini dapat memberikan manfaat kepada kita
semua. Amin.

Sampit,

Maret 2012
Penulis

DAFTAR ISI
KATA
PENGANTAR .......................................................................................
................
i
DAFTAR
ISI ..................................................................................................
...................
ii
BAB I
PENDAHULUAN
1.1 Latar
Belakang.........................................................................................
1
1.2 Tujuan
Penulisan .....................................................................................
1
1.3 Rumusan Masalah............................................................
........................ 1
1.4 Metode
Penulisan..................................................................................... 2
1.5 Sistematika
Penulisan............................................................................... 2
BAB II
PEMBAHASAN
2.1 Pengertian Istirahat
dan
Tidur ................................................................... 3
2.2 Mekanisme
Tidur...................................................................................... 3
2.3 Tahap

Tahap
Tidur................................................................................. 3
2.4 Kegunaan
Tidur........................................................................................ 4
2.5 Kebutuhan
Tidur
Rata

Rata
Perhari........................................................ 4
2.6 Faktor

Faktor
Yang
Mempengaruhi
Tidur ............................................ 6

2.7 Masalah

masalah
Yang
Terjadi
Saat
Tidur.............................................. 6
2.8 askep
pengkajian................................................................................. 8
BAB III PENUTUP
3.1 KESIMPULAN .....................................................................................
. 11
3.2 SARAN .............................................................................................
...... 11
DAFTAR PUSTAKA

BAB I
PENDAHULUAN
1.1 Latar Belakang
Pada dasarnya istirahat adalah suatu kondisi yang tenang, rileks tanpa ada
stres emosional, bebas dari kecemasan. Namun tidak berarti tidak melakukan
aktivitas apa pun, duduk santai di kursi empuk atau berbaring di atas tempat tidur
juga merupakan bentuk istirahat. Sebagai pembanding, klien/orang sakit tidak
beraktifitas tapi mereka sulit mendapatkan istirahat begitu pula dengan mahasiswa
yang selesai ujian merasa melakukan istirahat dengan jalan-jalan. Oleh karena itu
perawat dalam hal ini berperan dalam menyiapkan lingkungan atau suasana yang
nyaman untuk beristirahat bagi klien/pasien.
Sedangkan Tidur merupakan suatu keadaan perilaku individu yang relatif
tenang disertai peningkatan ambang rangsangan yang tinggi terhadap stimulus
dari luar. Keadaan ini bersifat teratur, silih berganti dengan keadaan
terjaga(bangun), dan mudah dibangunkan, (Hartman). Pendapat lain juga
menyebutkan bahwa tidur merupakan suatu keadaan istirahat yang terjadi dalam
suatu waktu tertentu, berkurangnya kesadaran membantu memperbaiki sistem
tubuh/memulihkan energi. Juga tidur sebagai fenomena di mana terdapat periode

tidak sadar yang disertai perilaku fisik psikis yang berbeda dengan keadaan
terjaga.
Oleh karena itu, penulis akan membahas tentang Pemenuhan Kebutuhan
Istirahat dan Tidur secara lebih lengkap lagi pada makalah ini.
1.2 Tujuan Penulisan
Penulis membuat makalah ini untuk memenuhi tugas dari dosen mata kuliah
Keperawatan Gerontik serta
memberikan informasi dan
ilmu
pengetahuan
tentang Pemenuhan Kebutuhan Istirahat dan Tidur.
1.3 Rumusan Masalah
1. Apa yang dimaksud istirahat?
2. Apa yang dimaksud tidur ?
3. Bagaimana mekanisme tidur ?
4. Apa saja tahap-tahap dalam tidur ?
5. Apa kegunaan tidur ?
6. Bagaimana kebutuhan rata-rata tidur perhari ?
7. Apa saja faktor-faktor yang mempengaruhi tidur ?
8. Apa saja masalah yang terjadi pada saat tidur ?
1.4 Metode Penulisan
Metode yang digunakan dalam penulisan makalah ini yaitu metode
kepustakaan dan mengutip dari sumber-sumber yang dapat dibuktikan
kebenarannya.
1.5 Sistematika Penulisan
Sistematika penulisan makalah ini yaitu Kata Pengantar, Daftar Isi, Bab I
Pendahuluan yang terdiri dari Latar Belakang, Rumusan Masalah, Tujuan Penulisan,
Metode Penulisan, dan Sistematika Penulisan. Bab II Pembahasan. Bab III Penutup
yang terdiri dari Kesimpulan dan Saran. Daftar Pustaka.

BAB II

PEMBAHASAN
PEMENUHAN KEBUTUHAN ISTIRAHAT DAN TIDUR

2.1. Pengertian
Istirahat adalah suatu kondisi yang tenang, rileks tanpa ada stres emosional,
bebas dari kecemasan. Namun tidak berarti tidak melakukan aktivitas apa pun,
duduk santai di kursi empuk atau berbaring di atas tempat tidur juga merupakan
bentuk istirahat. Sebagai pembanding, klien/orang sakit tidak beraktifitas tapi
mereka sulit mendapatkan istirahat begitu pula dengan mahasiswa yang selesai
ujian merasa melakukan istirahat dengan jalan-jalan. Oleh karena itu perawat
dalam hal ini berperan dalam menyiapkan lingkungan atau suasana yang nyaman
untuk beristirahat bagi klien/pasien.
Menurut Narrow (1645-1967) terdapat enam kondisi seseorang dapat
beristirahat : Merasa segala sesuatu berjalan normal ; Merasa diterima ; Merasa
diri mengerti apa yang sedang berlangsung ; Bebas dari perlukaan dan ketidak
nyamanan ; Merasa puas telah melakukan aktifitas-aktifitas yang berguna ;
Mengetahui bahwa mereka akan mendapat pertolongan bila membutuhkannya.
Tidur merupakan suatu keadaan perilaku individu yang relatif tenang
disertai peningkatan ambang rangsangan yang tinggi terhadap stimulus dari luar.
Keadaan ini bersifat teratur, silih berganti dengan keadaan terjaga(bangun), dan
mudah dibangunkan, (Hartman). Pendapat lain juga menyebutkan bahwa tidur
merupakan suatu keadaan istirahat yang terjadi dalam suatu waktu tertentu,
berkurangnya kesadaran membantu memperbaiki sistem tubuh/memulihkan
energi. Juga tidur sebagai fenomena di mana terdapat periode tidak sadar yang
disertai perilaku fisik psikis yang berbeda dengan keadaan terjaga.
2.2. Mekanisme Tidur
Teori Chemics : peningkatan CO2 menyebabkan rasa ngantuk.
Teori Vaskuler : penurunan TD di otak yang menyebabkan rasa ngantuk.
Salah satu fungsi kelenjar hipofise sebagai pusat pengaturan tidur.
Para Ahli neurifisiologis : sekresi hormone serotonin yang menyebabkan rasa
ngantuk
Teori Feed Back : Kelemahan sel-sel saraf yang menyebabkan rasa ngantuk
Instink/Naluri

o
o

2.3. Tahap Tahap Tidur


Tanda-tanda menjelang tidur :
Suhu badan (SB) menurun
Pernapasan melambat
Otot2 rileks
Menguap.(tanda tubuh beradaptasi akibat pernapasan melambat)
Basic Rest Activity Cycle (BRAC):
NREM (Non Rapid Eye Movement)
Slow wave sleep, yang terdiri dari 4 tahap :
Tahap I :
Mulai saat hilangnya Gel Alpha yang biasa terdapat pada seseorag yang sedang
terjaga.
Muncul gel2 yang tidak sinkron, frekuensi bercampuran dan voltase rendah.

o Merasa ingin tidur, bila banyak pikiran akan mudah dibangunkan.


o Merupakan tidur paling dangkal, berlangsung selama beberapa detik beberapa
menit.
Tahap II :
o Merupakan tidur yang tidak dalam.
o Muncul gel yang berbentuk seperti spindel dengan voltase lebih tinggi, runcing2
(Gel K)
o Berlangsung 5-10 menit.
Tahap III :
o Merupakan tidur yang dalam.
o Muncul gel Deltha, yang lambat dengan amplitudo besar, tinggi dan dalam.
o Biasanya sulit dibangunkan.
o Berlangsung 10 menit
Tahap IV :
o Tidur yang paling dalam.
o Pada EEG dipenuhi Gel Deltha.
o Sangat sulit dibangunkan.
o Terjadi mimpi sehubungan dengan kejadian sehari sebelumnya.
o Lamanya 5-15 menit
o Terjadi perubahan fisik :
o Nadi & pernapasan melambat
o TD turun
o Otot-otot sangat rileks
o Basal metabolisme dan SB menurun
REM (Rapid Eye Movement)
Paradoksical sleep- sebagai puncak Tidur :
Sangat sulit dibangunkan.
Pada orang dewasa tahap ini 20-25% dari tidur malam, bila seseorang terbangun
pada tahap ini mereka dapat mengingat mimpi mereka.
Biasanya terjadi 80-100 menit setelah orang tertidur.
Semakin lelah seseorang makin cepat mengalami tahap ini .
Karakteristik Tahap REM :
Terjadi pada tahap II NREM dan berlangsung selama 5-10 menit.
Kembali ke tahap II NREM lagi.
Saat perpindahan dari NREM ke REM biasanya terjadi hentakan otak yang tidak
disadari.
TD menngkat.
Sekresi getah/asam lambung meningkat
Basal metabolisme dan SB meningkat
Terjadi mimpi yang menyenangkan, bersemangat dan sibuk.
Orang yang tidak mengalami periode REM biasanya tidak merasa puas dengan
tidurnya.
Orang biasanya mengalami 4-5x masa REM
2.4. Kegunaan Tidur (Delment & Wolman )
Beradaptasi terhadap rangsangan yang dapat menimbulkan kecemasan.
Memperbaiki ingatan.
Mempermudah mempelajari sesuatu serta dalam mengatasi masalah-masalah yang
sulit.

Relaksasi
2.5. Kebutuhan Tidur Rata Rata Perhari
Bayi baru lahir : Lama tidur 14-18 jam/hari dengan 50% REM dan 1 siklus tidur
rata-rata 45-60 menit
Bayi(s/d 1 thn) : 1 siklus tidur rata2 12-14 jam/hari dengan 20-30% REM dan tidur
sepanjang malam
Todler(1-3 thn): Lama tidur 11-12 jam/hari dengan 25% REM dan Tidur sepanjang
malam + tidur siang
Pra sekolah : 11 jam/hari dengan 20% REM
Usia sekolah : 10 jam/hari dengan 18,5% REM
Usia sekolah : 10 jam/hari dengan 18,5% REM
Adolescent : 8,5 jam/hari dengan 20% REM
Dewasa muda : 7-8 jam/hari dengan 20-25% REM
Dewasa menengah : 7 jam/hari dengan 20% REM dan sering sulit tidur
Dewasa tua : 6 jam/hari dengan 20-25% REM dan sering sulit tidur
2.6. Faktor Faktor Yang Mempengaruhi Tidur
1.Umur
Semakin bertambah umur manusia semakin berkurang total waktu kebutuhan tidur.
Hal ini dipengaruhi oleh pertumbuhan dan fisiologis dari sel-sel dan organ, pada
neonati kebutuhan tidur tinggi karena masih dalam proses adaptasi dengan
lingkungan dari dalam rahim ibu, sedangkan pada lansia sudah mulai terjadi
degenerasi sel dan organ yang mempengaruhi fungsi dan mekanisme tidur.
2.Penyakit
Hal ini umumnya terjadi pada klien dengan nyeri, kecemasan, dispnea. Pada kasus
penyakit akibat digigit nyamuk tse-tse. Juga pada kasus tertentu dengan klien
gangguan hipertiroid.
3.Motivasi
Niat seseorang untuk tidur mempengaruhi kualitas tidur seperti menonton, main
game atau hal-hal lain yang dapat menyebabkan penundaan waktu anda untuk
tidur.
4.Emosi
Suasana hati, marah, cemas dan stres dapat menyebabkan seseorang tidak bisa
tidur atau mempertahankan tidur.
5.Lingkungan
Lingkungan yang tidak kondusif seperti di dekat bandara atau di tepi jalan-jalan
umum atau di tempat-tempat umum yang menimbulkan kebisingan.
6.Obat obatan
penggunaan atau ketergantungan pada penggunaan obar-obat tertentu seperti
golongan sedative, hipnotika dan steroid.
7.Makanan dan minuman
Pola dan konsumsi makanan yang mengandung merica, gas/air yang banyak, pola
dan konsumsi minuman yang mengandung kafein ,gas dll.
8.Aktivitas.
Kurang beraktivitas dan atau melakukan aktivitas yang berlebihan justru akan
menyebabkan kesulitan untuk memulai tidur.
2.7. Masalah Masalah Yang Terjadi Pada Saat Tidur
Insomnia, merupakan suatu keadaan di mana seseorang sulit untuk memulai
atau mempertahankan keadaan tidurnya.

Narkolepsi, merupakan suatu keadaan tidur di mana seseorang sulit


mempertahankan keadaan terjaga/bangun/sadar. Penderita akan sering mengantuk
hingga dapat tertidur secara tiba-tiba.
Somnabulisme atau disebut tidur berjalan.
Enuresa atau ngompol
Nocturia, merupakan suatu keadaan di mana klien sering terbangun pada
malam hari untuk buang air kecil/BAK.
Apnea/tidak bernapas dan Mendengkur.
Delirium/Mengigau.
Sehubungan dengan gangguan penyakit seperti pain, anxiety dan dispneu.
Nightmares dan Nightterros (mimpi buruk)
Tidur dan stadium penyakit (digigit nyamuk tse-tse)

DINAS KESEHATAN PEMERINTAH KABUPATEN

KOTAWARINGIN TIMUR
AKADEMI KEPERAWATAN PEMKAB KOTIM
Jalan Batu Berlian Nomor 11 Telp.(0531)22960/ Fax (0531)22940 Sampit
Kode pos :
74322

FORMAT PENGKAJIAN INDIVIDU


ASUHAN KEPERAWATAN GERONTIK
Maret 2012
A. DATA BIOGRAFI
Nama
: Tn. M
TTL
: Bandung, 14 maret 1925
Jenis Kelamin
: Laki laki ,Gol.Darah :O
Pendidikan
: SD

Tanggal Pengkajian : 25

Agama
: Islam
Status Perkawinan : Kawin
TB/BB
: 165 cm,. 60 kg
Penampilan
: Bersih dan rapi, Ciri-ciri tubuh : berambut pendek, berwarna
putih, bentuk tubuh bungkuk,berjanggut
Alamat
: Kel.Kota Besi Hulu RT/RW 05 /02
Kec.Kota Besi ....Telp/HP 085753394881
Kabupaten Kotawaringin Timur
Orang Yang Dekat
:Ny. T
Hubungan
: istri
Alamat/ Telpon : kota besi /082154560570
B. RIWAYAT KEPERAWATAN
1.
Genogram

Keterangan :

: Laki laki

Garis Keturunan
: Perempuan
Serumah
Hubungan
2.

.......
:

: Tinggal
Garis

: Meninggal

Riwayat Keluarga
..Di dalam keluarga klien tidak ada yang menderita penyakit menurun seperti DM,
Hipertensi, Asma Dan menular seperti Hepatitis, TBC dan lain lain.

C.RIWAYAT PEKERJAAN
Pekerjaan saat ini
: tidak ada
Alamat pekerjaan
: Jarak dari rumah
: - ......................km/meter*
Alat transportasi
: Pekerjaan sebelumnya
: PERUN TNI AD
Jarak dari rumah
: 20 km/meter*
Alat transportasi
: Tidak ada
Sumber-sumber pendapatan & kecukupan terhadap kebutuhan: sumber sumber
pendapatan d dapat dari anak dan sudah dapat memenuhi kebutuhan sehari-hari.
D.RIWAYAT LINGKUNGAN HIDUP
Type tembat tinggal
: Rumah
Jenis lantai rumah
: Keramik
Kondisi lantai
: Kering
Tangga rumah
: Tidak ada
Penerangan
: cukup
Tempat tidur
: aman (pagar pembatas,tidak terlalu tinggi)
Alat dapur
: tertata rapi
WC
Ada
: aman (posisi duduk ,ada pegangan )
Kebersihan lingkungan
: bersih (tidak ada barang membahayakan)
Jumlah orang yang tinggal dalam satu rumah : 6 orang
Derajat privasi : klien, 1 istri, 1 anak, 1 menantu, 2 cucu.
Tetangga Terdekat : ada
Alamat dan Telepon :.kota besi (0851546505670)
E.RIWAYAT REKREASI
Hobby atau Minat : memancing dan memelihara ayam dan bunga
Keanggotaan organisasi : tidak ada
Liburan atau Perjalanan :jalan jalan ke pantai dan ketempat anak
F.SISTEM PENDUKUNG
Perawat/Bidan/Dokter/Fisioterafi* : ada
Jarak dari rumah
: 20 km/meter*
Rumah Sakit
: Ada ,Jarak 5 km
Klinik
: tidak ada
jarak
Pelayanan Kesehatan Di rumah
: tidak ada
Makanan yang dihantarkan
: tidak ada
Perawatan sehari-hari yang dilakukan keluarga: tidak ada
Lain-lain
G.DESKRIPSI KEKHUSUSAN
Kebiasaan Ritual
: sholat 5 waktu
Yang lainnya
: Tidak ada
H.STATUS KESEHATAN

km

Status Kesehatan umum Selama setahun yang lalu: klien pernah menderita
demam,sakit kepala, flu,batuk, maag, dan hernia. Yang sering kambuh yaitu maag.
Status kesehatan umum selama 5 tahun yang lalu : klien menderita hernia.
Keluhan Utama: nyeri ulu hati
1.Provocative / Paliative
: imflamasi mukosa lambung
2.Quality/ Quantity
: tertusuk tusuk jarum
3.Region
: Epigastrium
4.Severity Scale
: skala nyeri 3(0-10)
5.Timing
: kalau telat makan( kadang-kadang)
Pemahaman & Penatalaksanaan Masalah Kesehatan : Apabila kambuh klien minum
obat promaag.
Obat-obatan :
NO
1.
2.

NAMA OBAT
Paracetamol
Promaag

Alergi (Catatan Agent dan Reaksi Spesifik)


Obat-obatan
: Tidak ada
Makanan
: tidak ada
Faktor Lingkungan : tidak ada

DOSIS
500mg
250mg

KETERANGAN
Sesudah makan
Sebelum makan

Penyakit yang diderita :


Hipertensi

Rheumatoid

Asthm

a
Dimensia
Lain-lainnya sebutkan: hernia
I.AKTIVITAS HIDUP SEHARI-HARI (ADL)
Indeks KATZ
: A
Oksigenasi
: kebutuhan oksigenasi klien terpenuhi
Cairan dan Elektrolit
: klien minum air 1500ml/hari
Nutrisi
: klien makan 3x sehari lengkap dengan nasi, sayur,
dan lauk pauknya.
Eliminasi
: klien BAB 1x sehari dan BAK >3x sehari
Aktivitas
: klien hanya dirumah memelihara ayam dan bunga
Istirahat dan Tidur
: klien siang tidur dari jam 12.00 13.00 dan malam
dari jam 20.00 04.00. Kwantitas : klien sering terbangun, setiap jam klien
terbangun dan susah untuk memulai tidur lagi.
Personal Hygiene
: 2x sehari
Seksual
: 1bulan sekali
Rekreasi
: kepantai dan memancing
J. PSIKOLOGI,KOGNITIF DAN PERSEPTUAL
Konsep Diri
: Klien puas dengan keadaan dirinya

Emosi
: terkontrol
Adaptasi
: klien mampu beradaptasi dengan baik.
Mekanisme Pertahanan diri : Baik
Status mental
:
Tingkat Kesadaran
: komposmentis
Afasia
:Dimensia
: tidak
Orientasi
: normal
Bicara
: normal
Bahasa yang digunakan
: bahasa indonesia, banjar dan sunda
Kemampuan membaca
: bisa
Kemampuan interaksi
: sesuai
Vertigo
:
tidak
Short Porteble Mental Status Questionaire (SPMSQ) = Fungsi mental utuh
Mini Mental State Exam (MMSE)= baik nilai kesalahan : 1
Geriatrik Depresion Scale
= Tidak depresi nilai: 4
APGAR
=
K.TINJAUAN SISTEM
Keadaan Umum
Tingkat Kesadaran
Tanda tanda Vital

: Baik
:Composmentis
: TD 140 / 90 mmHg
Nadi: 80 x/menit
RR
20 X/menit
Suhu : 36 0c
BB:
60 Kg

TB : 165 cm
PENGKAJIAN PERSISTEM
PERNAFASAN (B1: BREATHING)
1.Bentuk dada
: simetris
2.Sekresi dan Batuk
: Tidak ada
3.Pola nafas
Frekwensi Nafas :
20 x/menit
4.Bunyi nafas : Normal
5.Pergerakan dada
Intercostal
Clavicula

Tracheal Tag
Substernal

Supra
Lain lain
Suprasternal

Flail Chest

6.Tractil Fremitis/Fremitus Vokal


Meningkat
lokasi
Menurun

lokasi

Lain-lain
7.Alat Bantu Pernafasan
Nasal
Masker

Bag and Mask


Respirator

CARDIOVASKULER ( B2 : BLEEDING )
1.Nadi
Frekuensi.........80.........................x/menit

Tracheostomi

Reguler

Kuat

Irreguler

Lemah

2.Bunyi Jantung
Normal
Tambahan

Ada

Tidak,Jenis..............

3.Letak Jantung
Ictus cordis teraba pada.................
4.Pembesaran Jantung
: Tidak
5.Nyeri Dada
: Tidak
6.Edema :
Palpebra
Anasarka
Asites

Tidak Ada

Ekstrimitas atas
Ekstrimitas bawah

Lainnya.........................
7.Clubbing Finger

1.
a.
b.
c.
d.
e.
f.
2.
a.
b.
3.
a.
b.
c.
d.
e.
4.
5.

: Tidak

PERSYARAFAN (B3 : BRAIN )


Tingkat Kesadaran : Kompos mentis
1.GCS :
Eye :......4........ Verbal :.....6........ Motorik :.5.................
Total GCS : 15
2.Refleks
: normal
3.Koordinasi Gerak
: Tidak
4.Kejang
:Tidak
5.Lain-lain..........................................
PENGINDERAAN ( PERSEPSI SENSORI )
Mata ( Penglihatan )
Bentuk
: Normal
Visus.....................
Pupil : isokor
Gerak bola Mata : normal
Medan Penglihatan : normal
Buta Warna
: tidak
Tekanan intra okuler : tidak
Hidung (Penciuman )
Bentuk
:
Normal
Gangguan Penciuman
:
Ya
Telinga ( Pendengaran )
Aurikel
Membran tympani
Otorrhoea
Gangguan Pendengaran
Tinitus
Perasa
Peraba

: Normal
: Terang
: Tidak ada
: Tidak
: Tidak
: normal
: normal

PERKEMIHAN ELIMINASI URI ( B4 : BLADDER )

Masalah Kandung Kemih


: tidak ada masalah
Produksi Urine 700 ml/hari
Frekuensi > 3x /hari
Warna kuning kecoklatan ,Bau khas amoniak

1.
a.
b.
c.
d.
e.
f.
g.
h.
i.

PENCERNAAN ELIMINASI ALVI ( B5 : BOWEL)


Mulut dan Tenggorokan
Mulut
Selaput Lendir Mulut : lembab
Lidah : bersih
Kebersihan Rongga Mulut : Tidak berbau
Tenggorokan
: tidak ada masalah
Abdomen
: Nyeri tekan,lokasi epigastrium
Pembesaran hepar
tidak ada
Pembesaran Lien
tidak ada
Asites
tidak ada
Lain lain : tidak ada

2.

Masalah usus besar dan rektum/anus


BAB 1 X/hari
Tidak ada masalah
OTOT,TULANG DAN INTEGUMENT ( B6 : BONE )
1.
Otot dan Tulang
Kemampuan pergerakan sendi lengan dan tungkai ( ROM )
Kemampuan kekuatan otot
: Bebas
Fraktur
: Tidak ada
Dislokasi
: Tidak ada
Haematom
: Tidak ada
2.
Integumen
Warna Kulit : cokelat
Turgor :Elastik
Tulang Belakang
: kiposis
Akral
: hangat
REPRODUKSI
Laki laki :
Kelamin
bentuk
pembesaran pada alat kelamin.
Kebersihan Alat Kelamin
: Bersih

ENDOKRIN
Faktor Alergi : tidak ada
Manifestasi : tidak ada
Cara Mengatasi : tidak ada
2.
Kelainan endokrin: tidak ada masalah.
1.

PENGETAHUAN :
Pengetahuan klien tentang kesehatan dirinya:

tidak

normal,keterangan

terjadi

.klien menganggap bahwa kesehatan dirinya itu sangatlah penting.sehingga klien


rutin melakukan control.

Sampit, Maret 2012


Mahasiswa yang mengkaji,

.........................................
NIM.
ANALISA DATA
NO
1.

DATA
S: saya sering terbangun apabila
tidur malam
O : - ku baik
- konjungtiva anemis
- klien setiap 1 jam
bangun
apabila tidur malam
-klien tampak lelah
-klien menguap
- TD 140/90 mmHg
N 80 x/ menit
RR 20x/ menit
S 36 C
Kuantitas tidur malam dari
jam 20.00 04.00
Kuantitas tidur siang dari
jam 12.00 13.00

ETIOLOGI
Ketidak normalan
status fisiologi

PROBLEM
Gangguan rasa
nyaman(istirahat
tidur)

RENCANA KEPERAWATAN
No
.
1

Dx.
Kep.
1

Tujuan

Intervensi

Setelah dilakukan 1.
tindakan
keperawatan
diharapkan gangguan
istirahat tidur tidak
terjadi,dengan 2.
criteria hasil:
1.
Klien tampak
rileks dan lebih segar
2.
Ttv dalam batas
normal
3.
3.
Klien dapat tidur
6-8 jam setiap
4.
malam.

Rasional

Lakukan pengkajian 1.
Memberikan informasi
masalah gangguan
dasar dalam menentukan
tidur klien,
rencana keperawatan.
karakteristik dan
2.
Mengatur pola tidur.
penyebab kurang tidur.3.
Meningkatkan tidur.
Lakukan persiapan 4.
Meningkatkan tidur.
untuk tidur malam
5.
Meningkatkan tidur.
seperti pada jam 9
6.
Meningkatkan tidur.
malam sesuaidengan 7.
Mengurangi gangguan
pola tidur klien.
tidur.
Lakukan mandi air 8.
Mengurangi gangguan
hangat.
tidur.
Anjurkan makan yang9.
Mengurangi gangguan
cukup satu jam sebelum tidur.
tidur.
10. Mengurangi tidur.
5.
Berikan susu hangat 11. Meningkatkan
pola
sebelum tidur.
tidur.
6.
Keadaan tempat
tidur yang nyaman,
bersih dan bantal yang
nyaman.
7.
Bunyi telepon dan
alarm hp di kecilkan.
8.

Berikan pengobatan
seperti analgetik dan
sedative,setengah jam
sebelum tidur.

9.

Lakukan masase pada


daerah belakang, tutup
jendela/pintu jika
perlu.
10. Tingkatkan aktivitas
sehari hari dan
kurangi aktivitas
sebellum tidur.
11. Pengetahuan
kesehatan : jadwal
tidur mengurangi
stress , cemas , dan
latihan relaksasi.
IMPLEMENTASI

No.
1. 1
.

Dx.
Kep.
1
1.

Implementasi

Evaluasi

melakukan pengkajian masalah


S : klien mengatakan saya
gangguan tidur klien, karakteristik dan masih sering terbangun pada
penyebab kurang tidur.
malam hari
Hasil : klien sering terbangun pada
O : - : - ku baik
malam hari
- konjungtiva anemis
2.
menganjurkan klien untuk tidur
- klien setiap 1 jam
malam seperti pada jam 9 malam
bangun
apabila tidur
sesuaidengan pola tidur klien.
malam
Hasil : klien tidur jam 20.00 04.00 wib
-klien tampak lelah
3.
anjurkan keluarga klien untuk
-klien menguap
memberikan Keadaan tempat tidur yang
- TD : 140/90 mmHg
nyaman, bersih dan bantal yang
N : 80 x/ menit
nyaman.
RR : 20x/ menit
Hasil : keluarga klien menuruti anjuran
S : 36 C
ersebut..
Kuantitas tidur malam
4.
meningkatkan aktivitas sehari hari
dari jam 20.00 04.00
dan kurangi aktivitas sebellum tidur.
Kuantitas tidur siang dari
Hasil : klien tidak melakukan kegiatan
jam 12.00 13.00
sebelum tidur
A ; masalah belum teratasi
.
P : lanjutkan intervensi

BAB III
PENUTUP
A.

KESIMPULAN
Istirahat adalah suatu kondisi yang tenang, rileks tanpa ada tress emosional, bebas
dari kecemasan. Namun tidak berarti tidak melakukan aktivitas apa pun, duduk
santai di kursi empuk atau berbaring di atas tempat tidur juga merupakan bentuk
istirahat. Sebagai pembanding, klien/orang sakit tidak beraktifitas tapi mereka
sulit mendapatkan istirahat begitu pula dengan mahasiswa yang selesai ujian
merasa melakukan istirahat dengan jalan-jalan

B.

SARAN
Oleh karena itu perawat dalam hal ini berperan dalam menyiapkan lingkungan
atau suasana yang nyaman untuk beristirahat bagi klien/pasien.

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

4
MAR

31

ASUHAN KEPERAWATAN GERONTIK PADA Ny. S DENGAN


MASALAH GANGGUAN SEKSUAL (kelompok7)
LAPORAN PENDAHULUAN
ASUHAN KEPERAWATAN GERONTIK PADA Ny. S
DENGAN MASALAH GANGGUAN SEKSUAL

KELOMPOK 7:
ENDAH MURNI
REZKY FAHRUDINUR RAMADHAN
TRI NURWAHYUNI

AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTA WARINGIN TIMUR
JL. BATU BERLIAN NO.II TELP. (0531) 22960
2012
KATA PENGANTAR
Puji syukur kepada Tuhan Yang Maha Esa karena berkat taufik dan hidayah-Nya, makalah ini
dapat diselesaikan. Makalah ini merupakan makalah pengetahuan bagi mahasiswa/i akper pemkab
kotim maupun para pembaca untuk bidang Ilmu Pengetahuan.
Makalah ini sendiri dibuat guna memenuhi salah satu tugas kuliah dari dosen mata kuliah
Keperawatan Anak I dengan judul ASUHAN KEPERAWATAN GERONTIK PADA NY. S DENGAN
MASALAH GANGGUAN SEKSUAL. Dalam penulisan makalah ini penulis berusaha menyajikan
bahasa yang sederhana dan mudah dimengerti oleh para pembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih banyak kekurangan.
Oleh karenanya, penulis menerima kritik dan saran yang positif dan membangun dari rekan-rekan

pembaca untuk penyempurnaan makalah ini. Penulis juga mengucapkan banyak terima kasih kepada
rekan-rekan yang telah membantu dalam penyelesaian makalah ini.
Akhir kata, semoga makalah ini dapat memberikan manfaat kepada kita semua. Amin.

Sampit,

Maret 2012

Penulis

DAFTAR ISI
HALAMAN JUDUL...............................................................................................................

KATA PENGANTAR ............................................................................................................

ii

DAFTAR ISI ........................................................................................................................

iii

BAB I

PENDAHULUAN
1.1 LATAR BELAKANG ...................................................................................

BAB II
2.1.. LAPORAN

1.2 TUJUAN PENULISAN ................................................................................

1.3 RUMUSAN MASALAH................................................................................

1.4 METODE PENULISAN...............................................................................

1.5 SISTEMATIKA PENULISAN........................................................................

PEMBAHASAN
PENDAHULUAN

ASUHAN

KEPERAWATAN

GERONTIK

PADA

NY

DENGAN

GANGGUAN SEKSUAL
A. Perubahan anatomik sistem genetalia pada lansia.................
B. Perubahan fisiologik aktivitas seksual akibat proses penuaan bila ditinjau dari pembagian tahapan
seksual menurut Kaplan..........................
C. Di samping faktor perubahan fisik, faktor psikologi juga sering kali menyebabkan penurunan fungsi
dan potensi seksual pada lanjut usia........
D. Beberapa hal yang dapat menyebabkan masalah kehidupan sosial
E. Upaya mengatasi permasalahan seksual pada lansia............
F. ............................................................................................................
G. PENATALAKSANAAN...........................................................................
H. MASALAH KEPERAWATAN..................................................................
I.

DIAGNOSA KEPERAWATAN.................................................................

J. RENCANA KEPERAWATAN..................................................................
DAFTAR KEPUSTAKAAN
2.2.. LAPORAN KASUS ASUHAN KEPERAWATAN GERONTIK PADA NY DENGAN GANGGUAN
SEKSUAL
PENGKAJIAN............................................................................................

15

ANALISA DATA.........................................................................................

18

RENCANA KEPERAWATAN.......................................................................
BAB III

19

PENUTUP

3.1 KESIMPULAN ............................................................................................


3.2 SARAN .....................................................................................................

22
22

DAFTAR PUSTAKA
BAB I
PENDAHULUAN
A.

Latar Belakang
Kehidupan seksual merupakan bagian dari kehidupan manusia, sehingga kualitas kehidupan
seksual ikut menentukan kualitas hidup. Hubungan seksual yang sehat adalah hubungan seksual
yang dikehendaki, dapat dinikmati bersama pasangan suami dan istri dan tidak menimbulkan akibat
buruk baik fisik maupun psikis termasuk dalam hal ini pasangan lansia.
Dewasa lanjut (Late adult hood) atau lebih dikenal dengan istilah lansia adalah periode
dimana seseorang telah mencapai usia diatas 45 tahun. Pada periode ini masalah seksual masih
mendatangkan pandangan bias terutama pada wanita yang menikah, termasuk didalamnya aspek
sosio-ekonomi. Pada pria lansia masalah terbesar adalah masalah psikis dan jasmani, sedangkan
pada wanita lansia lebih didominasi oleh perasaan usia tua atau merasa tua.
Pada penelitian di negara barat, pandangan bias tersebut jelas terlihat. Penelitian Kinsey
yang mengambil sampel ribuan orang, ternyata hanya mengambil 31 wanita dan 48 pria yang berusia
diatas 65 tahun. Penelitian Masters-Jonhson juga terutama mengambil sampel mereka yang berusia
antara 50-70 tahun, sedang penelitian Hite dengan 1066 sampel hanya memasukkan 6 orang wanita
berusia di atas 70 tahun(Alexander and Allison,1995).
Penelitian akhir-akhir ini menunjukkan bahwa:

Banyak golongan lansia tetap menjalankan aktifitas seksual sampai usia yang cukup lanjut, dan
aktifitas tersebut hanya dibatasi oleh status kesehatan dan ketiadaan pasangan.

Aktifitas dan perhatian seksual pasangan suami istri lansia yang sehat berkaitan dengan pengalaman
seksual kedua pasangan tersebut sebelumnya.

Mengingat bahwa kemungkinan hidup seorang wanita lebih panjang dari pria, seorang wanita lansia
yang ditinggal mati suaminya akan sulit untuk menemukan pasangan hidup.
Saat ini jumlah wanita di Indonesia yang memiliki Usia Harapan Hidup (UHH) diatas 45 tahun
lebih meningkat dan pada usia tersebut wanita masih berharap dapat melakukan hubungan seksual
secara normal. Karena faktor usia, hubungan seksual pada lansia umumnya memiliki frekwensi yang
relatif rendah, sehingga diperlukan suatu penelaahan tentang masalah seksual pada lansia.
Fenomena sekarang, tidak semua lansia dapat merasakan kehidupan seksual yang
harmonis. Ada tiga penyebab mengapa kehidupan seksual tidak harmonis. Pertama, komunikasi
seksual diantara pasangan tidak baik. Kedua, pengetahuan seksual tidak benar. Ketiga karena
gangguan fungsi seksual pada salah satu maupun kedua pihak bisa karena perubahan fisiologis
maupun patologis.
Agar kualitas hidup lansia tidak sampai terganggu karena masalah seksual, maka setiap
disfungsi seksual harus segra diatasi dengan cara yang benar dan ilmiah. Yang perlu diperhatikan
dalam penanganan disfungsi seksual ialah pertama kita harus menentukan jenis disfungsi seksual
dengan tepat, mencari penyebabnya, memberikan pengobatan sesuai penyebab dan untuk
memperbaiki fungsi seksual seperti dijelaskan dalam makalah ini.

B.
1.

Tujuan
Tujuan Umum
Mengetahui masalah seksual pada masa usia lanjut

2.

Tujuan Khusus

a.

Mengetahui karakteristik masa usia lanjut

b.

Mengetahui perubahan-perubahan pada masa usia lanjut

c.

Mengetahui masalah seksual pada masa usia lanjut

d.

Mengetahui perubahan seksual pada pria lansia

e.

Mengetahui perubahan seksual pada wanita lansia

f.

Mengetahui cara mengatasi permasalah seksual pada masa usia lanjut

C.
1.

Manfaat
Bagi mahasiswa
Merupakan sumber tambahan informasi dan pengetahuan tentang permasalahan seksual pada masa
usia lanjut sebagai acuan dalam memberikan pelayanan kebidanan pada saat praktik lapangan.

2.

Bagi institusi dan civitas akademika


Mengukur pengetahuan dan pengalaman mahasiswa dalam menyusun suatu makalah dengan
mengambil dari berbagai sumber literature serta dijadikan sebagai sumber bacaan tambahan di
perpustakaan

D.

Rumusan Masalah

1.

Apa perubahan anatomik sistem genetalia pada lansia?

2.

Apa perubahan fisiologik aktivitas seksual akibat proses penuaan bila ditinjau dari pembagian
tahapan seksual?

3.

Apa di samping faktor perubahan fisik, faktor psikologi juga sering kali menyebabkan penurunan
fungsi dan potensi seksual pada lanjut usia?

4.

Apa beberapa hal yang dapat menyebabkan masalah kehidupan social?

5.

Apa upaya mengatasi permasalahan seksual pada lansia?

E.

Metode Penulisan
Metode yang digunakan dalam penulisan makalah ini yaitu metode deskriptif dengan
menggunakan studi melalui pendekatan proses keperawatan dengan langkah-langkah pengkajian,
perumusan diagnosa, perencanaan, pelaksanaan dan evaluasi. Tehnik pengumpulan data yaitu
dengan menggunakan studi kepustakaan yaitu mempelajari Dokumentasi Keperawatan serta sumbersumber lainnya yang berhubungan dengan judul makalah dan masalah yang dibahas

F.

Sistematika Penulisan
Sistematika penulisan makalah ini yaitu Kata Pengantar, Daftar Isi, Bab I Pendahuluan yang
terdiri dari Latar Belakang, Rumusan Masalah, Tujuan Penulisan, Metode Penulisan, dan Sistematika

Penulisan. Bab II Pembahasan. Bab III Penutup yang terdiri dari Kesimpulan dan Saran. Daftar
Pustaka.

BAB II
PEMBAHASAN
A. Perubahan anatomik sistem genetalia pada lansia
1.

Wanita
Dengan berhentinya produksinya hormon estrogen, genitalia interna dan eksterna berangsurangsur mengalami atrofi.

Vagina
Vagina mengalami kontraktur, panjang dan lebar vagina mengalami pengecilan. Fornises
menjadi dangkal, begitu pula serviks tidak lagi menonjol ke dalam vagina. Sejak klimakterium, vagina
berangsur-angsur mengalami atropi, meskipun pada wanita belum pernah melahirkan. Kelenjar seks
mengecil dan berhenti berfungsi. Mukosa genitalia menipis begitu pula jaringan sub-mukosa tidak
lagi mempertahankan elastisitasnya akibat fibrosis.
Perubahan ini sampai batas tertentu dipengaruhi oleh keberlangsungan koitus, artinya
makin lama kegiatan tersebut dilakukan kurang laju pendangkalan atau pengecilan genitalia eksterna.

Uterus
Setelah klimaterium uterus mengalami atrofi, panjangnya menyusut dan dindingnya menipis,
miometrium menjadi sedikit dan lebih banyak jaringan fibrotik. Serviks menyusut tidak menonjol,
bahkan lama-lama akan merata dengan dinding jaringan.

Ovarium
Setelah menopause, ukuran sel telur mengecil dan permukaannya menjadi keriput sebagai
akibat atrofi dari medula, bukan akibat dari ovulasi yang berulang sebelumnya, permukaan ovarium
menjadi rata lagi seperti anak oleh karena tidak terdapat folikel. Secara umum, perubahan fisik
genetalia interna dan eksterna dipengaruhi oleh fungsi ovarium. Bila ovarium berhenti berfungsi, pada
umumnya terjadi atrofi dan terjadi inaktivitas organ yang pertumbuhannya oleh hormon estrogen dan
progesteron.

Payudara (Glandula Mamae)


Payudara akan menyusut dan menjadi datar, kecuali pada wanita yang gemuk, dimana
payudara tetap besar dan menggantung. Keadaan ini disebabkan oleh karena atrofi hanya
mempengaruhi kelenjar payudara saja. Kelenjar pituari anterior mempengaruhi secara histologik
maupun fungsional, begitu pula kelenjar tiroid dan adrenal menjadi keras dan mengkibatkan bentuk
tubuh serupa akromegali ringan. Bahu menjadi gemuk dan garis pinggang menghilang. Kadang
timbul pertumbuhan rambut pada wajah. Rambut ketiak, pubis mengurang, oleh karena
pertumbuhannya dipengaruhi oleh kelenjar adrenal dan bukan kelenjar ovarium. Rambut kepala
menjadi jarang. Kenaikan berat badan sering terjadi pada masa klimakterik.

2.

Pria
Prostat
Pembesaran prostat merupakan kejadian yang sering pada pria lansia, gejala yang timbul
merupakan efek mekanik akibat pembesaran lobus medius yang kemudian seolah-olah bertindak
sebagai katup yang berbentuk bola (Ball Valve Effect). Disamping itu terdapat efek dinamik dari otot
polos yang merupakan 40% dari komponen kelenjar, kapsul dan leher kantong kemih, otot polos ini
dibawah pengaruh sistem alfa adrenergik. Timbulnya nodul mikroskopik sudah terlihat pada usia 2530 tahun dan terdapat pada 60% pria berusia 60 tahun, 90% pada pria berusia 85 tahun, tetapi
hanya 50% yang menjadi BPH Makroskopik dan dari itu hanya 50% berkembang menjadi BPH klinik
yang menimbulkan problem medik.
Kadar dehidrosteron pada orang tua meningkat karena meningkatnya enzim 5 alfa reduktase
yang mengkonfersi tetosteron menjadi dehidro steron. Ini yang dianggap menjadi pendorong
hiperplasi kelenjar, otot dan stroma prostat. Sebenarnya selain proses menua rangsangan androgen
ikut berperan timbulnya BPH ini dapat dibuktikan pada pria yang di kastrasi menjelang pubertas tidak
akan menderita BPH pada usia lanjut.

Testis
Penuaan pada pria tidak menyebabkan berkurangnya ukuran dan berat testis tetapi sel yang
memproduksi dan memberi nutrisi (sel Leydic) pada sperma berkurang jumlah dan aktifitasnya
sehingga sperma berkurang sampai 50% dan testoteron juga menurun. Hal ini menyebabkan
penuruna libido dan kegiatan sex yang jelas menurun adalah multipel ejakulasi dan perpanjangan
periode refrakter. Tetapi banyak golongan lansia tetap menjalankan aktifitas sexsual sampai umur
lanjut.

B. Perubahan fisiologik aktivitas seksual akibat proses penuaan bila ditinjau dari pembagian tahapan
seksual menurut Kaplan adalah berikut ini :
1.

Fase desire
Dipengaruhi oleh penyakit, masalah hubungan dengan pasangan, harapan kultural,
kecemasan akan kemampuan seks. Hasrat pada lansia wanita mungkin menurun seiring makin
lanjutnya usia, tetapi bias bervariasi.Interval untuk meningkatkan hasrat seksual pada lansia pria
meningkat serta testoteron menurun secara bertahap sejak usia 55 tahun akan mempengaruhi libido.

2.

Fase arousal
Lansia wanita: pembesaran payudara berkurang; terjadi penurunan flushing, elastisitas dinding
vagina, lubrikasi vagina dan peregangan otot-otot; iritasi uretra dan kandung kemih.

Lansia pria : ereksi membutuhkan waktu lebih lama, dan kurang begitu kuat; penurunan produksi
sperma sejak usia 40tahun akibat penurunan testoteron; elevasi testis ke perineum lebih lambat.

3.

Lase orgasmik
Lansia wanita : tanggapan orgasme kurang intens disertai lebih sedikit konstraksil kemampuan
mendapatkan orgasme multipel berkurang.

Lansia pria : kemampuan mengontrol ejakulasi membaik; kekuatan dan jumlah konstraksi otot
berkurang; volume ejakulat menurun.

4.

Fase pasca orgasmik

Mungkin terdapat periode refrakter dimana pembangkitan gairah sampai timbulnya fase
orgasme berikutnya lebih sukar terjadi. Disfungsi seksual pada lansia tidak hanya disebabkan oleh
perubahan fisiologik saja, terdapat banyak penyebab lainnya seperti:

Penyebab iatrogenik
Tingkah laku buruk beberapa klinisi, dokter, suster dan orang lain yang mungkin membuat
inadekuat konseling tentang efek prosedur operasi terhadap fungsi seksual.

Penyebab biologik dan kasus medis


Hampir semua kondisi kronis melemahkan baik itu berhubungan langsung atau tidak dengan
seks dan system reproduksi mungkin memacu disfungsi seksual psikogenik.

C. Di samping faktor perubahan fisik, faktor psikologi juga sering kali menyebabkan penurunan fungsi
dan potensi seksual pada lanjut usia seperti :
1.

Rasa tabu atau malu bila mempertahankan kehidupan seksual pada lansia.

2.

Sikap keluarga dan masyarakat yang kurang menunjang serta diperkuat oleh tradisi dan budaya.

3.

Kelelahan atau kebosanan karena kurang variasi dalam kehidupannya.

4.

Pasangan hidup telah meninggal.

5.

Disfungsi seksual karena perubahan hormonal atau masalah kesehatan jiwa lainnya misalnya cemas,
depresi, pikun dsb.

D. Beberapa hal yang dapat menyebabkan masalah kehidupan sosial antara lain :
1.

Infark miokard
Mungkin mempunyai efek yang kecil pada fungsi seksual. Banyak pasien segan untuk terlibat
dalam hubungan seksual karena takut menyebabkan infark.

2.

Pasca stroke
Masalah seksual mungkin timbul setelah perawatan di rumah sakit karena pasien mengalami
anxietas akibat perubahan gambaran diri, hilangnya kapasitas, takut akan kehilangan cinta atau
dukungan relasi serta pekerjaan atau rasa bersalah dan malu atas situasi. Pola seksual termasuk
kuantitas dan kualitas aktivitas seksual sebelum stroke sangat penting untuk diketahui sebelum
nasehat spesifik tentang aktivitas seksual ditawarkan. Karena sistem saraf otonomik jarang
mengalami kerusakan pada stroke, maka respon seksual mungkin tidak terpengaruh.
Libido biasanya tidak terpengaruh secara langsung. Jika terjadi hemiplegi permanent maka
diperlukan penyesuaian pada aktivitas seksual. Perubahan penglihatan mungkin membatasi
pengenalan orang atau benda-benda, dalam beberapa kasus, pasien dan pasangannya mungkin
perlu belajar untuk menggunakan area yang tidak mengalami kerusakan. Kelemahan motorik dapat
menimbulkan kesulitan mekanik, namun dapat diatasi dengan bantuan fisik atau tehnik bercinta
alternatif. Kehilangan kemampuan berbicara mungkin memerlukan sistem non-verbal untuk
berkomunikasi.

3.

Kanker

Masalah seksual tidak terbatas pada kanker yang mengenai organ-organ seksual. Baik
operasi maupun pengobatan mengubah citra diri dan dapat menyebabkan disfungsi seksual
(kekuatan dan libido) untuk sementara waktu saja, walaupun tidak ada kerusakan saraf.
4.

Diabetes mellitus
Diabetes menyebabkan arteriosklerosis dan pada banyak kasus menyebabkan neuropati
autonomik. Hal ini mungkin menyebabkan disfungsi ereksi dan disfungsi vasokonstriksi yang
memberikan kontribusi untuk terjadinya disfungsi seksual.

5.

Arthritis
Beberapa posisi bersenggama adalah menyakitkan dan kelemahan atau kontraktur fleksi
mungkin mengganggu apabila distimulasi secara memadai. Nyeri dan kaku mungkin berkurang
dengan pemanasan, latihan, analgetik sebelum aktivitas seksual.

6.

Rokok dan alcohol


Pengkonsumsian alkohol dan rokok tembakau mengurangi fungsi seksual, khususnya bila
terjadi kerusakan hepar yang akan mempengaruhi metabolisme testoteron. Merokok juga mungkin
mengurangi vasokongesti respon seksual dan mempengaruhi kemampuan untuk mengalami
kenikmatan.

7.

Penyakit paru obstruktif kronik


Ada penyakit paru obstruktif kronik, libido mungkin terpengaruh karena adanya kelelahan
umum, kebutuhan pernafasan selama aktivitas seksual mungkin dapat menyebabkan dispnoe, yang
mungkin dapat membahayakan jiwa.

8.

Obat-obatan
Beberapa obat-obatan dapat menyebabkan terjadinya disfungsi seksual, antara lain beberapa
obat anti hipertensi, estrogen, anti psikotik, sedatif, dan lain-lain.

E. Upaya mengatasi permasalahan seksual pada lansia


Untuk mengatasi beberapa gangguan baik fisik maupun psikis termasuk masalah seksual
diperlukan penanganan yang serius dan terpadu. Proses penanganan ini memerlukan waktu yang
cukup lama tergantung dari keluhan dan kerjasama antara pasien dengan konselor. Dari ketiga
gangguan tersebut, masalah seksual merupakan masalah yang penanganannya memerlukan
kesabaran dan kehati-hatian, karena pada beberapa masyarakat Indonesia terutama masyarakat
pedesaan membicarakan masalah seksual adalah masalah yang tabu.
Manajemen yang dilakukan tenaga kesehatan untuk mengatasi gangguan seksual pada
lansia adalah sebagai berikut :
1.

Anamnesa Riwayat Seks

Gunakan bahasa yang saling menguntungkan dan memuaskan

Gunakan pertanyaan campuran antara terbuka dan teutup

Mendapatkan gambaran yang akurat tentang apa yang sebenarnya salah

Uraikan dengan panjang lebar permasaIahanya

Dapatkan latar belakang medis mencakup daftar lengkap tentang obat-obatan yang dikonsumsi
oieh pasien.

Pemeriksaan sebaiknya dilakukan dihadapan pasangannya. Anamnese harus rinci, meliputi


awitan, jenis maupun intensitas gangguan yang dirasakan. Juga anamnese tentang ganguan sistemik
maupun organik yang dirasakan. Penelaahan tentang gangguan psikologik, kognitif harus dilakukan.
Juga anamneses tentang obat-obatan. Pemeriksaan fisik meliputi head to toe.
Pemeriksaan tambahan yang dilakukan meliputi keadaan jantung, haati, ginjal dan paru-paru.
Status endokrin dan metaboliuk meliputi keadaan gula darah, status gizi dan status hormonal tertentu.
Apabila keluhan mengenai disfungsi ereks pada pria, pemeriksaan khas juga meliputi a.l pemeriksaan
dengan snap gauge atau nocturnal penile tumescence testing. (Hadi-Martono, 1996)
2.

Pengobatan yang diberikan mencakup

Konseling Psikoseksual

Therapi Hormon

Penyembuhan dengan obat-obatan

Peralatan Mekanis

Bedah Pembuluh

3.

Bimbingan Psikososial
Bimbingan dan konseling sangat dipentingkan dalam rencana manajemen gangguan seks
dan dikombinasikan dengan penyembuhan pharmakologi.

4.

Penyembuhan Hormon
Pada pria lansia : Penggunaan suplemen testosteron untuk menyembuhkan viropause/andropause
pada pria (pemanasan dan ejakulasi).

Pada wanita lansia : Terapi pengganti hormon (HRT) dengan pemberian estrogen pada
klimakterium.

5.

Penyembuhan dengan Obat

Yohimbine, Pemakaian Krim vasoaktif

Oral phentholamin

Tablet apomorphine sublingual

Sildenafil, suntik intra-carporal obat vasoaktif

Penempatan intra-uretral prostaglandin

1 Disfungsi seksual berhubungan dengan perubahan struktur tubuh/fungsi yang ditandai dengan
perubahan dalam mencapai kepuasan seksual
2.

Gangguan gambaran diri berhubungan dengan perubahan bentuk salah satu anggota tubuh.
3. Perubahan pola seksualitas berhubungan dengan efek penyakit akut dan kronis
RENCANA KEPERAWATAN
Dx.
Kep.

No.
1.

Tujuan

Intervensi
pasien

Rasional

Pasien dapat menerima 1.

Bantu

perubahan struktur tubuh

mengekspresikan perubahan

terutama pada fungsi

fungsi tubuh termasuk organ

seksual yang dialaminya

seksual

seiring

untuk
1.

dengan

Agar

pasien

lebih

bisa

menerima perubahan tersebut

Kriteria hasil:

bertambahnya usia.

Mengekspresikan

2.

kenyamanan

Berikan

2.

pendidikan

kesehatan

Mengekspresikan

tentang

penurunan fungsi seksual.

Menambah pemahaman klien


tentang
yang

semua
di

perubahan

alami

nya

agar

penurunan fungsi seksuel tidak

kepercayaan diri

menjadi beban pikiran


3.

Makanan bergizi dianjurkan


untuk menjaga daya tahan

3.

Motivasi

klien

mengkonsumsi

untuk

tubuh karena biasanya pada

makanan

lansia daya tahan tubuhnya

yang rendah lemak, rendah

4.

2.

kolestrol, dan berupa diet


4.

Untuk mengurangi kekeringan

vegetarian

dan rasa gatal pada vagina,

Anjurkan

klien

untuk

sakit pada saat berhubungan

dan gel

seksual

Kaji

perubahan bentuk salah

pasien

satu angota tubuhnya

gambaran diri berhubungan

secara positif

dengan

Kriteria hasil:

tubuhnya

perasaan/persepsi
1.
tentang

lingkungan

bina

malu dan rendah diri


Pasien

yakin

kemampuan yang dimiliki


4.

yang

keadaan nya

kurang

pendekatan
hubungan

Tunjukkan

dan
2.
saling

rasa

Agar

klien

3.

Rasa menerima pada pasien

empati,

akan membuat pasien lebih


percaya diri

pada pasien

Agar

Bantu

4.

pasien

terlalu

hubungan

orang lain karena perubahan


nya

5.

mengekspresikan

tidak

canggung atau malu dengnan

kesempatan

pasien

pasien

untuk

dengan orang lain


Beri

mau

mengungkapkan masalah nya

perhatian dan penerimaan

mengadakan

5.

jauh klien bisa menerima

angota

percaya dengan pasien


akan
3.

Untuk mengetahui seberapa

berfungsi secara normal


Lakukan

rasa

perubahan

keadaan

dan beradaptasi dengan


2.
tanpa

serta untuk megurangi rasa

menggunakan krim vagina


Pasien dapat menerima 1.

Pasien mau berinteraksi

menurun

Untuk mengetahui apakah

pada

klien depresi terhadap

untuk

perubahan

perasaan

kehilangan
3.

Pasien dapat menerima 1.

Kaji factor-faktor penyebab


1.

Penting untuk membantu

perubahan pola

dan penunjang, yang meliputi

dalam intervensi selanjutnya

seksualitas yang

Kelelahan

disebabkan masalah

Nyeri

kesehatannya.

Nafas pendek

Kriteria Hasil :

Keterbatasan suplai oksigen

Mengidentifikasi
keterbatasannya

Imobilisasi
pada

Kerusakan inervasi saraf

aktivitas

seksual

disebabkan

yang

masalah

kesehatan

Perubahan hormone
Depresi
Kurangnya informasi yang

Mengidentifikasi
modifikasi

tepat
kegiatan
2.

Ajarkan pentingnya mentaati


2.

Untuk

pantas

aturan medis yang dibuat

mengurangi

dalam respon terhadap

untuk

penyebab

keterbatasannya

penyakit

seksual

yang

3.

mengontrol

gejala

atau

factor-faktor

Berikan informasi yang tepat


3.

Agar klien lebih mengerti dan

pada

bisa menerima bahkan tidak

pasien

dan

pasangannya

tentang

memaksakan diri karena

keterbatasan fungsi seksual

keterbatasan yang di

yang

sebabkan oleh penyakit

disebabkan

oleh

keadaan sakit
4.

menghilangkan

4.

Ajarkan

modifikasi

mungkin

dalam

seksual

untuk

kegiatan

rasa

tidak

nyaman

saat

berhubungan karena penyakit

membantu

penyesuaian
keterbatasan

yang

Meminimalkan rasa sakit tau

dengan
akibat

sakit

(saran khusus)

IMPLEMENTASI
No.
1. 1
.

Dx. Kep.
1
1.

2.

Implementasi

Evaluasi

melakukan pendekatan dan bina hubungan saling

S:klien mengatakan sedikit mengerti

percaya dengan pasien

mengapa keinginan untuk melakukan

hasil : klien merasa nyaman saat ditanya dan

hubungan suami istri berkurang

merasa percaya

DO : - umur klien 69 tahun

membantu

pasien

untuk

mengekspresikan - TD : 130 / 90 mmHg

perubahan fungsi tubuh termasuk organ seksual - Nadi : 88 x/menit


seiring dengan bertambahnya usia

- Suhu : 36C

hasil : klien mulai mau sedikit demi sedikit terbuka - RR : 18 x/menit


saat di bombing untuk mengekspresikan masalah - Klien sudah menoupose
nya
3.

memberikan

pendidikan

kesehatan

tentang

penurunan fungsi seksual.


Hasil : klien sedikit lebih mengerti saat di jelaskan
tentang perubahan yang terjadi pada nya
4.

memotivasi klien untuk mengkonsumsi makanan


yang rendah lemak, rendah kolestrol, dan berupa
diet vegetarian
hasil : klien setiap hari mengkonsumsi nasi, ikan,
sayur

BAB III
PENUTUP
A. KESIMPULAN
Pada usia lanjut, hambatan untuk aktivitas seksual yang dapat dibagi menjadi hambatan
eksternal yang datang dari lingkungan dan hambatan internal,yang terutama berasal dari subjek
lansianya sendiri. Hambatan eksternal biasanya berupa pandangan sosial, yang menganggap bahwa
aktivitas seksual tidak layak lagi dilakukan lagi oleh lansia.Hambatan eksternal bilamana seorang
janda atau duda akan menikah lagi sering kali juga berupa sikap menentang dari anak-anak, dengan
berbagai alasan.
Hambatan internal psikologik seringkali sulit dipisahkan secara jelas dengan hambatan
eksternal. Seringkali seorang lansia sudah merasa tidak baisa dan tidaak pantas berpenampilan
untuk menarik lawan jenisnya. Pandangan sosial dan keagamaan tentang seksualitas diusia lanjut
menyebabkan keinginan dalam diri mereka ditekan sedemikian sehingga memberikan dampak pada
ketidakmampuan fisik, yang dikenal sebagai impotensia.Obat-obatan yang sering diberikan, pada
penderita usia lanjut dengan patologi multipel jika sering menyebabkan berbagai gangguan fungsi
seksual pada usia lanjut.
Masa tua merupakan masa yang sangat ditakuti dengan alasan terjadinya kemunduran
fisik terutama pada penampilan. Rasa khawatir akan kehilangan perhatian dari pasangan membawa
akibat terhadap frekwensi maupun kualitas hubungan seks, baik secara langsung maupun tidak.
Melalui konseling, peran konselor dan tenaga kesehatan dapat menjelaskan kondisi
umum dan masalah yang timbul pada masa usia lanjut serta pengaruhnya terhadap emosi, pola pikir
dan hubungan seksual sangat berpengaruh. Melalui beberapa tahapan konseling secara terbuka dan
kolaborasi dengan dokter spesialis kebidanan dan kandungan, bisa diperoleh suatu pemecahan
masalah seksual pada lansia, dengan pemakaian krem vasoaktif, melakukan olah raga ringan dan
konsumsi makan seimbang, dan solusi-solusi lain secara bertahap masalah pada lansia
akan terselesaikan.

B. SARAN
Permasalahan pada masa lansia sering terabaikan, tidak hanya di lingkungan keluarga lansia sendiri,
tetapi juga di lingkungan masyarakat bahkan pusat pelayanan kesehatan. Lansia sebagaimana pria
dan wanita mulai dari kanak-kanak hingga dewasa lainnya mempunya hak-hak untuk diperlakukan
adil dan sama, mendapat informasi dan pelayanan kesehatan yang sempurna dan optimal, serta
diperlakukan dan dihargai masa akhir usia mereka, merasakan kehidupan yang harmonis serta
merasakan kenikmatan seksual yang aman dan nyaman. Oleh karena itu, pengetahuan tentang
permasalahan seksual pada lansia baik pria maupun wanita perlu sebarluaskan sejak dini, dan
perlunya kerjasama yang optimal disetiap instansi pemerintah dan masyarakat untuk mengatasi
masalah ini agar para lansia mendapatkan kehidupan yang nayak, dan harmonis sebagai manusia
dan warga negara seutuhnya.

DAFTAR PUSTAKA
http://abhique.blogspot.com/2009/10/konsep-keperawatan pada lnjut usia (lansia).html
http://abhique.blogspot.com/2009/10/rencana asuhan keperawatan pada lansia.html
Carpenito,Lynda Juall.2000.Diagnosa Keperawatan.EGC.Jakarta
Aspiani Reny Yuli,S.Kep.Ns.Buku Ajar Asuhan Keperawatan Gerontik.2008
Darmojo, R Boedi dan Martono, H Hadi.2000.Geriatri ( ilmu kesehatan usia lanjut ). Jakarta : FKUI
Widyastuti, Yani dan Anita Rahmawati, Yuliasti, E. 2009. Kesehatan Reproduksi. Yogyakarta.
Fitramaya
Modul Kesehatan Reproduksi. 2008. Departemen Kesehatan RI. Jakarta
http://kuliahbidan.wordpress.com/2008/07/17/masalah-seksual-lansia/

FORMAT PENGKAJIAN INDIVIDU ASUHAN KEPERAWATAN GERONTIK


Tanggal pengkajian : 28 maret 2012
A. DATA BIOGRAFI
Nama

: Ny. S

TTL

: 7 juli 1943

Jenis kelamin

: perempuan

Pendidikan

: SD

Agama

: islam

Golongan darah : O

Status perkawinan

: menikah

TB / BB

: 150 cm/45 kg

Penampilan

: bersih, rapi,

Alamat

:jl desa camba

Orang yang dekat

: klien dekat dengan anak tertua klien

Hubungan
Alamat / telepon

ciri-ciri tubuh : kurus, kecil

: anak
:-

B. RIWAYAT KEPERAWATAN
1.

2.

Genogram

Laki-laki

Garis keturunan

Perempuan

Tinggal serumah

Garis Hubungan

Meninggal

Riwayat keluarga
Di keluarga klien tidak ada yang menderita penyakit menurun seperti DM ataupun penyakit menular
seperti TB paru

C. RIWAYAT PEKERJAAN
: klien tidak bekerja, klien hanya berdiam diri
Alamat pekerjaaan

dirumah
: tidak ada

Jarak dari rumah

: tidak ada

Alat transportasi

: jalan kaki

Pekerjaan sebelumnya

: klien sebagai ibu rumah tangga

Jarak dari rumah

: tidak ada

Alat transportasi

: jalan kaki

& kecukupan terhadap kebutuhan : dari anak tertua dan dari menantu klien
D. RIWAYAT LINGKUNGAN HIDUP
Type tempat tinggal

: permanen (milik suami)

Jenis lantai rumah

: kayu

Keadaan lantai

: kering

Tangga rumah

: tidak ada

Penerangan

: cukup

Tempat tidur

: aman ( tidak terlalu tinggi)

Alat dapur

: tertata rapi

WC

: jamban

Kebersihan lingkungan

: bersih

Jumlah orang yang tinggal dalam satu rumah : 5 orang


Derajat privasi

: kurang di perhatikan oleh menantunya

: klien bertetangga dengan cucu-cucu klien yang sudah berkeluarga


Alamat dan telepon
E.

: jl. Desa camba

RIWAYAT REKREASI
Hobby / minat

: klien senang memancing

Keanggotaan organsasi

: klien tidak mengikuti organiasi apapun

: klien hanya berdiam diri dirumah karena jarang berekreasi


F.

SISTEM PENDUKUNG
Klien di dukung oleh seorang perawat
Jarak dari rumah

: 1000 km

Rumah sakit

: tidak ada rumah sakit

: di kampung klien hanya terdapat puskesmas pembantu


Pelayanan kesehatan dirumah

: tidak ada

Makanan yang di hantarkan

: tidak ada makanan yang di hantarkan

di lakukan keluarga : keluarga klien tidak melakukan perawatan khusus kepada klien di rumah
G. DISKRIPSI KEKHUSUSAN
: semenjak klien tua, klien jarang melakukan sholat lima waktu
H. STATUS KESEHATAN

elama setahun yang lalu : setahun terakhir, klienmenderita maag dan asam urat

elama 5 tahun yang lalu : klien mengatakan tidak prnah menderita penyakit yang parah, hsnya penyakit biasa seperti
pilek, demam
Keluhan utama
1.

Provocative / palliative

: maag

2.

Quality / quantity

: seperti di tusuk-tusuk

3.

Region

: di uluhati

4.

Severity scale

: 4 (0-10)

5.

Timing

: kadang-kadang

Pemahaman & penatalaksanaan masalah kesehatan : klien mengerti kalau sakit harus ke puskesmas
untuk berobat. .
Obat obatan :
NO

NAMA OBAT

DOSIS

KETERANGAN

ANTASIDA

2 X sehari

Sebelum makan

Cimetidine

3 x sehari

Sesudah makan

Paracetamol

1 x sehari

Bila nyeri

Vit B.komplek

2 x sehari

Sesudah makan

Allopurinol

3 x sehari

Sesudah makan

Piroxicam

3 x sehari

Sesudah makan

Vit B.1

2 x sehari

Sesudah makan

Alergi (catatan agent dan reaksi spesifik)

I.

Obat obatan

: klien tidak ada alergi pada obat-obatan

Makanan

: klien tidak ada alergi pada makanan

Factor lingkungan

: klien tidak ada alergi pada lingkungan

Penyakit yang pernah di derita

: klien menderita maag dan asam urat

AKTIVITAS HIDUP SEHARI-HARI (ADL)


IndeksKATZ: A
: frekuensi nafas 18x/menit, klien tidak menggunakan alat bantu pernafasan, bernafas melalui
hidung
: klien minum air putih 1000ml/hari, klien minum kopi setiap pagi
: klien makan 3x sehari dengan nasi, ikan sayur dan kadang di tambah dengan buah
Eliminasi

: BAB 1x/hari dengan konsisten silembek, BAK >5x/hari

Aktivitas

: klien tidak bekerja, klien hanya berdiam diri di rumah

: klien tidur cukup, tidur malam 7 jam dan tidur siang 1 jam dalam sehari, klien merasa puas
saat bangun

: untuk kebersihan klien mengerti dan membersihkan diri setiap mandi baik itu oral hygiene
maupun vulva hygiene
: saat ditanya klien mengatakan bahwa klien masih berhubungan seksual dengan suaminya tapi
sekarang sudah mulai jarang karena keinginan untuk berhubungan itu mulai menurun sementara
suami klien masih mempunyai keinginan yang kuat.
: klien jarang berekreasi ketempat yang jauh mengingat kondisi klien, klien hanya main kerumah
tetangga yang berada di dekat rumah
J.

PSIKOLOGI, KOGNITIF DAN PERSEPTUAL

Konsep diri

: klien menyadari bahwa klien sudah lansia

Emos

: emosi klien labil

: klien mulai sulit untuk beradabtasi terhadap lingkungan maupun orang baru
Mekanisme pertahanan diri

: tidak terkaji

Status mental
Tingkat kesadaran

: kompos mentis

Afasia

:-

: klien mengalami dimensia sejak beberapa tahun yang lalu


: klien kadang bingung terhadap orang, waktu dan tempat terutama yang baru dilihat oleh klien
Bicara

: klien berbicara normal tapi sedikit lebih pelan

: klien menggunakan bahasa banjar dan dayak dalam kehidupan sehari-hari


Kemampuan membaca

: klien tidak bias membaca

Kemampuan interaksi

: klien mampu berinteraksi tapi secara perlahan

Vertigo

: klien tidak mengalami vertigo

Short Portable Mental Status Questionaire (SPMSQ) = 2 (fungsi mental utuh)


Mini Mental State Exam (MMSE) = 2 (baik)
Geriatric Depresion Scale

= 5 (kemungkinan depresi)

APGAR

= score 5 (menengah / sedang)

K. TINJAUAN SISTEM
Keadaan umum

: baik

Tingkat kesadaran

: compos mentis

Tanda-tanda vital

: TD : 130/90 mmHg

nadi : 88x/menit

RR : 18x/menit

suhu : 36 C

TB : 150 cm

BB : 50 kg

PENGKAJIAN PERSISTEM
PERNAFASAN (B1 : BREATHING)
1. Bentuk dada

: simetris

2. Sekresi dan batuk

: batuk dan sekresi tidak ada

Nyeriwaktubernafas

: tidak nyeri saat bernafas

3. Polanafas
a.

Frekuensi nafas

: 18x/menit

4. Bunyinafas
a.

Normal
Vasikuler di

: semua lapang paru

Bronchial di

: atas manubrium sternum

Bronchovesikuler di

: ICS 2 percabangan bronkus

5. Pergerakan dada
6. Tractilfremitis / fremitus vocal
7. Alat bantu pernafasan

: intercostal
: tidak meningkat dan tidak menurun
: tidak memakai alat bantu pernafasan

CARDIVASKULAR (B2 : BLEEDING)


1. Nadi
Frekuensi

: 88 x/menit ,kuat

2. Bunyi jantung

: normal

3. Letak jantung

: ictus cordis teraba pada ICS 5

4. Pembesaran jantung

: tidak ada pembesaran jantung

5. Nyeri dada

: tidak ada nyeri dada

6. Edema

: tidak ada edema

7. Clubbing finger

: tidak ada

PERSARAFAN (B3 : BRAIN)


Tingkat kesadaran
1. GCS
Total GCS

: kompos mentis
: E4 M6 V5
: 15

2. Reflex

: normal

3. Koordinasi gerak

: ya

4. Kejang

: tidak

PENGINDERAAN (persepsisensori)

1. Mata (penglihatan)
a. Bentuk

: normal

b. Visus

:-

c. Pupil

: isokor

d. Gerak bola mata

: normal, tidak menyempit

e. Medan penglihatan

: normal

f.

: klien tidak mengalami buta warna

Butawarna

g. Tekanan intra okuler

: tidak

2. Hidung (penciuman)
a.

Bentuk

: normal

b.

Gangguan penciuman

: tidak ada

3. Telinga (pendengaran)
a.

Aurikel

: normal dan simetris

b.

Membrab tympani

: agak keruh

c.

Otorrhoea

: tidak ada

d.

Gangguan pendengaran

: ya

e.

Tinnitus

: tidak

4. Perasa

: menurun

5. Peraba

: menurun

PERKEMIHAN-ELIMINASI URI (B4 : BLADDER)


Masalah kandung kemih

: tidak ada masalah

Produksi urine

: 500 ml/hari

Frekuensi

: >3 x/hari

Warna

: kuning

Bau

: khas amoniak

PENCERNAAN-ELIMINASI ALVI ( B5 : BOWEL)


1. Mulut dan tenggorokan
a) Selaput lendir mulut

: lembab, tidak ada stomatitis

b) Lidah

: agak kotor

c) Kebersihan rongga mulut

: tidak berbau dan gigi bersih

d) Tenggorokan

: tidak sakit saat menelan

e) Abdomen

: kenyal

f) Pembesaran hepar

: tidak ada pembesaran hepar

g) Pembesaran lien

: tidak ada pembesaran lien

h) Asites

: tidak ada asites

2. Masalah usus besar dan rectum / anus


Bab

: 1 x/hari tidak ada masalah

Obat pencahar

: tidak mengkonsumsi obat pencahar

OTOT, TULANG DAN INTEGUMENT (B6 : BONE)


1. Otot dan tulang
Kemampuan pergerakan sendi lengan dan tungkai (ROM) : bebas
Kemampuan kekuatan otot
Fraktur

: tidak ada fraktur

Dislokasi

: tidak ada dislokasi

Hematom

: tidak ada hematom

2. Integument
Warna kulit

: kuning langsat

Akral

: hangat

Turgor

: tidak elastis

Tulang belakang

: kiposis

REPRODUKSI
Perempuan :
Payudara
Bentuk

: normal

Benjolan

: tidakada

Kelamin
Bentuk

: normal

Keputihan

: tidak ada keputihan

Siklus haid

: sudah menoupose

ENDOKRIN
1. Factor alergi

: tidak ada alergi

2. Kelainan endokrin

: tidak ada kelainan endokrin

PENGETAHUAN

n dirinya : klien kurang peka terhadap masalah kesehatan

ANALISA DATA
NO

DATA

ETIOLOGI

PROBLEM

DS : klien mengatakan keinginan untuk

Perubahan struktur

melakukan hubungan suami istri sudah

tubuh / fungsi

Disfungsi seksual

mulai berkurang sejak klien merasa


memasuki usia senja dan klien
mengatakan dalam 1 minggu klien dan
suaminya sangat jarang melakukan
hubungan suami istri.
DO : - umur klien 69 tahun
- TD : 130 / 90 mmHg
- Nadi : 88 x/menit
- Suhu : 36C
- RR : 18 x/menit
- Klien sudah menoupose

RENCANA KEPERAWATAN
No.

Dx.
Kep.

Tujuan

Pasien dapat menerima 1.

Lakukan

perubahan struktur tubuh

bina

terutama pada fungsi

percaya dengan pasien

seksual yang dialaminya 2.

Bantu

Kriteria hasil:

mengekspresikan perubahan
2.

Agar

fungsi tubuh termasuk organ

menerima perubahan tersebut

Intervensi

Mengekspresikan
kenyamanan
kepercayaan diri

pendekatan
hubungan

seksual

Mengekspresikan

Rasional

pasien

dan
1.
saling

Agar

klien

mau

mengungkapkan masalah nya

untuk

seiring

pasien

lebih

bisa

dengan

bertambahnya usia.
3.

Berikan

pendidikan

kesehatan

tentang

penurunan fungsi seksual.


3.

Menambah pemahaman klien


tentang
yang

semua
di

alami

perubahan
nya

agar

penurunan fungsi seksual tidak


menjadi beban pikiran
4.

Motivasi

klien

untuk
4.

Makanan bergizi dianjurkan

makanan

untuk menjaga daya tahan

yang rendah lemak, rendah

tubuh karena biasanya pada

kolestrol, dan berupa diet

lansia daya tahan tubuhnya

mengkonsumsi

vegetarian

menurun

IMPLEMENTASI
No.
1

Dx. Kep.
Implementasi
1
1. melakukan pendekatan dan bina hubungan saling

Evaluasi
S:klien mengatakan sedikit mengerti

percaya dengan pasien

mengapa keinginan untuk melakukan

hasil : klien merasa nyaman saat ditanya dan

hubungan suami istri berkurang

merasa percaya

DO : - umur klien 69 tahun

2.

membantu

pasien

untuk

mengekspresikan - TD : 130 / 90 mmHg

perubahan fungsi tubuh termasuk organ seksual - Nadi : 88 x/menit


seiring dengan bertambahnya usia

- Suhu : 36C

hasil : klien mulai mau sedikit demi sedikit terbuka - RR : 18 x/menit


saat di bombing untuk mengekspresikan masalah - Klien sudah menoupose
nya
3. memberikan

pendidikan

kesehatan

tentang

penurunan fungsi seksual.


Hasil : klien sedikit lebih mengerti saat di jelaskan
tentang perubahan yang terjadi pada nya
4. memotivasi klien untuk mengkonsumsi makanan
yang rendah lemak, rendah kolestrol, dan berupa
diet vegetarian
hasil : klien setiap hari mengkonsumsi nasi, ikan,
sayur

SHORT PORTABLE MENTAL STATUS QUESTIONNAIRE (SPMSQ)


PENILAIAN UNTUK MENGETAHUI FUNGSI INTELEKTUAL LANSIA
Nama klien : Ny. S

tanggal : 28 maret 2012

Jenis kelamin : perempuan

umur : 69 tahun

Agama : islam

suku : dayak

Alamat : islam
Pewwancara : mahasiswa akper pemkab kotim

SKOR
NO

PERYANYAAN

JAWABAN

Tanggal berapa hari ini ?

28

Hari apa sekarang ini ?

Rabu

Apa nama tempat ini ?

Rumah saya

Dimana alamat anda ?

camba

Kapan anda lahir ?

Tahun 43 an

Berapa umur anda ?

lupa

Siapa presiden Indonesia sekarang ?

SBY

Siapa presiden sebelumnya?

Megawati

Siapa nama kecil ibu anda ?

Tidak tahu

10

15 - 6

Jumlah kesalahan total

Keterangan :
Kesalahan : 0-2 fungsi mental utuh
Kesalahan : 3-4 kerusakan intelektual ringan
Kesalahan : 5-7 kerusakan intelektual sedang
Kesalahan : 8-10 kerusakan intelektual berat

MINI MENTAL SKORE

NO

PERTANYAAN

BENAR

Tanggal berapa hari ini ? (dd/mm/hh)

Hari apakah hari ini ?

Apakah nama tempat ini ?

Berapa no. Telp, bila tidak ada, no rumah / jalan ?

Berapakah usia anda ?

Kapan anda lahir ?

Siapa nama presiden sekarang ?

Siapa nama presiden sebelumnya ?

Siapa nama ibu mu sebelum menikah ?

10

15 6

JUMLAH KESALAHAN :
0-2 Kesalahan : Baik
3-4 kesalahan : gangguan intelektual ringan
5-7 kesalahan : gangguan intelektual sedang
8-10 kesalahan : gangguan intelektual berat
HASIL : 2 kesalahan, baik

SALAH

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

5
MAR

31

Asuhan keperawatan pada Ny. A dengan GANGGUAN AKTIVITAS


(kelompok 4)

Tugas keperawatan gerontik


Asuhan keperawatan pada Ny. A dengan GANGGUAN
AKTIVITAS

Disusun oleh:
Dwi kirnawati
Juliansyah
Fauzi herawan
Sari dwi ratman

AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTAWARINGIN TIMUR
Jalan batu berlian No.11, telp (0531) 22960/22940
SAMPIT

KATA PENGANTAR
Puji syukur kepada Tuhan Yang Maha Esa karena berkat taufik dan hidayahNya, makalah ini dapat diselesaikan. Makalah ini merupakan makalah pengetahuan
bagi mahasiswa/i akper pemkab kotim maupun para pembaca untuk bidang Ilmu
Pengetahuan.
Makalah ini sendiri dibuat guna memenuhi salah satu tugas kuliah dari
dosen mata kuliah Keperawatan Anak I dengan judul ASUHAN KEPERAWATAN
GERONTIK PADA NY. A DENGAN MASALAH GANGGUAN AKTIVITAS. Dalam
penulisan makalah ini penulis berusaha menyajikan bahasa yang sederhana dan
mudah dimengerti oleh para pembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih banyak
kekurangan. Oleh karenanya, penulis menerima kritik dan saran yang positif dan
membangun dari rekan-rekan pembaca untuk penyempurnaan makalah ini. Penulis
juga mengucapkan banyak terima kasih kepada rekan-rekan yang telah membantu
dalam penyelesaian makalah ini.

Akhir kata, semoga makalah ini dapat memberikan manfaat kepada kita semua.
Amin.

Sampit,

Maret 2012

Penulis

DAFTAR ISI
HALAMAN JUDUL...............................................................................................................

KATA PENGANTAR ............................................................................................................

ii

DAFTAR ISI ........................................................................................................................

iii

BAB I

PEMBAHASAN

1.1 LAPORAN

PENDAHULUAN

ASUHAN

KEPERAWATAN

GERONTIK

PADA

NY

DENGAN

GANGGUAN AKTIVITAS
1.2 KONSEP DASAR PENYAKIT............................................................
DAFTAR KEPUSTAKAAN..........................................................................
2.2.. LAPORAN KASUS ASUHAN KEPERAWATAN GERONTIK PADA NY DENGAN GANGGUAN
AKTIVITAS
PENGKAJIAN............................................................................................
ANALISA DATA.........................................................................................
RENCANA KEPERAWATAN.......................................................................

LAPORAN PENDAHULUAN
1. Konsep dasar penyakit
a. Pengertian

Aktivitas adalah suatu energy atau keadaan bergerak dimana manusia memerlukannya
untuk dapat memenuhi kebutuhan hidup.
b. Epidemologi/insiden kasus
Pemenuhan kebutuhan aktivitas dan latihan biasanya menyangkut tentang
kemampuan untuk mobilisasi secara mandiri.
Gangguan mobilisasi dapat terjadi pada semua tingkatan umur, yang beresiko tinggi
terjadi gangguan mobilisasi adalah orang yang lanjut usia, post cedera dan post trauma.
c.
-

Etiologi/penyebab
Kelainan postur
Gangguan perkembangan otot
Kerusakan system saraf pusat
Trauma lanngsung pada system mukuloskeletal dan neuromuscular
Kekakuan otot

d.
-

Factor predisposisi
Pengobatan
Terapi pembatasan gerak
Kurang pengetahuan tentang manfaat pergerakan fisik
IMT diatas 75% sesuai dengan usia
Kerusakan sensori persepsi
Nyeri, tidak nyaman
Intoleransi aktivitas/ penurunan kekuatan dan stamina
Depresi mood dan cemas
Keengganan untuk memulai gerak
Gaya hidup menetap, tidak fit
Malnutrisi umum dan spesifik
Kehilangan integrasi struktur tulang
Keterbatasan lingkungan fisik dan social
Keterbatasan daya tahan kardiovaskuler
Kepercayaan terhadap budaya berhubungan dengan aktivitas yang tepat disesuaikan dengan
umur

e.
f.

Patofisiologi terjadinya penyakit


Kaki tidak mampu menopang berat badan
Perlu bantuan kursi roda untuk berpindah tempat
Tangan belum mampu untuk melakukan pekerjaannya secara mandiri
Tidak mampu melakukan kegiatan secara mandiri
Gejala klinis
tidak mampu bergerak secara mandiri

g. Pemeriksaan fisik
a. Tingkat kesadaran
b. Postur/bentuk tubuh
o Skoliosis
o Kiposis
o Lordosis
o Cara berjalan

c.
o
o
o
o
o
o
o
o
o
o
o
o

Ekstremitas
Kelemahan
Gangguan sensorik
Tonus otot
Atropi
Tremor
Gerakan tak terkendali
Kekuatan otot
Kemampuan jalan
Kemampuan duduk
Kemampuan berdiri
Nyeri sendi
Kekakuan sendi

h. Pemeriksaan diagnostic
pemeriksaan kekuatan otot (neuthopografi)
i.

Prognosis
Apabila ada perubahan mobilisasi, maka setiap system tubuh beresiko terjadi
gangguan. Tingkat keparahan dari gangguan tersebut tergantung pada umur klien, dan kondisi
kesehatan secara keseluruhan serta tingkat imobilisasi yang dialami. Misalnya,
perkembangan pengaruh mobilisasi lansia berpenyakit kronik lebih cepat dibandingkan
dengan klien yang lebih muda.

j. Therapy (tindakan penanganan)


- Fisiotheraphy
- Latihan mobilisasi ringan seperti; miring kanan-miring kiri

2. Konsep dasar keperawatan


a.
1.
a.
b.

Pengkajian
Tingkat aktivitas sehari-hari
Pola aktivitas sehari-hari
Jenis, frekuensi, dan lamanya latihan fisik

2. Tingkat kelelahan
a. Aktivitas yang membuat lelah
b. Riwayat sesak nafas
3.
a.
b.
c.

Gangguan pergerakan
Penyebab gangguan pergerakan
Tanda dan gejala
Efek dari gangguan pergerakan

4. Pemeriksaan fisik
a. Tingkat kesadaran
b. Postur bentuk tubuh

b. Diagnose keperawatan yang mungkin muncul


1. Intoleransi aktivitas
Definisi: kondisi dimana seseorang mengalami penurunan energy fisiologis dan
psikologis untuk melakukan aktifitas sehari-hari.
Kemungkinan berhubungan dengan :
a. Kelemahan umum
b. Bedres yang lama (imobilisasi)
c. Motivasi yang kurang
d. Pembatasan pergerakan
e. Nyeri
2. Keletihan
Definisi: kondisi dimana seseorang mengalami perasaan letih yang berlebihan secara
terus-menerus dan penuruna kapasitas kerja fisik dan mental yang tidak dapat hilang dengan
istirahat.
Kemungkinan berhubungan dengan:
a. Menurunnya produksi metabolism
b. Pembatasan diet
c. Anemia
d. Ketidakseimbangan glukosa dan elektrolit
3. Gangguan mobilitas fisik
Definisi: kondisi dimana pasien tidak mampu melakukan pergerakan secara mandiri.
Kemungkinan berhubungan dengan:
a. Gangguan persepsi kognitif
b. Imobilisasi
c. Gangguan neuro muskuler
d. Kelemahan
e. Pasien dengan traksi

4. Deficit perawatan diri


Definisi: kondisi dimana pasien tidak dapat melakukan sebagian atau seluruh aktivitas
sehari-hari seperti; makan, berpakaian dan mandi, dan lain-lain.
Kemungkinan berhubungan dengan:
a. Gangguan neuromuskuler
b. Menurunnya kekuatan otot
c. Menurunnya control otot dan koordinasi
d. Kerusakan persepsi kognitif
e. Depresi
f. Gangguan fisik
c.
1.

Rencana keperawatan
Untuk diagnose keperawatan intoleransi aktivitas
Intervensi:
o Monitor keterbatasan aktivitas, kelemahan saat aktivitas
o Bantu pasien dalam melakukan aktivitas sendiri

o Catat tanda vital


o Kolaborasi dengan dokter
o Lakukan aktivitas yang adekuat
Rasional:
o Merencanakan intervensi dengan tepat
o Pasien dapat memilih dan merencanakannya sendiri
o Mengkaji sejauh mana perbedaan peningkatan selama aktivitas
o Mempercepat proses penyembuhan
o Untuk mengoptimalkan pergerakan
2.
o
o
o
o
o
o
o
o
o
o
o
o
3.
o
o
o
o
o
o
o
o
o
o
4.
o
o
o
o
o

Untuk diagnose keperawatan keletihan


Intervensi:
Monitor keterbatasan aktivitas
Bantu pasien dalam melakukan aktivitas sendiri
Catat tanda vital sebelum dan sesudah aktivitas
Kolaborasi dengan dokter dalam latihan aktivitas
Berikan diet yang adekuat dengan kolaborasi ahli diet
Berikan pendidikan kesehatan
Rasional:
Merencanakan intervensi dengan tepat
Pasien dapat memilih dan merencanakannya sendiri
Mengkaji sejauh mana perbedaan peningkatan selama aktivitas
Mempercepat proses penyembuhan
Diet adekuat dapat menambah energy untuk mencegah keletihan
Menambah pengetahuan pasien
Untuk diagnose keperawatan gangguan mobilitas fisik
Intervensi:
Pertahanan body aligment dan posisi yang nyaman
Cegah pasien jatuh
Lakukan latihan aktif maupun pasif
Lakukan fisiotheraphy dada dan postural
Tingkatkan aktivitas sesuai batas toleransi
Rasional:
Mencegah iritasi dan komplikasi
Mempertahankan keamanan pasien
Meningkatkan sirkulasi dan mencegah kontraktur
Meningkatkan fungsi paru
Memaksimalkan mobilisasi
Untuk diagnose keperawatan deficit perawatan diri
Intervensi:
Lakukan kajian kemampuan pasien dalam perawatan diri terutama ADL
Jadwalkan jam kegiatan tertentu untuk ADL
Jaga privasi dan keamanan pasien
Lakukan latihan aktif dan pasif
Monitor tanda vital, tekanan darah, sebelum dan sesudah ADL

o
o
o
o
o

Rasional:
Memberikan informasi dasar dalam menentukan rencana keperawatan
Perencanaan yang matang dalammelakukan kegiatan sehari-hari
Memberikan keamanan
Meningkatkan sirkulasi darah
Mengkaji sejauh mana perbedaan peningkatan selama aktivitas

d. Evaluasi
Evaluasi asuhan keperawatan pada klien terganggu kesejajaran tubuh dan mobilisasi
berdasarkan criteria hasil setiap tujuan keperawatan, yaitu:
- Klien akan mempertahankan rentang gerak pada sendi ekstremitas atas
- Klien akan mengikuti program latihan teratur 3-4 kali sehari dengan perencanaan pulang
- Klien akan melakukan rentang gerak penuh pada sendi yang sakit
- Tidak ada kontraktur sendi

LAPORAN KASUS

Tanggal Pengkajian: 28 Maret 2012


A. DATA BIOGRAFI
Nama
: Ny. A
TTL
: Sampit, 13 juli 1949
Jenis kelamin
: perempuan
Gol. Darah
:B
Agama
: islam
Pendidikan
:Status perkawinan
: janda
TB/BB
: 145 cm, 43 kg
Penampilan
: rapi
: rambut kelabu, kulit keriput, gigi bersih, warna kulit pucat, agak bungkuk
: kelurahan ketapang, kecamatan mentawa baru ketapang, RT 04, RW 05, kabupaten
kotawaringin timur
Orang yang dekat
: Ny. K
Hubungan
: anak klien
Alamat/telpon
: 0852459734xx
B. RIWAYAT KEPERAWATAN
1. Genogram

Keterangan

Laki-laki

Garis

keturunan
: Perempuan

: Tinggal serumah

: Garis hubungan

: Meninggal

2. Riwayat keluarga
Klien adalah anak kedua dari sepuluh bersaudara. Suami klien meninggal sepuluh tahun yang
lalu. Dikeluarga klien tidak ada riwayat penyakit menurun maupun menular berbahaya
lainnya. Saat muda klien bekerja sebagai petani dan suami klien bekerja sebagai tukang kayu.
Kedua orang tua klien bekerja sebagai petani. Sejak kecil hingga menikah klien hidup serba
kekurangan, tapi klien masih bisa membiayai anaknya sekolah. Saat semua anak klien sudah
bekerja dan menikah hidup klien mulai berkecukupan, tetapi klien sering mengeluhkan nyeri
sendi dan postur tulang punggung klien mulai bungkuk dan klien agak susah saat berjalan.
Tapi klien masih bisa memenuhi kebutuhannya (makan) sendiri namun saat berjalan ataupun
mandi, klien selalu dibantu keluarganya karena klien tidak kuat berdiri lama.
C. RIWAYAT PEKERJAAN
Saat ini klien sudah tidak bekerja, sebelumnya klien adalah seorang petani, dan jarak tempat
kerjanya dari rumah adalah 1km dan biasa ditempuh klien dengan jalan kaki. Saat ini
pendapatan klien bersumber dari uang yang diberikan anak-anaknya tiap bulan dan semua
kebutuhan klien terpenuhi.
D. RIWAYAT LINGKUNGAN HIDUP
Rumah klien terbuat dari kayu, jenis lantai rumah klien terbuat dari kayu dan kondisi
lantainya kering. Tidak terdapat tangga dirumah klien, penerangan yang tersedia cukup,
tempat tidur klien aman karena berada dibawah dan tidak terlalu tinggi. Alat dapur tertata
rapi. Terdapat sebuah WC dirumah klien namun tidak ada pegangan dan lantainya licin.
Lingkungan disekutar klien bersi dan tidak ada barang yang membahayakan. Klien tinggal
dengan satu orang anak, satu orang menantu, dan kedua cucunya (5 orang dalam satu rumah),
klien mendapatkan privasinya dirumah tersebut. Tetangga terdekat klien adalah Tn. A yang
tinggal disebelah rumah klien.
E. RIWAYAT REKREASI

Hobby/ minat klien adalah membuat kue kering. Klien tidak mengikuti kegiatan apapun dank
lien jarang melakukan liburan atau perjalanan kecuali perjalanan pulang kampong tiap
lebaran.
F. SISTEM PENDUKUNG
Rumah klien dekat dengan puskesmas, kurang lebih 500m. jarak antara rumah sakit dengan
rumah klien adalah 2km. Klien jarang mendapatkan pelayanan kesehatan dirumah dan
perawatan sehari-hari yang dilakukan keluarga adalah membantunya berjalan dan mandi.
G. DISKRIPSI KEKHUSUSAN
Klien selalu melaksanakan kebiasaan ritual sholat 5 waktu dirumah setiap harinya.
H. STATUS KESEHATAN
Sejak 5 tahun lalu hingga sekarang klien hanya sering mengeluh nyeri sendi dan pinggang
setiap sebelum tidur, klien juga merasa sering lemah bila terlalu lama berdiri sehingga agak
susah berjalan. Klien tidak memiliki keluhan lain selain hal tersebut.
1. Provocative/palliative
: nyeri sendi dan nyeri punggung
2. Quality/Quantity
: nyut-nyutan seperti membawa batu
3. Region
: di punggung dan seluruh persendian
4. Severity scale
:4
5. Timing
: setiap sebelum tidur
Pemahaman dan penatalaksanaan masalah kesehatan : bila nyeri muncul klien hanya
menggosok bagian tubuh yang sakit dengan minyak urut dan klien tidak pernah
memeriksakan penyakit yang dideritanya ke dokter ataupun memeriksakan diri ketempat
pelayanan kesehatan lainnya.
Klien tidak memiliki riwayat alergi terhadap obat-obatan, makanan, maupun factor
lingkungan.
Penyakit yang diderita klien adalah reumatik.
I.

AKTIVITAS HIDUP SEHARI-HARI (ADL)


Indeks kats klien adalah C, karena setiap klien mandi dan berpindah selalu di bantu keluarga.
Oksigenasi, cairan & elektrolit, nutrisi, istirahat & tidur, dan personal hygine klien tercukupi.
Tetapi aktivitas klien mengalami penurunan. Sejak 10 tahun semenjak kematian suaminya
pun kebutuhan seksual klien tidak pernah terpenuhi. Klien juga jarang melakukan rekreasi
karena agak susah berjalan.

J. PSIKOLOGI
Klien merupakan anak kedua dari sepuluh bersaudara yang berusia 62 tahun, klien menyukai
semua bagian tubuhnya, klien ingin hidupnya tenang sampai akhir hayatnya, klien merasa
dirinya berharga karena seluruh keluarganya menyayanginya. Emosi klien labil, klien
gampang tersinggung. Klien dapat beradaptasi dengan baik terhadap lingkungannya.
Mekanisme pertahanan diri minimal.
atus mental
:
Tingkat kesadaran klien compos mentis, klien tidak mengalami dimensia, orientasi dan bicara
klien normal. Bahasa yang digunakan bahasa banjar. Klien mampu membaca dan mampu
berinteraksi dengan lawan bicaranya. Klien tidak memiliki vertigo.
Short portable mental status questionnaire (SPMSQ) : 3
Mini mental state exam (MMSE)
:3
Geriatric depression scale
:4
APGAR
:7

K. TINJAUAN SISTEM
Keadaan umum klien baik, tingkat kesadaran compos mentis, tanda-tanda vital ; TD: 140/100
mmHg, RR: 20x/menit, Nadi: 82x/menit, suhu: 35,4C, TB: 145cm, BB: 43kg.
PENGKAJIAN PERSISTEM
PERNAFASAN (B1: BREATHING)
Bentuk dada simetris, klien tidak ada batuk dan tidak mengeluarkan sputum, pola nafas
regular dengan frekuensi 20x/menit, bunyi nafas normal.
CARDIOVASCULAR (B2: BLEEDING)
Nadi regular dengan frekuensi 82x/menit, bunyi jantung normal, tidak ada pembersaran
jantung, tidak ada edema dan clubbing finger.

PERSARAFAN (B3: BRAIN)


Tingkat kesadaran klien composmentis, GCS 15 (e4v5m6), reflex normal, klien mempunyai
koordinasi gerak yang baik, tidak ada kejang.
PENGINDERAAN (PERSEPSI SENSORI)
Bentuk Mata klien normal, pupil isokor, gerak bola mata normal, medan penglihatan
menyempit, klien tidak mengalami buta warna dan peningkatan tekanan intra okuler.
Bentuk hidung klien normal dan tidak ada gangguan penciuman.
Bentuk telinga klien normal, aurikel normal, membrane tympani terang, tidak ada otorrhoea,
tidak ada tinnitus dan tidak ada gangguan pendengaran.
Indera perasa dan peraba klien normal.
PERKEMIHAN-ELIMINASI URI (B4: BLADDER)
Tidak ada masalah pada kandung kemih klien, produksi urine 700ml/hari, freuensi 5-6x/hari,
warna kuning terang, bau khas amoniak.
PENCERNAAN-ELIMINASI ALVI (B5: BOWEL)
Selaput lendir mulut lembab, lidah klien hiperemik, rongga mulut klien tidak berbau, tidak
ada kesulitan maupun nyeri saat menelan, abdomen kenyal dan tidak ada benjolan, tidak ada
pemesaran hepar, lien, dan asites.
BAB 1x/hari, tidak ada masalah pada BAB, klien tidak menggunakan obat pencahar dan
lavemen.
OTOT, TULANG DAN INTEGUMEN (B6: BONE)
Kemampuan pergerakan sendi lengan dan tungkai terbatas, tidak ada fraktur, tidak ada
dislokasi, dan tidak ada hematom.
Warna kulit pucat, akral dingin, turgor tidak elastic, tulang belakang klien kiposis.
REPRODUKSI
Bentuk payudara klien simetris, tidak ada benjolan, bentuk kelamin normal, tidak ada
keputihan, siklus haid 7hari.
ENDOKRIN

Tidak ada factor alergi dan kelainan endokrin pada klien.


PENGETAHUAN
Klien tidak mengetahui apa penyebab persendian dan punggungnya yang sering sakit, klien
tidak tahu bagaimana cara menghilangkannya. Klien hanya tahu cara menguranginya yaitu
dengan menggunakan minyak urut.
ANALISA DATA
NO
1.

DATA
DS: saya sering merasa
nyeri punggung dan nyeri
sendi

ETIOLOGI
Kelemahan

PROBLEM
Gangguan mobilitas
fisik

DO:
-k/u lemah
-kesadaran compos mentis
-P: nyeri sendi dan punggung
-Q:
nyut-nyut
seperti
membawa batu
-R: di persendian dan
punggung
-S: 4
-T: setiap mau tidur
-klien tidak bisa berdiri lama
-berjalan ataupun mandi
dibantu keluarga
-TD: 140/100mmHg
-RR: 20x/menit
-N: 82x/menit
-S: 35,4C

PRIORITAS MASALAH
1. Gangguan mobilitas fisik
DIAGNOSA MASALAH
1. Gangguan mobilitas fisik b/d kelemahan
RENCANA KEPERAWATAN

Dx.
Kep.

No.
1.

Tujuan
Setelah
dilakukan
1.
tindakan keperawatan,
diharapkan gangguan
mobilitas
fisik
2.
berkurang atau teratasi,
dengan criteria hasil:
- klien dapat melakukan
3.
aktivitas secara adekuat

Intervensi

Rasional

Pertahanan body aligment


1. Mencegah
dan posisi yang nyaman
komplikasi

iritasi

dan

Cegah pasien jatuh


Lakukan latihan
maupun pasif

2. Mempertahankan keamanan
pasien
aktif
3. Meningkatkan sirkulasi dan

- k/u baik
mencegah kontraktur
- tidak terjadi cidera
- klien meningkatkan
4. Lakukan
fisiotheraphy
4. Meningkatkan fungsi paru
aktivitas sesuai batas dada dan postural
toleransi
5. Memaksimalkan mobilisasi
5. Tingkatkan
aktivitas
sesuai batas toleransi
IMPLEMENTASI

Dx.
Kep.

No.
1
.

Implementasi

Evaluasi

1. mempertahanan body aligment dan posisi S: saya masih merasa lemah saat
yang nyaman
terlalu lama berdiri
Hasil: klien mempertahankan body aligment.
O:
2. mencegah pasien jatuh
-k/u lemah
Hasil: klien dibantu saat berpindah dan mandi -aktivitas klien meningkat
sehingga mencegah terjadinya jatuh
-tidak terjadi cidera
3. melakukan latihan aktif maupun pasif
A: masalah belum teratasi
Hasil: klien melakukan latihan aktif dengan
berjalan ditempat selama 1 menit
P: lanjutkan intervensi
4. meningkatkan aktivitas sesuai batas
toleransi
Hasil: klien mencoba mandi sendiri tetapi
masih dalam pengawasan

DAFTAR PUSTAKA
Stockslager Jaime L. 2007. Asuhan Keperawatan Geriatrik Edisi 2. Jakarta. EGC
Tamher S, Noorkasiani. 2009. Kesehatan Usia Lanjut Dengan Pendekatan Asuhan
Keperawatan. Jakarta. Salemba Medika
Rosidawati, dkk. 2008. Mengenal Usia Lanjut dan Perawatannya. Jakarta. Salemba Medika
Stanley Mickey. 2002. Buku Ajar Keperawatan Gerontik. Jakarta. EGC

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

6
MAR

31

AKALAH ASUHAN KEPERAWATAN PADA LANSIA DENGAN


GANGGUAN ELIMINASI (kelompok 3)
MAKALAH
ASUHAN KEPERAWATAN PADA LANSIA DENGAN GANGGUAN ELIMINASI

DI SUSUN OLEH:
INKA FEBRYRIA PERTIWI
KARTA ADI WIBOWO
IRWANSYAH
ALFIANEDI
AKADEMI KEPERAWATAN PEMERINTAH KABUPATEN KABUPATEN
KOTAWARINGIN TIMUR
2012
KATA PENGANTAR
Puji syukur kehadirat Tuhan Yang Maha Esa karena atas berkat dan rahmatNya
lah

kami

dapat

menyelesaikan

makalah

ini

yang

berjudulMakalah

Asuhan

Keperawatan Gangguan Eliminasi Pada Lansia


Makalah ini disusun untuk melengkapi tugas Keperawatan Gerontik. Selain itu
diharapkan makalah ini dapat membantu teman-teman yang lain dalam memahami
konsep eliminasi pada lansia khususnya.
Harapan kami mudah-mudahan makalah kami ini bermanfaat. Kami menyadari
sebagai manusia tidak luput dari kekurangan, oleh karena itu saran dan kritik pembaca
sangat kami harapkan sebagai masukan perbaikan makalah kami berikutnya.

Sampit, Maret 2012


Penulis,
BAB I
PENDAHULUAN
I.

LATAR BELAKANG
Menua (menjadi tua) adalah suatu proses secra perlahan lahan kemampuan
jaringan untuk memperbaiki diri / mengganti dan mempertahankan fungsi normalnya
sehingga tidak dapat bertahan terhadap infeksi dan memperbaiki kerusakan yang
diderita. Proses menua merupakan proses yang terus menerus berlanjut secara
alamiah. Dimulai sejak lahir dan umumnya dialami pada semua makhluk hidup.
Usia lanjut adalah tahap akhir dari siklus hidup manusia, merupakan bagian dari
proses alamiah kehidupan yang tidak dapat dihindarkan dan akan dialami oleh setiap
individu. Penuaan adalah normal, dengan perubahan fisik dan tingkah laku yang dapat
diramalkan terjadi pada semua orang pada saat mereka mencapai usia tahap
perkembangan kronologis tertentu. Ini merupakan suatu fenomena yang kompleks dan

multi dimensional yang dapat diobservasi di dalam satu sel dan berkembang pada
keseluruhan sistem. Walaupun hal itu terjadi pada tingkat kecepatan yang berbeda, di
dalam parameter yang cukup sempit, proses tersebut tidak tertandingi.
Menua bukanlah suatu penyakit tetapi merupakan proses berkurangnya daya
tahan tubuh dalam menghadapi rangsangan dari dalam maupun luar tubuh. Walaupun
demikian, memang harus diakui bahwa ada berbagai penyakit yang sering menghinggapi
kaum lanjut usia. Proses menua sudah mulai berlangsung sejak seseorang mencapai
usia dewasa, misalnya dengan terjadinya kehilangan jaringan pada otot, susunan saraf,
dan jaringan lain sehingga tubuh mati sedikit demi sedikit, dan terjadi juga pada sistem
pencernaan.
Pada tahap ini individu mengalami banyak perubahan, baik secara fisik maupun
mental, khususnya kemunduran dalam berbagai fungsi dan kemampuan yang pernah
dimilikinya. Perubahan penampilan fisik sebagai bagian dari proses penuaan yang
normal, seperti berkurangnya ketajaman panca indera, menurunnya daya tahan tubuh ,
lebih mudah terkena konstipasi merupakan ancaman bagi integritas orang usia lanjut.
Belum lagi mereka masih harus berhadapan dengan kehilangan peran diri, kedudukan
sosial serta perpisahan dengan orang-orang yang dicintai.
II.

TUJUAN PENULISAN
Setelah menyelesaikan tugas keperawatan gerontik diharapkan:

1.

Mahasiswa dapat memahami asuhan keperawatan pada lansia.

2.

Mahasiswa dapat memberikan asuhan keperawatan pada lansia dengan ganguan


eliminasi.

3.

Dapat menambah pengetahuan bagi mahasiswa tentang penanganan pada lansia


dengan gangguan eliminasi.

III.

RUMUSAN MASALAH
Berdasarkan latar belakang di atas, maka rumusan masalah dalam makalah ini

adalah bagaimana asuhan keperawatan pada lansia (Lanjut Usia) dengan gangguan
pemenuhan kebutuhan eliminasi.
IV.

METODE PENULISAN
Metode yang digunakan dalam penulisan makalah ini yaitu metode kepustakaan

dan dikutip dari sumber-sumber yang dapat dibuktikan kebenarannya.


V.

SISTEMATIKA PENULISAN
Sistematika penulisan makalah ini yaitu kata pengantar, daftar isi, bab I
pendahuluan yang terdiri dari latar belakang, rumusan masalah, tujuan penulisan,
metode penulisan, dan sistematika penulisan. Bab II berisi tinjauan pustaka. Bab III
penutup yang terdiri dari kesimpulan dan saran. Daftar pustaka.

BAB II
TINJAUAN PUSTAKA

I.

KOSEP DASAR ELIMINASI


Eliminasi merupakan proses pembuangan sisa-sisa metabolism tubuh baik yang
berupa urine maupun fekal (Tarwoto dan wartonah, 2010).
Eliminasi Urine
Eliminasi urine normalnya adalah pengeluaran cairan sebagai hasil filtrasi dari
plasma darah diglomerolus. Dari 180 liter darah yang masuk keginjal untuk difiltrasi,
hanya 1-2 liter saja yang dapat berupa urine, sebagian besar hasil filtrasi akan diserap
kembali ditubulus ginjal untuk dimanfaatkan tubuh.

Karakteristik urine normal:


a.
b.

Volume berkisar 250-400ml yang dikeluarkan setiap kali berkemih.


Warna normal kekungin-kunginan jernih. Pada dehidrasi warna kuning gelap atau
kuning coklat, sedangkan karena obat urine dapat berwarna merah atau orange gelap.

c.

Bau bervariasi tergantung komposisi, bau urine yang aromatic yang menyengat atau
memusingkan timbul karena mengandung amonik.

d.

pH sedikit asam yaitu antara 4,5-8 atau rata-rata 6,0. Namun demikian, pH
dipengaruhi oleh intake makanan. Misalnya urin pada vegetarian menjadi sedikit basa.

e.

Berat jenis 1.003-1.030.

f.

Komposiss air 93-97%.

g.

Osmolaritas (konsentrasi osmotic) 855-1.335 mOsm/liter

h.

Bakteri tidak ada.

Komposisi Urine
a.

Zat buangan nitrogen seperti urea, kreatinin, amoniak, asam urat serta urobilin.

b.

Hasil nutrient dari metabolism seperti karbohidrat, keton, lemak, dan asam amino.

c.

Ion-ion seperti natrium, klorida, kaliun dan magnesium

Faktor-Faktor yang Mempengaruhi Eliminasi urine


1.

Diet dan intake


Jumlah dan tipe makanana mempengaruhi output urine, seperti protein dan sodium
mempengaruhi jumlah urine yang keluar.

2.

Respon keinginan awal untuk berkemih


Beberapa masyarakat mempunyai kebiasaan yang mengabaikan respon awal untuk
berkemih dan hanya pada akhir keinginan berkemih menjadi lebih kuat. Akibatnya urine
banyak tertahan dalam kandung kemih. Masyarakat ini mempunyai kapasitas kamdung
kemih yang lebih dari normal.

3.

Gaya hidup
Banyak segi gaya hidup mempengaruhi seseorang dalam hal eliminasi urine. Tersedianya
fasilitas toilet atau kamar mandi dapat mempengaruhi frekuensi eliminasi. Praktek
eliminasi keluarga dapat mempengaruhi tingkah laku.

4.

Stress psikologi

Meningkatnya stres seseorang dapat meningkatkan frekuensi keinginan berkemih. Hal ini
karena meningkatnya sensitif untuk keinginan berkemih dan atau meningkatnya jumlah
urine yang diproduksi.
5.

Tingkat aktivitas
Aktifitas

sangat

dibutuhkan

untuk

mempertahankan

tonus

otot.

Eliminasi

urine

membutuhkan tonus otot kandung kemih yang baik untuk tonus spingter internal dan
eksternal.
6.

Tingkat perkembangan
Tingkat pertumbuhan dan perkembangan juga akan mempengaruhi pola berkemih. Pada
wanita hamil kapasitas kandung kemihnya menurun karena adanya tekanan dari fetus
atau adanya

7.

Kondisi patologis
Saat seseorang dalam keadaan sakit,produksi urinnya sedikit hal ini disebabkan oleh
keinginan untuk minum sedikit.

Masalah-masalah eliminasi urine:


1.

Retensio

urine.

Merupakan

penumpukan

urine

dalam

kandung

kemih

dan

ketidakmampuan pada kandung kemih untuk mengosongkan kandung kemih. Penyebab


distensi kandung kemih adalah urine yang terdapat dalam kandung kemih melebihi 400
ml normalnya 250-400 ml.
2.

Inkontinensia urine. Ketidakmampuan otot sfingter eksternal sementara atau menetap


untuk

mengontrol

ekskresi

urine.

Ada

dua

jenis

inkontinensia

urina,

yaitu, Inkontinensia stres adalah strea yang terjadi pada saat tekanan intraabdomen
meningkat.Inkontinensia urgensi adalah inkontinensia yang terjadi saat klien terdesak
ingin berkemih, terjadi akibat ISK bagian bawah atau spasme kandung kemih.
3.

Enuresis.

Ketidaksanggupan

menahan

kemih

(mengompol)

yang

diakibatkan

ketidakmampuan untuk mengendalikan sfingter eksterna .


Perubahan pola berkemih:
1.

Frekuensi : meningkatnya frekuensi berkemih tanpa intake cairan yang meningkat,


biasanya terjadi pada sistitis, stres, wanita hamil

2.

Urgensi. Perasaan segera ingin berkemih yang biasanya terjadi pada anak karena
kemampuan sfingter untuk mengontrol berkurang.

3.

Disuria: rasa sakit dan kesulitan dalam berkemih misal, ISK.

4.

Poliuri (diuresis): produksi urine melebihi normal tanpa peningkatan intake cairan,
misal pada pasien DM.

5.

Urinari suppression: keadaan ginjal tidak memproduksi urine secara tiba-tiba. Anuria
(urine kurang dari 100 ml/24jam) dan oliguria (urine berkisar 100-500ml/24jam).
Eliminasi fekal
Eliminasi fekal sangat erat kaitannya dengan saluran pencernaan. Saluran
pencernaan

merupakan

saluran

yang

menerima

makanan

dari

luar

dan

mempersiapkannya untuk diserap oleh tubuh dengan proses penernaan (pengunyahan,


penelanan, dan pencampuran) dengan enzim dan zat cair dari mulut sampai anus. Organ

utama yang berperan dalam eliminasi fekal adla usus besar. Usus besar memiliki
beberapa fungsi utama yaitu mengabsorpsi cairan dan elektrolit, proteksi atau
perlindungan dengan mensekresikan mukus yang akan melindungi dinding usus dari
trauma oleh feses dan aktivitas bakteri, mengantarkan sisa makanan sampai ke anus
dengan berkontraksi.
Proses eliminasi fekal adalah suatu upaya pengosongan intestin. Pusat refleks ini
terdapat pada medula dan spinal cord. Refleks defekasi timbul karena adanya feses
dalam rectum.
Proses Eliminasi
1.

Sistem digestif (GIT) bertambah lambat sehingga menyebabkan sekresi cairan digestif
dan peristaltik lamban sehingga terjadi penurunan kemampuan untuk mengkonsumsi
makanan tertentu.

2.

Pada lansia banyak makanan yang tidak tercerna dan kadangkadang tak cukup cairan
untuk mencerna sehingga timbul konstipasi.. konstipasi dapat juga terjadi karena tidak
mengkonsumsi makanan yang memadai/kurang melakukan latihan fisik.

3.

Tidak memadainya konsumsi makanan juga sebagai akibat dari penurunan respon
terhadap tanda-tanda internal terhadap lapar dan haus, perubahan pada gigi (karena
sakit/trauma) sehingga sulit untuk mengunyah.

4.

Keadaan

sakit,

misalnya

stroke

akan

menimbulkan

kesulitan

untuk

mengunyah/menelan.
5.

Kadang lupa dalam konsumsi makanan.

6.

Penggunaan laksatif yang berlebihan dapat menurunakan penyerapan vitamin-vitamin


tertentu yang larut dalam lemak (A, D, E, K).

7.

Pada umumnya keluhan seperti kembung, perasaan tidak enak biasanya akibat
makanan yang kurang bisa dicernakan akibat :

a)

Menurunnya fungsi kelenjar pencernaan.

b)

Menurunnya toleransi terhadap makanan berlemak.

8.

Konstipasi dapat terjadi karena kurangnya kadar selulosa, kurangnya nafsu makan
akibat gigi sudah lepas.

Masalah-masalah umum pada eliminasi Fekal


1.

Konstipasi: gangguan eliminasi yang mengakibatkan adanya feses yang keras melalui
usus besar. Biasanya disebabkan oleh po\la defekasi yang tidak teratur, penggunaan
laksatif dalam jangka waku yang lama, stress fsikologis, obat-obatan, kuang aktifitas
dan usia.

2.

Imfaksi fekal : massa fees yang keras di lipatan rectum yang diakibatkan oleh retensi
dan akumulasi material yang berkepanjangan. Biasanya disebabkan oleh konstipasi.

3.

Diare : keluarnya feses cairan dan meningkatnya buang air besar akibat cepatnya
kimus melewati usus besar, sehingga usus besar tidak mempunyai waktu cukup untuk
menyerap air. Diare disebabkan oleh stress fisik, obat-obatan,alergi dan lain-lain.

4.

Inkontinensia alvi : hilangnya kemampuan otot untuk mengontrol pengeluaaran feses


dan gas yang melalui spingter anus akibat kerusakan fungsi spingter / persarafan
didaerah anus. Penyebabnya karena penyakit neoromuskular, atau tumor spingter anus
eksternal.

5.

Kembung : platus yang berlebihan didaerah intestinal, sehingga menyebabkan distensi


intestinal, dapat disebakan karena konstipasi, mengkonsumsi makanan yang banyak
mengandung gas dapat berefek anestesi.

6.

Hemoroit : kelebran vena didaerah anus sebagai akibat peningkatan tekanan darah
tersebut. Penyebabnya adalah, konstipasi kronis, peregangan maksimal saat defekasi,
kehamilan, dan obesitas.

II.
1.

KONSEP DASAR KEPERAWATAN GERONTIK


Gerontologi
Berbagai istilah berkembang terkait dengan lanjut usia (lansia), yaitu gerontologi,

geriatri, dan keperawatan gerontik. Gerontologi berasal dari kata Geros : lanjut usia
dan Logos : ilmu. Jadi Gerontologi adalah ilmu yang mempelajari secara khusus
mengenai

faktor-faktor

yang

menyangkut lanjut

usia. Gerontologi

Ilmu

yang

mempelajari seluruh aspek menua (Kozier, 1987) Cabang ilmu yang mempelajari proses
menua dan masalah yang mungkin terjadi pada lanjut usia (Miller, 1990).
2.

Geriatri
Geriatri berasal dari kata Geros : Lanjut usia dan Eatrie : kesehatan/medikal.

Cabang ilmu kedokteran yang mempelajari tentang penyakit pada lanjut usia

Cabang ilmu kedokteran yang mempelajari aspek-aspek klinis, preventif maupun


terapeutis bagi klien lanjut usia.

Ilmu yang mempelajari proses menjadi tua pada manusia serta akibat akibatnya pada
tubuh

manusia.

Dengan

demikian

jelaslah

bahwa

objek

dari

geriatri

adalah

manusia lanjut usia.

Bagian dari ilmu kedokteran yang mempelajari tentang pencegahan penyakit dan
kekurangan-kekurangannya pada lanjut usia.

Cabang ilmu kedokteran (medicine) yang berfokus pada masalah kedokteran yaitu
penyakit yang timbul pada lanjut usia (Black & Matassari Jacob, 1997).

3.

Geriatric Nursing :

a.

Praktek keperawatan yang berkaitan dengan penyakit pada proses menua (Kozier,
1987).

b.

Spesialis keperawatan lanjut usia yang dapat menjalankan peranya pada tiap tatanan
pelayanan dengan menggunakan pengetahuan, keahlian dan keterampilan merawat
untuk meningkatkan fungsi optimal lanjut usia/lansia secara komprehensif. Oleh karena
itu, perawatan lansia yang menderita penyakit (geriatric nursing) dan dirawat di rumah
sakit merupakan bagian dari Gerontic nursing.

4.

Proses Menua
Menua (menjadi tua) adalah suatu proses menghilangnya secara perlahan-lahan
kemampuan jaringan untuk memperbaiki diri/mengganti dan mempertahankan fungsi
normalnya sehingga tidak dapat bertahan terhadap infeksi dan memperbaiki kerusakan
yang diderita (Constantindes, 1994). Proses menua merupakan proses yang terusmenerus (berlanjut) secara alamiah. Dimulai sejak lahir dan umumnya dialami pada

semua makhluk hidup. Proses menua sertiap individu pada organ tubuh juga tidak
sama cepatnya, adakalanya orang belum tergolong lanjut usia (masih muda) tetapi
kekurangan-kekurangan yang menyolok (Deskripansi).
Menurut undang-undang no. 9 tahun 1960 tentang pokok-pokok kesehatan pasdal
8 ayat 2, berbunyi : Dalam istilah sakit termasuk cacat, kelemahan dan lanjut
usia. Berdasarkan pernyataan ini, maka lanjut usia dianggap sebagai semacam penyakit.
Hal ini tidak benar. Gerontologi berpendapat lain, sebab lanjut usia bukan suatu penyakit
melainkan suatu masa/tahap hidup manusia, yaitu : bayi, kanak-kanak, dewasa, tua,
dan lanjut usia.
Menua bukanlah suatu penyakit tetapi merupakan proses berkurangnya daya tahan
tubuh dalam menghadapi rangsangan dari dalamtubuh maupun dari luar tubuh.
Walaupun demikian memang harus diakui bahwa ada berbagai penyakit yang sering
menghinggapi kaum lanjut usia. Proses menua sudah mulai berlangsung sejak seseorang
mencapai

usia dewasa,

otot, susunan

syaraf,

misalnya
dan

dengan

jaringan

terjadinya
lain

kehilangan

sehingga tubuh

jaringan
mati

pada
sedikit

demi sedikit. Sampai saat ini banyak sekali teori yang menerangkan proses menua,
mulai dari teori degeneratif yang didasari oleh habisnya daya cadangan vital, teori
terjadinya atrofi, yaitu : teori yang mengatakan bahwa proses menua adalah proses
evolusi dan teori imunologik, yaitu : teori adanya produk sampah/waste products dari
tubuh sendiri yang makin bertumpuk. Tetapi seperti diketahui lanjut usia akan selalu
bergendengan dengan

perubahan

fisiologik

maupun

psikologik.

Yang

penting

untuk diketahui bahwa aktivitas fisik dapat menghambat/memperlambat kemunduran


fungsi alat tubuh yang disebabkan bertambahnya umur.
5.

Teori-Teori Proses Menua

a.

Secara individual

1.

Tahap proses menua terjadi pada orang dengan usia berbeda.

2.

Masing-masing lanjut usia mempunyai kebiasaan yang berbeda.

3.

Tidak ada satu factor pun ditemukan untuk mencegah proses menua.

b.

Teori-teori biologi

1.

Teori genetik dan mutasi (Somatic Mutatie Theory)


Menurut teori ini semua telah terprogram secara genetik untuk spesies-spesies tertentu.
Menua terjadi sebagai akibat dari perubahan biokimia yang diprogram oleh molekulmolekul/DNA dan setiap sel pada saatnya akan mengalami mutasi. Sebagai contoh yang
khas adalah mutasi dari sel-sel kelamin. (terjadi penurunan kemampuan fungsional sel).

2.

Pemakaian dan Rusak kelebihan usaha dan stres menyebabkan sel-sel tubuh lelah
(terpakai).

3.

Pengumpulan

dari

pigmen/lemak

dalam

tubuh

yang

disebut

teori

akumulasi

dari produk sisa. Sebagai contoh adanya pigmenLipofuchine di sel otot jantung dan sel
susunan syaraf pusat pada orang lanjut usia yang mengakibatkan menganggu fungsi sel
itu sendiri.
4.

Peningkatan jumlah kolagen dalam jaringan.

5.

Tidak ada perlindungan terhadap : radiasi, penyakit dan kekurangan gizi.

6.

Reaksi dari kekebalan sendiri (Auto Immune Theory) Didalam proses metabolisme
tubuh, suatu saat diproduksi suatu zat khusus. Ada jaringan tubuh tertentu yang tidak
tahan terhadap zat tersebut sehingga jaringan tubuh menjadi lemah dan sakit. Sebagai
contoh ialah tambahan kelenjar timus yang pada usia dewasa berinvolusi dan semenjak
itu terjadilah kelainan autoimun. (Menurut Goldteris & Brocklehurst, 1989).

c.

Teori immunologik slow virus (Immunology slow virus theory)


Sistem immun menjadi efektif dengan bertambahnya usia dan masuknya virus kedalam
tubuh dapat menyebabkan kerusakan organ tubuh.

d.

Teori stress
Menua terjadi akibat hilangnya sel-sel yang biasa digunakan tubuh. regenerasi jaringan
tidak dapat mempertahankan kestabilan lingkungan internal, kelebihan usaha dan stres
menyebabkan sel-sel tubuh lelah terpakai.

e.

Teori radikal bebas


Radikal bebas dapat terbentuk di alam bebas, tidak stabilnya radikal bebas (kelompok
atom) mengakibatkan oksidasi oksigen bahan-bahan organik seperti karbohidrat dan
protein. Radikal ini meyebabkan selsel tidak dapat regenerasi.

f.

Teori rantai silang


Sel-sel yang tua/usang, reaksi kimianya menyebabkan ikatan yang kuat, khususnya
jaringan kolagen. Ikatan ini menyebabkan kurangnya elastis, kekacauan dan hilangnya
fungsi.

g.

Teori program
Kemampuan organisme untuk menetapakan jumlah sel yang membelah setelah sel-sel
tersebut mati.

6.
a)

Teori Kejiwaan Sosial


Aktivitas atau kegiatan (Activity Taheory)
Ketentuan akan meningkatnya pada penurunan jumlah kegiatan secara langsung.
Teori ini menyatakan bahwa pada lanjut usiayang sukses adalah mereka yang aktif dan
ikut banyak dalam kegiatan sosial.

Ukuran optimum (pola hidup) dilanjutkan pada cara hidup dari lanjut usia.

Mempertahankan hubungan antara sistem sosial dan individu agar tetap stabil dari
usia pertengahan ke lanjut usia.

b)

Kepribadian berlanjut (Continuity Theory)


Dasar kepribadian/tingkah laku tidak berubah pada lanjut usia. Teori ini merupakan
gabungan dari teori diatas. Pada teori ini menyatakan bahwa perubahan yang terjadi
pada

seseorang

yang lanjut

usia sangat

dipengaruhi

oleh

tipe personality yang

dimilikinya.
c)

Teori Pembebasan (Disengagement Theory)


Putusnya pergaulan/hubungan dengan masyarakat dan kemunduran individu dengan
individu lainnya. Pada lanjut usia pertama diajukan oleh Cumming and Henry 1961. teori
ini menyatakan bahwa dengan bertambahnya usia seseorang secara berangsur-angsur
mulai melepaskan diri dari kehidupan sosialnya atau menarik diri dari pergaulan
sekitarnya. Keadaan ini mengakibatkan interaksi social lanjut usia menurun, baik secara
kualitas maupun kuantitas sehingga sering terjadi kehilangan ganda (Triple loos), yakni:

1.

Kerhilangan peran (Loss of Role)

2.

Hambatan kontak sosial (Restraction of Contacts and Relation Ships)

3.

Berkurangnya komitmen (Redused commitmen to social Mores and Values).

7.

Faktor-Faktor Yang Mempengaruhi Ketuaan

a.

Hereditas : Keturunan/genetik

b.

Nutrisi : Makanan

c.

Status kesehatan

d.

Pengalaman hidup

e.

Lingkungan

f.

Stress

8.

Batasan-Batasan Lanjut Usia


Mengenai kapankah orang disebut lanjut usia, sulit dijawab secara memuaskan.
Dibawah ini dikemukakan beberapa pendapat mengenai batasan umur.
Menurut organisasi kesehatan dunia lanjut usia meliputi :

a)

Usia pertenggahan (middle age), ialah kelompok usia 45-59 tahun.

b)

Lanjut usia (elderly) : antara 60 dan 70 tahun

c)

Lanjut usia tua (old) : antara 75 dan 90 tahun.

d)

Usia sangat tua (very old) : diatas 90 tahun


Menurut Dra. Ny. Jos masdani (Psikolog UI)
Mengatakan : lanjut usia merupakan kelanjutan dari usia dewasa. Kedewasaan dapat
dibagi menjadi empat bagian, yaitu :

a)

Fase iuventus, antara 25 dan 40 tahun

b)

Fase verilitas, antara 40 dan 50 tahun

c)

Fase praesenium, antara 55 dan 65 tahun

d)

Fase senium, antara 65 hingga tutup usia.

9.

Perubahan-Perubahan Yang Terjadi Pada Lanjut Usia


Perubahan-perubahan fisik
Sel

1.

Lebih sedikit jumlahnya

2.

Lebih besar ukurannya.

3.

Berkurangnya jumlah cairan tubuh dan berkurangnya cairan intraseluler.

4.

Menurunnya proporsi protein diotak, otot, ginjal, darah dan hati.

5.

Jumlah sel otak menurun.

6.

Terganggunya mekanisme perbaikan sel.

7.

Otak menjadi atrofis beratny berkurang 5-10 %.


Sistem persyarafan

1.

Berat otak menurun 10-20 % (setiap orang berkurang sel saraf otaknya dalam setiap
harinya).

2.

Cepatnya menurun hubungan persarafan.

3.

Lambat dalam respon dan waktu untuk bereaksi, khususnya dengan stress.

4.

Mengecilnya saraf panca indera.

5.

Berkurangnya penglihatan, hilangnya pendengaran, mengecilnya saraf pencium dan


perasa, lebih sensitif terhadap perubahan suhu dengan rendahnya ketahanan terhadap
dingin.

6.

Kurang sensitif terhadap sentuhan.


Sistem pendengaran

1.

Presbiakus (gangguan pada pendengaran). Hilangnya kemampuan (daya) pendengaran


pada telinga dalam, terutama terhadap bunyi suara/nada-nada yang tinggi, suara yang
tidak jelas, sulit mengerti kata-kata, 50 % terjadi pada usia di atas umur 65 tahun.

2.

Membran tympany menjadi atrofi menyebabkan otosklerosis.

3.

Terjadinya penggumpalan serumen dapat mengeras karena meningkatnya keratin.


Pendengaran bertambah menurun pada lanjut usia yang mengalami ketegangan
jiwa/stres.
Sistem penglihatan

1.

Sfingter pupil timbul sklerosis dan hilangnya respon terhadap sinar

2.

Kornea lebih berbentuk sferis (bola)

3.

Lensa lebih suram (kekeruhan pada lensa) menjadi katarak, jelas menyebabkan
gangguan penglihatan.

4.

Meningkatnya ambang pengamatan sinar, daya adaptasi terhadap kegelapan lebih


lambat dan susah melihat dalam cahaya gelap.

5.

Hilangnya daya akomodasi.

6.

Menurunnya lapangan pandang : berkurang luas pandangannya.

7.

Menurunnya daya membedakan warna biru atau hijau pada skala.


Sistem kardiovaskuler

1.

Elastisitas, dinding aorta menurun.

2.

Katup jantung menebal dan menjadi kaku.

3.

Kemempuan jantung memompa darah menurun 1 % setiap tahun sesudah berumur 20


tahun, hal ini menyebabkan menurunnya kontraksi dan volumenya.

4.

Kehilangan elastisitas pembuluh darah; kurangnya efektivitas pembuluh darah perifer


untuk oksigenasi, perubahan posisi dari tidur ke duduk (duduk ke berdiri) bisa
menyebabkan tekanan darah menurun menjadi 65 mmHg (mengakibatkan pusing
mendadak).

5.

Tekanan darah meninggi diakibatkan oleh meningkatnya resistensi dari pembuluh


darah perifer, sistolis normal 170 mmHg. Diastolis normal 90 mmHg.
Sistem pengaturan temperatur tubuh
Pada pengaturan suhu, hipotalamus dianggap bekerja sebagai suatu termostat, yaitu
menetapkan

suatu

suhu

tertentu,

kemunduran

terjadi

berbagai

faktor

yang

mempengaruhinya. Yang sering ditemui antara lain :


1.

Temperatur

tubuh

menurun

metabolisme yang menurun.

(hipotermia)

secara

fisiologik

35C

ini

akibat

2.

Keterbatasan refleks menggigl dan tidak dapat memproduksi panas yang banyak
sehingga terjadi rendahnya aktivitas otot.
Sistem respirasi

1.

Otot pernafasan kehilangan kekuatan dan menjadi kaku.

2.

Menurunnya aktivitas dari silia.

3.

Paru-paru kehilangan elastisitas, kapasitas residu meningkat, menarik nafas lebih


berat, kapasitas pernafasan maksimum menurun dan kedalaman bernafas menurun.

4.

Alveoli ukurannya melebar dari biasa dan jumlahnya berkurang.

5.

O2 pada arteri menurun menjadi 75 mmHg

6.

CO2 pada arteri tidak berganti

7.

Kemampuan untuk batuk berkurang.

8.

Kemampuan pegas, dinding dada dan kekuatan otot pernafasan akan menurun seiring
dengan pertambahan usia.
Sistem gastrointestinal

1.

Kehilangan gigi, penyebab utama adanya Periodontal disease yang biasa terjadi setelah
umur 30 tahun, penyebab lain meliputi kesehatan gigi yang buruk dan gizi yang buruk.

2.

Indera pengecap menurun, adanya iritasi yang kronis dari selaput lendir, atropi indera
pengecap ( 80 %), hilangnya sensitifitas dari saraf pengecap di lidah terutama rasa
manis dan asin, hilangnya sensitifitas dari saraf pengecap tentang rasa asin, asam dan
pahit.

3.

Esofagus melebar.

4.

Lambung, rasa lapar menurun (sensitifitas lapar menurun), asam lambung menurun,
waktu mengosongkan menurun.

5.

Peristaltik lemah dan biasanya timbul konstipasi.

6.

Fungsi absorpsi melemah (daya absorpsi terganggu)

7.

Liver (hati), makin mengecil dan menurunnya tempat penyimpanan, berkurangnya


aliran darah.
Sistem reproduksi

1.

Menciutnya ovari dan uterus.

2.

Atrofi payudara.

3.

Pada laki-laki testis masih dapat memproduksi spermatozoa meskipun adanya


penurunan secara berangsur-angsur.

4.

Dorongan seksual menetap sampai usia diatas 70 tahun (asal kondisi kesehatan baik),
yaitu :

1.

Kehidupan seksual dapat diupayakan sampai masa lanjut usia.

2.

Hubungan seksual secara teratur membantu mempertahankan kemampuan seksual.

3.

Tidak perlucemas karena merupakan perubahan alami.

4.

Selaput lendir vagina menurun, permukaan menjadi halus, sekresi berkurang, reaksi
sifatnya menjadi alkali dan terjadi perubahan-perubahan warna.
Sistem genitourinaria

1.

Ginjal
Merupakan alat untuk mengeluarkan sisa metabolisme tubuh melalui urin darah yang
masuk ke ginjal, disaring oleh satuan (unit) terkecil dari ginjal yang disebut nefron
(tepatnya di glomerulus). Kemudian mengecil dan nefron menjadi atrofi, aliran darah ke
ginjal

menurun

sampai

50

%,

fungsi

tubulus

berkurang

akibatnya:

kurangnya

kemampuan mengkonsentrasi urin, berat jenis urin menurun, proteinuria (biasanya +


1); BUN (blood urea nitrogen) meningkat sampai 21 mg %, nilai ambang ginjal terhadap
glukosa meningkat.
2.

Vesika urinaria (kandung kemih) : otot-otot menjadi lemah, kapasitasnya menurun


sampai 200 ml atau menyebabkan frekuensi buang air seni meningkat, vesika urinaria
susah dikosongkan pada pria lanjut usia sehingga mengakibatkan meningkatnya retensi
urin.

3.

Pembesaran prostat 75 % dialami oleh pria usia diatas 65 tahun.

4.

Atrofi vulva

5.

Vagina
Orang-orang yang makin menua, sexual intercourse masih juga membutuhkannya. Tidak
ada batasan umur tertentu untuk fungsi sexual seseorang berhenti. Frekuensi sexual
intercourse cenderung menurun secara bertahap tiap tahun tetapi kapasitas untuk
melakukan dan menikmati berjalan terus sampai tua.
Sistem endokrin

1.

Produksi dari hampir semua hormon menurun

2.

Fungsi paratiroid dan sekresinya tidak berubah.

3.

Pituitari : Pertumbuhan hormon ada tetapi lebih rendah dan hanya di dalam pembuluh
darah: berkurangnya produksi dari ACTH, TSH, FSH dan LH.

4.

Menurunnya

aktivitas

tiroid,

menurunnya

BMR

(basal

metababolic

rate)

dan

menurunnya daya pertukaran zat.


5.

Menurunnya produksi aldosteron.

6.

Menurunnya sekresi hormon kelamin, misalnya : progesteron, estrogen dan testeron.


Sistem kulit (integumentary system)

1.

Kulit mengerut/keriput akibat kehilangan jaringan lemak.

2.

Permukaan kulit kasar dan bersisik (karena kehilangan proses keratinasi serta
perubahan ukuran dan bentuk-bentuk sel epidermis).

3.

Menurunnya respon terhadap trauma.

4.

Mekanisme proteksi kulit menurun :

a.

Produksi serum menurun

b.

Penurunan produksi VTD.

c.

Gangguan pigmentasi kulit

5.

Kulit kepala dan rambut menipis berwarna kelabu.

6.

Rambut dalam hidung dan telinga menebal.

7.

Berkurangnya elastisitas akibat dari menurunnya cairan dan vaskularisasi.

8.

Pertumbuhan kuku lebih lambar

9.

Kuku jari lebih menjadi keras dan rapuh.

10.

Kuku kaki tumbuh secara berlebihan dan seperti tanduk.

11.

Kelenjar keringat berkurang jumlahnya dan fungsinya.

12.

Kuku menjadi pudar dan kurang bercahaya.


Sistem muskuloskeletal (musculosceletal system)

1.

Tulang kehilangan density (cairan) dan makin rapuh.

2.

Kifosis

3.

Pinggang, lutu dan jari-jari pergelangan terbatas.

4.

Discus intervertebralis menipis dan menjadi pendek (tingginya berkurang).

5.

Persendian membesar dan menjadi kaku.

6.

Tendon mengerut dan mengalami sklerosis.

7.

Atrofi serabut otot (otot-otot serabut mengecil) : serabut-serabut otot mengecil


sehingga seseorang bergerak menjadi lamban, otot-otot kram dan menjadi tremor.

8.

Otot-otot polos tidak begitu berpengaruh.

III.

ASUHAN KEPERAWATAN\
Asuhan

keperawatan

adalah

suatu

proses

pemecahan

masalah

yang

mengarahkan perawat dalam memberikan asuhan. Pengkajian merupakan langkah


pertama

dalam

proses

ini

yaitu

meliputi

pengumpulan

dan

analisa

data

dan

menghasilkan diagnosa keperawatan. Pengkajian yang berfokus pada keperawatan


sangat penting untuk menetukan diagnosa keperawatan yang dapat menentukan
intervensi dan implementasi keperawatan.
1.

Pengkajian

a.

Eliminasi urine

1.

Urine. Warna : Normal kuning jernih. Bau : Normal aromatik amonia. Pada
overhidrasi hampir tidak berwarna. Pada dehidrasi orange-kecoklatan.

2.

Jumlah urine bervariasi tergantung intake. Normal 1 x BAK 250-400 ml.

3.

Distensi kandung kemih inkontinensia (tidak dapat menahan BAK)

4.

Frekuensi BAK, tekanan dan desakan.

5.

Kondisi-kondisi tertentu misalnya :

a)

Disuria, keadaan nyeri waktu BAK.

b)

Nokturia, keadaan BAK sering pada malam hari.

c)

Enurisis, keadaan sadar BAK (umumnya pada anakanak).

d)

Polyurie, peningkatan jumlah BAK baik frekuensi maupun volume.

e)

Oliguri, penurunan jumlah BAK frekuensi/jumlahnya.

f)

Anuri, produksi urine <100 /hari.

g)

Retensio, ketidakmampuan mengosongkan bladder, misalnya : karena obstruksi saluran


urethra.

b.

Eliminasi bowel

1.

Status gizi

2.

Pemasukan diit

3.

Anorexia, tidak dicerna, mual dan muntah.

4.

Mengunyah dan menelan.

5.

Keadaan gigi, rahang dan rongga mulut

6.

Auskultasi bising usus.

7.

Palpasi apakah perut kembung, fecal.

8.

Konstipasi, sudah berapa hari tidak BAB.

9.

Keadaan diare.

2.

Intervensi

a.

Eliminasi Urine

1.

Cukupkan cairan masuk 2000-3000 ml/hari.

2.

Cegah terjadinya inkontinensia :

a)

Jelaskan dan dorong klien untuk BAK tiap 2 jam.

b)

Pertahankan penerangan dikamar mandi untuk mencegah jatuh.

c)

Observasi jumlah urin

d)

Batasi cairan terutama waktu menjelang tidur.

b.

Eliminasi Bowel

1.

Berikan sikap fowler waktu makan

2.

Pertahankan keasaman lambung.

3.

Berikan makanan yang tidak membentuk gas

4.

Cukup cairan

3.

Untuk mencegah sembelit/konstipasi.

a.

Awasi kecukupan cairan dalam diit.

b.

Dorong untuk melakukan aktivitas

c.

Fasilitasi gerak usus dalam mencerna.

d.

Berikan kebebasan dan gerak posisi tubuh normal

e.

Berikan kecukupan konsumsi serat.

f.

Ajarkan latihan kegel.

g.

Ajarkan latihan perut.

h.

Atur waktu makan dan minum.

i.

Atur jumlah makan dan minum.

j.

Berikan laxatif jika perlu.

BAB III
FORMAT PENGKAJIAN LANSIA
I.

Data Biografi
Nama

: Ny. S

Umur

: 74 tahun

Jenis kelamin

: Perempuan

Pendidikan

: SD

Agama

: Islam

Status perkawinan

: Janda

TB/BB

: 149 cm / 37 kg

: Rapi,bersih,wangi,berpakaian sesuai, rambut

beruban, menggunakan jilbab,

sedikit bungkuk.
Alamat

: Jl. SukaBumi Barat No. 007

Orang yang dekat

II.
1.

: Ny. Ati

Hubungan

: Anak klien

Alamat

: Sda

RIWAYAT KEPERAWATAN
GENOGRAM

Keterangan:
: perempuan

: garis perkawinan

: laki-laki

------ : tinggal dalam satu

rumah
: garis keturunan

2.

: meninggal dunia

Riwayat Keluarga
Klien adalah anak ke-4 dari lima bersaudara, klien dulunya berasal dari keluarga petani.
Ayah dan ibu klien sudah meninggal. Suami klien sudah meninggal sejak klien berumur
51 tahun. Sekarang klien tinggal ikut anaknya.
Dalam keluarga klien ada yang menderita penyakit stroke yaitu kakak pertamanya dan
sudah meninggal. Dalam lingkungan keluarga klien tidak ada yang menderita penyakit
menular seperti TBparu.

III. RIWAYAT PEKERJAAN


Pekerjaan saat ini

: tidak bekerja

Alamat pekerjaan

:-

Jarak dari rumah

:-

Transportasi

:-

Pekerjaan sebelumnya

: Pedagang sayur yang digendong di bahu

Jarak dari rumah

: 10 km

Transportasi

: Jalan kaki

Sumber-sumber pendapatan dan kecukupan terhadap kebutuhan : kebutuhan klien


dipenuhi oleh anak-anaknya.

IV. RIWAYAT LINGKUNGAN


Jenis lantai rumah
Kondisi lantai

: porselen
: kering

Tangga rumah

: tidak ada

Penerangan

: cukup

Tempat tidur

: tanpa ranjang

Alat dapur

: tertata rapi

WC

: ada dikamar, 3 meter dari tempat tidur

Kebersihan lingkungan
mebahayakan klien

: lingkungan bersih, tidak ada barang yang dapat

Jumlah yang tinggal dalam satu rumah


Derajat privasi

: baik

Tetangga terdekat

:Mbah Saras

Alamat

V.

: 5 (lima) orang

: Jl. Suka- Bumi Barat No. 008

RIWAYAT REKREASI
Hobi/minat
Keanggotaan organisasi
Liburan/perjalanan

: Klien hobby menyulam, bernyanyi


: anggota posyandu lansia Kamboja
: Klien sering
taman kota.

diajak

anaknya

jalan-jalan

ke

VI. SISTEM PENDUKUNG


Perawat/Bidan/Dokter
Jarak dari rumah
RS
Klinik
Makanan yang dihantarkan

: Mantri Sri
: 1 km
: RSU DR. Murjani Sampit, 4 km dari rumah
klien
: Puskesmas Baamang 1, 1 km dari rumah klien
:-

Perawatan sehari-hari yang dilakukan keluarga: tidak ada karena klien masihdapat
melakukan aktivitas madiri.

VII.

DESKRIPSI KEKHUSUSAN
Kebiasaan ritual

VIII.

: Klien selalu melaksanakan sholat lima waktu


berjamaah di mushola Al-Anshor dekat rumah klien,
dan sering mendengarkan ceraham dari TV.

STATUS KESEHATAN

Status kesehatan umum selama setahun yang lalu :sering pegal-pegal dan kesemutan
pada ektremitas, dan hipertensi
Status kesehatan umum selama lima tahun yang lalu : Klien pernah mederita sakit
stroke dan di opname di RSUD Sragen, Jawa tengah selama 2 minggu
Keluhan utama

: 3 hari sekali baru BAB, perut terasa penuh

:-

:-

:-

:-

:-

Obat-obatan

: Ottopan (paracetamol) 500 mg 3x1

Alergi

: klien tidak ada alergi

Obat-obatan

:-

Makanan

:-

Faktor lingkungan

:-

Penyakit yang diderita

: Hipertensi dan rematik

IX. AKTIVITAS HIDUP SEHARI-HARI (ADL)


Indeks katz

: Katz A

Oksigenasi

: Klien bernapas dengan hidung, RR : 20x/m

Cairan/elektrolit

: Klien makan 2x sehari, klien makan nasi dan lauk, klien tidak suka makan sayur,
klien minum air putih 3 gelas sehari ( 750 ml),
: 3 hari sekali baru BAB, perut dintesi, bising usus 3x/m, BAK
: semua aktivitas klien sehari-hari dapat dikerjakan secara mandiri
: Klien tidak terbiasa tidur siang. Jika malam hari klien mulai tidur pukul 22.00 sampai
04.00 pagi. Pada saat tidur klien sering terbangun.

: Klien mandi 2x sehari, keramas 2 hari sekali, berganti pakaian setiap hari
Seksual

: Klien sudah menopause sejak berumum 51 tahun,

dan sudah tidak memiliki pasangan, sejak menopause klien sudah tidak ada keinginan
untuk berhubungan dengan dengan lawan jenis.
X.

PSIKOLOGI KOGNITIF PERSEPTUAL


Konsep diri

: baik

Emosi

: stabil

Adaptasi mekanisme pertahan diri : baik


Status mental :

Tingkat kesadaran

: compos mentis

Afasia

: tidak ada

Dimensia

: ada

Orientasi

: baik

Bicara

Bahasa yang digunakan

: bahasa banjar dan bahasa indonesia

Kemampuan membaca

: klien bisa membaca

Kemampuan interaksi

: klien mampu berinteraksi dengan baik dan sesuai

Vertigo

: ada

SPSMQ

: skor 2 = fungsi mental utuh

MMSE

: skor 2 = baik

GDS

: skor 4 = tidak ada depresi

APGAR

: normal dan lancar

: skor 10 = rendah

XI. TINJAUAN SISTEM


Keadaan umum

: baik

Tingkat kesadaran

: compos mentis

Tanda-tanda vital

: TD: 190/100 mmHg, Nadi: 74x/m, RR: 20x/m,

Suhu : 36,5 C, TB : 149 cm, BB, 37 kg


PENGKAJIAN PERSISTEM
B1/pernapasan

Bentuk dada

: simetris

Sekeresi dan batuk

: tidak ada batuk

Pola napas

: RR: 20x/m, reguler

Bunyi napas

: vesikuler

Pergerakan dada

: normal

Tractil fremitis

: tidak ada

Alat bantu pernapasan

: klien tidak menggunakan alat bantu pernapasan

B2/Kardiovaskuler

Nadi

: 74x/m, reguler dan kuat

Bunyi janting

: normal

Letak jantung

: ictus cordis teraba pada interkosta ke-lima kira-kira


satu jari medial dari garis midclviucla

Pembesaran jantung

: ada

Nyeri dada

: tidak ada

Oedeme

: tidak ada

Clubbing finger
B3/ persarafan

: tidak ada

Tingkat kesadaran

: compos mentis

GCS

: 15, eye: 4, verbal:5, motorik: 6

Reflek

: normal

Koordinasi gerak

: Klien mampu mengkoordinasikan gerak

Kejang

: tidak ada

Penginderaan (persepsi sensori)


1.

Mata

Bentuk

: normal

Visus

:-

Pupil

: isokor

Gerak bola mata

: menyempit

Medan penglihatan

: menyempit

Buta warna

Tekanan Intra Okuler : tidak

2.

Hidung

Bentuk

: normal

Gagguan penciuman

: tidak ada

3.

Telinga

Aurikel

Membaran timpani

: keruh

Ottorhochea

: tidak ada

Gangguan pendengaran: ada

Tinitus

4.

Perasa

: normal

5.

Peraba

: normal

: tidak ada

: normal

: ada

B4/perkemihan

Masalah kandung kemih : Tidak terjadi nyeri saat BAK, tidak ada distensi suprapubik ,
BAK lancar , tidak terjadi infeksi, tidak terjadi terjadi inkontinensia urine.

Produksi urin

: volume BAK 400 ml / hari

Frekuensi BAK

Warna

: kuning

Bau

:amoniak

: 3 4 x/hari

B5/eliminasi alvi
1.

Mulut dan tenggorokan

Mulut

: mukosa lembab

Lidah

: normal

Kebersihan rongga muluat : tidak berbau, gigi bersih, tidak ompong,

Tengorokan

: tidak ada keluhan

Abdomen

: dintensi

Pembesaran hepar

: tidak ada

Pembesaran lien

: tidak ada

Asites

: tidak ada

2.

Masalah usus dan rektum

BAB

: 3 hari sekali baru BAB, perut terasa penuh

Obat pencahar

Lavamen

B6/Otot/tulang/integumen
1.

Otot-tulang

Kemampuan pergerakan sendi lengan dan tungkai : bebas


Kemampuan kekuatan otot :

Fraktur

: tidak ada

Dislokasi

: tidak ada

Hematoma

2.

Integumen

Warna kulit

Turgor

Tulang belakang

: tidak ada
: sawo matang
: tidak elastis
: kiposis

REPRODUKSI
Payudara

Bentuk

: simetris

Benjolan

: tidak ada

Kelamin

Bentuk

: normal

Keputihan

: tidak ada

Siklus haid

: klien sudah menopause

ENDOKRIN

Faktor alergi

: tidak ada

Manifestasi

:-

Cara mengatasi

:-

Kelainan endokrin

: tidak ada

PENGETAHUAN KLIEN TENTANG KESEHATAN DIRINYA


Klien tahu bahwa dirinya sakit hipertensi dan rematik, tapi klien menganggap sakitnya
itu adalah sakit orang sudah tua.

ANALISA DATA
No

Data

Penyebab

Masalah

DS :
1.

Klien mengatakan 2 hari ini tidak


bias BAB.

2.

Klien

Pemenuhan

Gangguan Bowel

kebutuhan gizi

Eliminasi ( BAB )

tidak seimbang.
mengatakan

tidak

suka

makan sayur dan hanya minum air


putih sebanyak 3 gelas.
DO :
1.

Klien

hanya

makan

nasi

dan

sedikit sayur mayur.


2.

Bising usus 3 x /menit

3.

Perkusi abdomen hypertimpani.

RENCANA KEPERAWATAN
No.
1.

Dx. Kep.

Tujuan

Intervensi

Rasional

Gangguan

Setelah dilakukan

1. Kaji pengetahuan klien1.

Bowel

Intervensi

mengenai pemahaman

tingkat pengetahuan

Eliminasi

keperawatan dalam

tentang nutrisi.

klien tentang nutrisinya.

( BAB ) b.d

waktu 2 X 24 jam

Pemenuhan

klien dapat BAB

kebutuhan

secara normal.

gizi tidak

Kriteria hasil :

2.

Anjurkan klien makan 2.


sayur dan buah.

Untuk mengetahui

Sayur dan buah


merupakan makanan
yang yang tinggi serat

seimbang. 1. Klien mendapatkan

sehingga dapat

nutrisi yang cukup

membantu melancarnak

dengan gizi yang

n pencernaan.

seimbang.
2. Klien dapat BAB

3. klien untuk

3.

Untuk membantu

dengan lancer

meningkatkan intake

maksimal dalam

cairan 1500 cc yang

waktu 2 X 24 jam .

dipenuhi secara

melunakan feses.

bertahap.
4. Anjurkan klien untuk 4.
makan makanan yang

Untuk mengurasi
kembung/ distensi.

tidak bergas.
5. Lakukan auskultasi
bising usus.

5.

Untuk mengetahui
keefektifan rencana
sebelumnya.

IMPLEMENTASI

Dx.
Kep.

No.
1. 1
.

Implementasi
1. Mengkaji pengetahuan klien mengenai
pemahaman tentang nutrisi. Hasil: yang saya
tahu saya harus makan makanan yang sedikit
garam agar tensi saya tidak naik.

Evaluasi
S: Saya sudah dapat BAB
dengan lancar, minum sebanyak 5
gelas / hari, mau mencoba
mengkonsumsi sayuran dan buahbuahan.

2. Menganjurkan klien makan sayur dan buah.


Hasil: saya akan mencoba makan sayur

O:
Bising usus 10x / menit.
Makan dengan lauk pauk dan
3. Menganjurkan klien untuk meningkatkan
intake cairan 1500 cc yang dipenuhi secara sayuran.
Perkusi abdomen tympani.
bertahap. Hasil: nanti saya akan mencoba
minum yang banyak.
A:Masalah teratasi
4. Menganjurkan klien untuk makan makanan
yang tidak bergas. Hasil: saya akan
P: Hentikan intervensi
mengurangi makan singkong
5. Melakukan auskultasi bising usus. Hasil:
bising usus 5x/m
BAB III
PENUTUP
I.

KESIMPULAN
Pada lansia sistem gastrointestinal mengalami perubahan seperti kehilangan
gigi, indra pengecap yang mengalami penurunan fungsi, rasa lapar yang menurun,
peristaltic yang menurun dan lain-lain. Sehingga pada lansia pola eliminasi urine dan
fekal mengalami perubahan dimana perawat harus mampu membantu lansia dalam
menghadapi perubahan tersebut.

DAFTAR PUSTAKA
Asfawan. M, Dkk. 1988. Gizi dan Kesehatan Manula (Manusia Lanjut Usia). Jakarta : PT
Mediyatama Sarana Prakarsa
Lueckenofte, 1998. Pedoman Praktis Pengkajian Gerontologi Edisi 2. Jakarta: EGC
Nugroho, W. 2000. Keperawatan Gerontik Edisi 2. Jakarta : EGC
Watson, R. 2003. Perawatan pada Lansia. Jakarta : EGC
Tarwoto, Wartonah. 2010. Kebutuhan Dasar Manusia. Jakarta: Salemba Medika

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

7
MAR

31

ASUHAN KEPERAWATAN GERONTIK PADA PASIEN LANSIA


DENGAN MASALAH PEMENUHAN KEBUTUHAN KESELAMATAN
DAN KEAMANAN (kelompok 2)
ASUHANKEPERAWATANGERONTIK
PADAPASIENLANSIADENGAN
MASALAHPEMENUHANKEBUTUHAN
KESELAMATANDANKEAMANAN

DisusunOleh:
KELOMPOK2
1.DediDarmaPutra
2.EdiTaufikurahman
3.KikiApriliyanti
4.NoviaYesiana

AKADEMIKEPERAWATAN
PEMERINTAHKABUPATENKOTAWARINGINTIMUR
Jl.BatuBerlianNo.11Telp(0531)22960
2012
KATAPENGANTAR
PujisyukurkepadaTuhanYangMahaEsakarenaberkattaufikdanhidayahNya,
makalah ini dapat diselesaikan. Makalah ini merupakan makalah pengetahuan bagi
mahasiswa/IakperpemkabkotimmaupunparapembacauntukbidangIlmuPengetahuan.
Makalahinisendiridibuatgunamemenuhisalahsatutugaskuliahdaridosenmata
kuliah Keperawatan Gerontikdengan judulStandarASUHAN KEPERAWATAN
GERONTIK PADA PASIEN LANSIA DENGAN MASALAH PEMENUHAN
KEBUTUHAN KESELAMATAN DAN KEAMANAN. Dalam penulisan makalah ini
penulis berusaha menyajikan bahasa yang sederhana dan mudah dimengerti oleh para
pembaca. Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih banyak
kekurangan.Olehkarenanya,penulismenerimakritikdansaranyangpositifdanmembangun
darirekanrekanpembacauntukpenyempurnaanmakalahini.
Penulis juga mengucapkan banyak terima kasih kepada rekanrekan yang telah
membantudalampenyelesaianmakalahini.
Akhirkata,semogamakalahinidapatmemberikanmanfaatkepadakitasemua.
Amin.

Sampit,Maret2012

DAFTARISI
KATAPENGANTAR.................................................................................................................
i
DAFTARISI...............................................................................................................................
ii
BAB I............................................................................................................................
PENDAHULUAN
A.LATARBELAKANG...............................................................................................1
B.TUJUANPENULISAN............................................................................................2
C.RUMUSANMASALAH...........................................................................................2
D.METODEPENULISAN............................................................................................2
E.SISTEMATIKAPENULISAN..................................................................................2
BABIIPEMBAHASAN
A.PERANPERAWATDALAMPEMENUHANKEBUTUHANKEAMANAN....3
B.KESELAMATANDANKEAMANAN...................................................................4

BAB

III.............................................................................................................................
PENUTUP
A.KESIMPULAN.........................................................................................................39
B.SARAN......................................................................................................................39
DAFTARPUSTAKA

BABI
PENDAHULUAN
A.LATARBELAKANG
Seiringdenganmeningkatnyakualitaspelayanankesehatandinegaramajudannegara
berkembang, maka bertambahlah usia harapan hidup penduduk negara tersebut. Hal ini
berarti,akanbertambahnyapopulasipenduduklanjutusia(lansia).DiIndonesiadanbeberapa
negaraberkembanglainnyaseseorangdikelompokkankedalamgolonganlansiajikaumur
kronologisnyasudah60tahun(Kane,1994).
Penyakit pada usia lanjut dengan gejala khas yaitu multipatologi (lebih dari satu
penyakit), kemampuan fisiologis tubuh yang sudah menurun, tampilan gejala yang tidak
khas/menyimpang, dan penurunan status fungsional (kemampuan kreraktivitas). Penyakit
penyakityangditemukanpadapasiengeriatriumumnyaadalahpenyakitdegeneratifkronik
(Kane,1994).
Setiaporangpastiinginmemilikimasatuayangbahagiatetapikeinginantidaklahselalu
dapatmenjadinyata.Padakehidupannyata,banyaksekalilansialansiayangmenjadidepresi,
stress,danberpenyakitan.Banyakkitatemukanlansiayangdikirimkepantijompodantidak
terurusolehkeluarga,adalansiayangdiasingkandarikehidupananakcucunyameskipun
hidupdalamlingkunganyangsama,adalansiayangmasihharusbekerjakerasmeskipun
sudahtua,danmasihbanyakhalhallainnyayangmenjadipenyebab(Lueckenotte,2000;
Hall&Hassett,2002).
Perawatsebagaitenagakesehatanyangprofesionalmempunyaikesempatanpalingbesar
untuk memberikan pelayanan/asuhankeperawatan yang komprehensif dengan membantu
klienmemenuhikebutuhandasaryangholistik,salahsatunyadalampemenuhankebutuhan
keselamatandankeamanan.
B.TUJUANPENULISAN
Untuk mengidentifikasi pemahaman perawat terhadap pemenuhan kebutuhan
keselamatandankeamananklienpadapasienlansia.
C.RUMUSANMASALAH
Berdasarkanlatarbelakangdiatas,makarumusanmasalahdalammakalahiniadalah
bagaimana asuhan keperawatan pada lansia (Lanjut Usia) dengan pemenuhan kebutuhan
keselamatandankeamanan.
D.METODEPENULISAN
Metode yang digunakan dalam penulisan makalah ini yaitu metode kepustakaan dan
dikutipdarisumbersumberyangdapatdibuktikankebenarannya.

E.SISTEMATIKAPENULISAN
SistematikapenulisanmakalahiniyaituKataPengantar,DaftarIsi,BabIPendahuluan
yangterdiridariLatarBelakang,RumusanMasalah,TujuanPenulisan,MetodePenulisan,
danSistematikaPenulisan.BabIIPembahasan.BabIIIPenutupyangterdiridariKesimpulan
danSaran.DaftarPustaka.

BABII
PEMBAHASAN
A.PERANPERAWATDALAMPEMENUHANKEBUTUHANKEAMANAN
Peranperawatdalampemenuhankebutuhankeamanandapatberperansecaralangsung
maupuntidaklangsung.Secaralangsungperawatdapatmelakukanasuhankeperawatanpada
klien yang mengalami masalah terkait dengan ketidakterpenuhinya kebutuhan keamanan.
Adapunperanperawatdalampemenuhankebutuhankeamananadalahsebagaiberikut:
1.Pemberi perawatan langsung (care giver); perawat memberikan bantuan secara
langsung pada klien dan keluarga yang mengalami masalah terkait dengan kebutuhan
keamanan.
2.Pendidik, perawat perlu memberikan pendidikan kesehatan kepada klien dan
keluarga agar klien dan keluarga melakukan program asuhan kesehatan keluarga terkait
dengan kebutuhan keamanan secara mandiri, dan bertanggung jawab terhadap masalah
keamanankeluarga.
3.Pengawaskesehatan,perawatharusmelakukanhomevisitataukunjunganrumah
yangteraturuntukmengidentifikasiataumelakukanpengkajiantentangkebutuhankeamanan
kliendankeluarga.
4.Konsultan, perawat sebagai narasumber bagi keluarga dalam mengatasi masalah
keamanankeluarga.Agarkeluargamaumemintanasehatkepadaperawatmakahubungan
perawatkeluarga harus dibina dengan baik, perawat harus bersikap terbuka dan dapat
dipercaya.
5.Kolaborasi,perawatjugaharusbekerjasamadenganlintasprogrammaupunsecara
lintassektoraldalampemenuhankebutuhankeamanankeluargauntukmencapaikesehatan
dankeamanankeluargayangoptimal.
6.Fasilitator,perawatharusmampumenjembatanidenganbaikterhadappemenuhan
kebutuhan keamanan klien dan keuarga sehingga faktor risiko dalam ketidakpemenuhan
kebutuhankeamanandapatdiatasi.
7.Penemukasus/masalah,perawatmengidentifikasimasalahkeamanansecaradini,
sehingga tidak terjadi injuri atau risiko jatuh pada klien yang tidak mampu memenuhi
kebutuhankeamanannya.
8.Modifikasi lingkungan, perawat harus dapat memodifikasi lingkungan baik
lingkunganrumahmaupunlingkunganmasyarakatagarterciptalingkunganyangsehatdalam
menunjangpemenuhankebutuhankeamanan.
B.KESELAMATANDANKEAMANAN
Keselamatanadalahsuatukeadaanseseorangataulebihyangterhindardariancaman
bahayaataukecelakaan.Kecelakaanmerupakankejadianyangtidakdapatdidugadantidak
diharapkanyangdapatmenimbulkankerugian,sedangkankeamananadalahkeadaanaman
dantentram.

KONSEPDASAR
1.Faktorfaktoryangmempengaruhikebutuhankeselamatandankeamanan
a.Usia
Padaanakanaktidakterkontroldantidakmengetahuiakibatdariapayangdilakukan.
Padaorangtuaataulansiaakanmudahsekaliterjatuhataukerapuhantulang.
b.Tingkatkesadaran
Padapasienkoma,menurunnyaresponsterhadaprangsang,paralisis,disorientasi,dan
kurangtidur.
c.Emosi
Emosisepertikecemasan,depresi,danmarahakanmudahsekaliterjadidanberpengaruh
terhadapmasalahkeselamatandankeamanan.
d.Statusmobilisasi
Keterbatasanaktivitas,paralisis,kelemahanotot,dankesadaranmenurunmemudahkan
terjadinyarisikoinjuriataugangguanintegritaskulit.
e.Gangguanpersepsisensori
Kerusakan sensori akan memengaruhi adaptasi terhadap rangsangan yang berbahaya
sepertigangguanpenciumandanpenglihatan.
f.Informasi/komunikasi
Gangguankomunikasisepertiafasiaatautidakdapatmembacamenimbulkankecelakaan.
g.Penggunaanantibiotikyangtidakrasional
Antibiotikdapatmenimbulkanresistendansyokanafilaktik
h.Keadaanimunitas
Gangguanimunitasakanmenimbulkandayatahantubuhyangkurangsehinggamudah
terserangpenyakit.
i.Ketidakmampuantubuhdalammemproduksiseldarahputih
Seldarahputihberfungsisebagaipertahanantubuhterhadapsuatupenyakit.
j.Statusnutrisi
Keadaan nutrisi yang kurang dapat menimbulkan kelemahan dan mudah terserang
penyakit,demikiansebaliknya,kelebihannutrisiberisikoterhadappenyakittertentu.
k.Tingkatpengetahuan
Kesadaran akan terjadinya gangguan keselamatan dan keamanan dapat diprediksi
sebelumnya.
2.Macammacambahayaataukecelakaan
a.Dirumah
Tersedak.
Jatuh.
Tertelanalatalatrumahtangga.
Tersiramairpanas.
Jatuhdarijendelaatautangga.
Terpotong.
Lukatusukataulukagores.
Lukabakar.
Tenggelam.
Terkenapecahankaca.
Jatuhdarisepeda.
Keracunan.

b.Dirumahsakit
Mikroorganisme.
Cahaya.
Kebisingan.
Temperatur.
Kelembapan.
Cederaataujatuh.
Kesalahanprosedur.
Peralatanmedik.
Radiasi.
Keracunaninhalasi,injeksi.
Syokelektrik.
Asfiksiadankebakaran.
3.Pencegahankecelakaandirumahsakit
a.Mengkajitingkatkemampuanpasienuntukmelindungidirisendiridarikecelakaan.
b.Menjagakeselamatanpasienyanggelisahselamaberadaditempattidur.
c.Menjaga keselamatan klien dari infeksi dengan mempertahankan teknik aseptik,
menggunakanalatkesehatansesuaitujuan.
d.Menjagakeselamatanklienyangdibawadengankursiroda.
e.Menghindarikecelakaan:
Menguncirodakeretadorongsaatberhenti.
Tempattidurdalamkeadaanrendahdanadapenghalangpadapasienyanggelisah.
Belberadapadatempatyangmudahdijangkau.
Mejayangmudahdijangkau.
Keretadorongadapenghalangnya.
f.Mencegahkecelakaanpadapasienyangmenggunakanalatlistrikmisalnyasuction,kipas
angin,danlainlain.
g.Mencegah kecelakaan pada klien yang menggunakan alat yang mudah meledak seperti
tabungoksigendantermos.
h.Memasanglabelpadaobat,botol,danobatobatanyangmudahterbakar.
i.Melindungisemaksimalmungkinkliendariinfeksinosokomialsepertipenempatanklien
terpisahantarainfeksidannoninfeksi.
j.Mempertahankanventilasidancahayayangadekuat.
k.Mencegahterjadinyakebakaranakibatpemasanganalatbantupenerangan.
l.Mempertahankankebersihanlantairuangandankamarmandi.
m.Menyiapkan alat pemadam kebakaran dalam keadaan siap pakai dan mampu
menggunakannya.
n.Mencegahkesalahanprosedur;identitasklienharusjelas.
KESELAMATANDANKEAMANANPADALANSIA
PENYEBABKECELAKAANPADALANSIA:
1.Fleksibilitasekstremitasyangberkurang
2.Fungsipenginderaandanpendengaranmenurun
3.Pencahayaanyangkurang
4.Lantailicindantidakrata
5.Tanggatidakadapengaman
6.Kursiatautempattiduryangmudahbergerak

7.Kehilangankesadarantibatiba(syncope)
TINDAKANPENGAMANANPADALANSIA:
1.Berikanalatbantuyangsesuai
2.Latihlansiauntukmobilisasi
3.Usahakanadayangmenemanijikabepergian
4.Letakkanperalatanterjangkaulansia
5.Gunakantempattidurtidakterlalutinggi
6.Penataanruanganharusbebaslalulalang
7.Upayakanlantaibersih,tidaklicin,rata,dantidakbasah
8.Hindarilampuredup/menyilaukan
PENGKAJIANDANPENCEGAHANJATUHPADALANSIA
A.DEFINISI
Jatuhadalahsuatukejadianyangdilaporkanpenderitaatausaksimata,yangmelibatkan
seseorang mendadak terbaring/terduduk di lantai /tempat yang lebih rendah atau tanpa
kehilangankesadaranatauluka(Reuben)Jatuhseringterjadiataudialamiolehusialanjut.
Banyak faktorberperandidalamnya ,kelemahan ototekstremitas bawahkekakuan sendi,
sinkopedandizzines,sertafaktorekstrinsiksertailantaiyanglicindantidakratatersandung
bendabenda,pengelihatankurangterangdansebagainya.Tidakmengejutkanbahwajatuh
merupakankejadianyangmempercepatpatahtulangpadaorangdengankepadatanmineral
tulang{BoneMineralDensity(BMD)}rendah.
Jatuhdapatdicegahsehinggaakanmengurangirisikopatahtulang.Jatuhadalahpenyebab
terbesaruntukpatahtulangpingguldanberkaitandenganmeningkatnyarisikoyangberarti
terhadap berbagai patah tulang meliputi punggung, pergelangan tangan, pinggul, lengan
bagianatas.
Jatuhdapatdisebabkanolehbanyakfaktor,sehinggastrategipencegahanharusmeliputi
berbagaikomponenagarsukses.Aktivitasfisikmeliputipolagerakanyangberagamseperti
latihankekuatanataukelasaerobikdapatmeningkatkanmassatulangsehinggatulanglebih
padatdandapatmenurunkanrisikojatuh.
MengurangiRisikoJatuh
Banyakhalyangdapatdilakukanuntukmengurangirisikojatuhdanmeminimalisirdampak
darijatuhyangterjadi.PedomanyangdikeluarkanolehAmericanGeriatricsSociety,British
GeriatricsSociety,danAmericanAcademyofOrthopediSurgeonspadapencegahanjatuh
meliputibeberaparekomendasiuntukorangtua(AGSetal.2001).
Faktorfaktorlingkunganyangseringdihubungandengankecelakaanpadalansia
Faktorpenyebabjatuhpadalansiadapatdibagidalam2golonganbesar,yaitu:
1.FaktorIntrinsik
Faktorinstrinsikdapatdisebabkanolehprosespenuaandanberbagaipenyakitseperti
StrokedanTIAyangmengakibatkankelemahantubuhsesisi,Parkinsonyangmengakibatkan
kekakuanalatgerak,maupunDepresiyangmenyebabkanlansiatidakterlaluperhatiansaat
berjalan.
Gangguan penglihatan pun seperti misalnya katarak meningkatkan risiko jatuh pada
lansia.Gangguansistemkardiovaskulerakanmenyebabkansyncope,syncopelahyangsering
menyebabkanjatuhpadalansia.Jatuhdapatjugadisebabkanolehdehidrasi.Dehidrasibisa
disebabkanolehdiare,demam,asupancairanyangkurangataupenggunaandiuretikyang
berlebihan.

2.FaktorEkstrinsik
Alatalat atau perlengkapan rumah tangga yang sudah tua atau tergeletak di bawah,
tempattidurtidakstabilataukamarmandiyangrendahdantempatberpeganganyangtidak
kuatatautidakmudahdipegang,lantaitidakdatar,licinataumenurun,karpetyangtidak
dilemdenganbaik,kesetyangtebal/menekukpinggirnya,danbendabendaalaslantaiyang
licinataumudahtergeser,lantailicinataubasah,peneranganyangtidakbaik(kurangatau
menyilaukan),alatbantujalanyangtidaktepatukuran,berat,maupuncarapenggunaannya.

B.PENCEGAHAN
Pencegahandilakukanberdasaratasfaktorresikoapayangdapatmenyebabkanjatuh
sepertifaktorneuromuskular,muskuloskeletal,penyakityangsedangdiderita,pengobatan
yangsedangdijalani,gangguankeseimbangandangayaberjalan,gangguanvisual,ataupun
faktor lingkungan. dibawah ini akan di uraikan beberapa metode pencegahan jatuh pada
orangtua:
1.Latihanfisik
Latihanfisikdiharapkanmengurangiresikojatuhdenganmeningkatkankekuatantungkaidan
tangan,memperbaiki keseimbangan, koordinasi, dan meningkatkan reaksi terhadap bahaya
lingkungan,latihanfisikjugabisamengurangikebutuhanobatobatansedatif.Latihanfisik
yangdianjurkanyangmelatihkekuatantungkai,tidakterlaluberatdansemampunya,salah
satunyaadalahberjalankaki.(1,4,5,6)
2.Managemenobatobatan
Gunakandosisterkecilyangefektifdanspesifikdiantara:
Perhatikanterhadapefeksampingdaninteraksiobat
Gunakanalatbantuberjalanjikamemangdiperlukanselamapengobatan
Kurangi pemberian obatobatan yang sifatnya untuk waktu lama terutama sedatif dan
tranquilisers
Hindaripemberianobatmultiple(lebihdariempatmacam)kecualiatasindikasikliniskuat
Menghentikanobatyangtidakterlaludiperlukan
3.Modifikasilingkungan
Atursuhuruangansupayatidakterlalupanasataudinginuntukmenghindaripusingakibat
suhudiantara:
Taruhlahbarangbarangyangmemangseringkalidiperlukanberadadalamjangkauantanpa
harusberjalandulu
Gunakankarpetantislipdikamarmandi.
Perhatikankualitaspenerangandirumah.
Jangansampaiadakabellistrikpadalantaiyangbiasauntukmelintas.
Pasangpegangantanganpadatangga,bilaperlupasanglamputambahanuntukdaerahtangga.
Singkirkanbarangbarangyangbisamembuatterpelesetdarijalanyangbiasauntukmelintas.
Gunakanlantaiyangtidaklicin.
Aturletakfurnitursupayajalanuntukmelintasmudah,menghindaritersandung.
Pasangpegangantanganditempatyangdiperlukansepertimisalnyadikamarmandi.
4.Memperbaikikebiasaanpasienlansiamisalnya:

Berdiridariposisidudukataujangkokjanganterlalucepat.
Janganmengangkatbarangyangberatsekaligus.
MengambilbarangdengancarayangbenardariLantai.
Hindariolahragaberlebihan.
5.Alaskaki
Perhatikanpadasaatorangtuamemakaialaskaki:
Hindarisepatuberhaktinggi,pakaisepatuberhaklebar
Janganberjalanhanyadengankauskakikarenasulituntukmenjagakeseimbangan
Pakaisepatuyangantislip
6.Alatbantujalan
Terapi untuk pasien dengan gangguan berjalan dan keseimbangan difokuskan untuk
mengatasiataumengeliminasipenyebabnyaataufaktoryangmendasarinya.
Penggunaannyaalatbantujalanmemangmembantumeningkatkankeseimbangan,namundi
sisilainmenyebabkanlangkahyangterputusdankecenderungantubuhuntukmembungkuk,
terlebih jika alat bantu tidak menggunakan roda. Karena itu penggunaan alat bantu ini
haruslahdirekomendasikansecaraindividual.
Apabila pada lansia yang kasus gangguan berjalannya tidak dapat ditangani dengan obat
obatanmaupunpembedahan.Olehkarenaitu,penanganannyaadalahdenganalatbantujalan
seperticane(tongkat),crutch(tongkatketiak)danwalker.(Jikahanya1ekstremitasatasyang
digunakan, pasien dianjurkan pakai cane). Pemilihan cane type apa yang digunakan,
ditentukanolehkebutuhandanfrekuensimenunjangberatbadan.Jikake2ekstremitasatas
diperlukanuntukmempertahankankeseimbangandantidakperlumenunjangberatbadan,
alatyangpalingcocokadalahfourwheeledwalker.Jikakeduaekstremitasatasdiperlukan
untuk mempertahankan keseimbangan dan menunjang berat badan, maka pemilihan alat
ditentukanolehfrekuensiyangdiperlukandalammenunjangberatbadan.
7.Periksafungsipenglihatandanpendengaran
8.Hipprotektor:terbuktimengurangiresikofrakturpelvis.
9.Memeliharakekuatantulang
SuplemennutrisiterutamakalsiumdanvitaminDterbuktimeningkatkandensitastulangdan
mengurangiresikofrakturakibatterjatuhpadaorangtua
Berhentimerokok
Hindarikonsumsialkohol
Latihanfisik
Antiresorbsisepertibiophosphonatesdanmodulatorreseptorestrogen
Suplementasihormonestrogen/terapihormonpengganti.

ASUHANKEPERAWATAN
Pengkajian
1.Faktorfaktoryangberhubungandengansistemsensorikomunikasipasiensepertiadanya
perubahanperilakupasienkarenagangguansensorikomunikasi:

a.Halusinasi;
b.Gangguanprosespikir;
c.Kelesuan;
d.Ilusi;
e.Kebosanandantidakbergairah;
f.Perasaanterasing;
g.Kurangnyakonsentrasi;
h.Kurangnyakoordinasidankeseimbangan.
2.Faktorrisikoyangberhubungandengankeadaanlain:
a.Kesadaranmenurun;
b.Kelemahanfisik;
c.Imobilisasi;
d.Penggunaanalatbantu.
Pengkajiankliendenganresikoinjurimeliputi:
Pengkajian resiko (Risk assessment tools) dan adanya bahaya dilingkungan klien (home
hazardsappraisal).
a.ResikoJatuh
Usiaklienlebihdari65tahun
RiwayatjatuhdirumahatauRS
Mengalamigangguanpenglihatanataupendengaran
Kesulitanberjalanataugangguanmobilitas
Menggunakanalatbantu(tongkat,kursiroda,dll)
Penurunanstatusmental(disorientasi,penurunandayaingat)
Mendapatkanobattertentu(sedatif,hypnotik,tranquilizers,analgesics,diuretics,orlaxatives)
b.Riwayatkecelakaan
Beberapaorangmemilikikecenderunganmengalamikecelakaanberulang,olehkarenaitu
riwayatsebelumnyaperludikajiuntukmemprediksikemungkinankecelakaanituterulang
kembali
c.Keracunan
Beberapaanakdanorangtuasangatberesikotinggiterhadapkeracunan.Pengkajianmeliputi
seluruh aspek pengetahuan keluarga tentang resiko bahaya keracunan dan upaya
pencegahannya.
d.Kebakaran
Beberapa penyebab kebakaran dirumah perlu ditanyakan tentang sejauh mana klien
mengantisipasiresikoterjadikebakaran,termasukpengetahuankliendankeluargatentang
upayaproteksidaribahayakecelakaanakibatapi.
e.PengkajianBahaya
Meliputimengkajikeadaan:lantai,peralatanrumahtangga,kamarmandi,dapur,kamartidur,
pelindungkebakaran,zatzatberbahaya,listrik,dllapakahdalamkeadaanamanataudapat
mengakibatkankecelakaan.
f.Keamanan(spesifikpadalansiadirumah)
Gangguankeamananberupajatuhdirumahpadalansiamemilikiinsidensiyangcukuptinggi,
banyakdiantaralansiatersebutyangakhirnyacederaberatbahkanmeninggal.Bahayayang
menyebabkanjatuhcenderungmudahdilihattetapisulituntukdiperbaiki,olehkarenaitu
diperlukanpengkajianyangspesifiktentangkeadaanrumahyangterstuktur.

ContohpengkajianchecklistpencegahanjatuhpadalansiayangdikeluarkanolehDepartemen
kesehatandanpelayananmasyarakatAmerika.

DiagnosaKeperawatandanIntervensi(TarwotodanWartonah)
1.Risikoinjuri
Definisi: kondisi dimana pasien berisiko mengalami injuri akibat hubungannya dengan
kondisilingkungan,adaptasi,dansumbersumberyangmengancam.
YKemungkinanberhubungandengan:
a.Kurangnyainformasitentangkeamanan;
b.Kelemahan;
c.Gangguankesadaran;
d.Kurangnyakoordinasiotot;
e.Epilepsi;
f.Episodekejang;
g.Vertigo;
h.Gangguanpersepsi.
YKemungkinandatayangditemukan:
a.Perlukaandaninjuri.
YKondisikliniskemungkinanterjadipada:
a.AIDS;
b.Demensia;
c.Pengobatanbarbiturat,halosinogen,danbenzodiazepin;
d.Epilepsi;
e.Penyakitperdarahan.
YTujuanyangdiharapkan:
a.Injuritidakterjadi.
YIntervensi:
a.Cekkeadaanpasiensetiapjamdanberikanpenghalangpadatempattidurnya
b.Cektandavitalsetiap4jamdankepatenansaluranpernapasan
c.Jangantinggalkanobatyangdekatdengantempattidurnya
d.Siagakanalatalatemergensisepertisuctiondanintubasipadatempatnya
e.Kuncirodatempattidur
f.Posisikepalalebihditinggikan
g.Berikanpeneranganyangcukuppadamalamhari
h.Kolaborasidengandokterdalammenanganimasalahgangguanpersepsipasien
i.Bantupasiendalampergerakan/aktivitasketoilet
j.Lakukankajiankeadaankulitpasiendangunakantempattidurkhususuntukmencegah
dekubitus
k.Berikanpendidikankesehatantentang:
Perubahangayahidupsepertimerokokdanminumalkohol
Pencegahaninjuridirumah
YRasional:
a.Pencegahanprimer
b.Monitorfaktorrisiko

c.Mencegahterjadinyakecelakaan
d.Dibutuhkanpadasaatemergensi
e.Mempertahankankeamanan
f.Mencegahaspirasi
g.Mencegahjatuh
h.Mencegahkecelakaanakibatgangguansensori
i.Mencegahkecelakaan
j.Mencegahkomplikasiakibatinjuri
k.Mencegahinjuri
2.Perubahanproteksi
Definisi:kondisidimanapasienmengalamipenurunankemampuanuntukmelindunginya
dirinyasendiridaripenyakit,baikdariluarmaupundaridalamtubuh.
YKemungkinanberhubungandengan:
a.Defisitimunologi;
b.Malnutrisi;
c.Kemoterapiatauefekpengobatan;
d.Penglihatanyangkurang;
e.Kuranginformasitentangkeselamatan.
YKemungkinandatayangditemukan:
a.Riwayatkecelakaan;
b.Lingkunganyangberesiko.
YKondisikliniskemungkinanterjadipada:
a.Usia:kematangan,sangattua;
b.Nutrisikurang;
c.Gangguandarah;
d.Pembedahan;
e.Radiasiataukemoterapi;
f.Penyakitimunitas;
g.AIDS.
YTujuanyangdiharapkan:
Pasientidakmengalamiinfeksinosokomial
YIntervensi:
a.Luangkanwaktuuntukmenjelaskantentangproteksi/metodeisolasi
b.Kolaborasidengandokterdalampemberianpengobatan
c.Jagapasiendariinjuridaninfeksi
d.Monitortandavital,integritaskulit,efekobat,danpendarahandaribekassuntikan
e.Tekantempatpenyutikansetelahmenyuntik
f.Berikandietadekuat
g.Lakukanpendidikankesehatantentang:
Pemberianpengobatan
Mempertahankankeamanan
Teknikisolasi
Penggunaanalatalatproteksi
YRasional:
a.Mengurangirisikopenularanpenyakit
b.Mengatasifaktorpenyebab
c.Mengurangirisikoinfeksi

d.Datadasaruntukmembandingkanadanyagangguanproteksi
e.Menghindaripendarahan
f.Meningkatkandayatahantubuh
g.Memberikanpengetahuandasartentangmenjagakeamanandiri
3.Risikotinggiinfeksi
Definisi: kondisidimanapasien mempunyairisikoyang tinggi terhadap masuknyavirus
penyakit.
YKemungkinanberhubungandengan:
a.Tidakadekuatnyapertahananprimer;
b.Kerusakanjaringan;
c.Terpaparnyalingkunganyangterkontaminasipenyakit;
d.Prosedurinvasif;
e.Malnutrisi;
f.Penyakitkronis.
YKemungkinandatayangditemukan:
a.Kondisikulit;
b.Nilailaboratorium;
c.Pemakaianalatalatinvasif.
YKondisikliniskemungkinanterjadipada:
a.AIDS;
b.Infeksibakteridanvirus;
c.Kondisisetelahoperasi.
YTujuanyangdiharapkan:
a.Pasiendapatmenunjukkanpenurunaninfeksi.
b.Tidakadatandatandainfeksi.
YIntervensi:
a.Monitortandavitalsetiap4jam
b.Gunakanmetodepengontroladanyainfeksi
c.Pertahankandietadekuat,vitaminC,dantabletFe
d.Catathasillaboratorium
e.Monitorpemberianantibiotikdankajiefeksampingnya
f.Informasikantentangefekpengobatan
g.Lakukantekniksteril
h.Lakukanpendidikankesehatantentang:
Pencegahandanpenularanpenyakit
Tandadangejalainfeksi
Hidupsehat
YRasional:
a.Datadasaruntukmengetahuikeadaannormal
b.Melindungipasiendariinfeksi
c.Meningkatkandayatahantubuh
d.Mengidentifikasiadanyainfeksi
e.Mencegahkomplikasi
f.Mencegahinfeksisilang
g.Mencegahterjadinyainfeksi
h.Memberikanpengetahuandasarbagaimanacaramemproteksidiri

DiagnosaKeperawatandanIntervensi(NANDA)
1.DiagnosaumumseringmunculpadakasuskeamananfisikmenurutNANDAadalah:
Resikotinggiterjadinyacedera(Highriskforinjury).
Seorangklienmengalamimasalahkeperawatanresikotinggiterjadinyaciderabilakondisi
lingkungandanadaptasiataupertahananseseorangberesikomenimbulkancedera.
Resiko terjadinya keracunan: adanya resiko terjadinya kecelakaan akibat terpapar, atau
tertelannyaobatatauzatberbahayadalamdosisyangdapatmenyebabkankeracunan.
Resikoterjadinyasufokasi:adanyaresikokecelakaanyangmenyebabkantidakadekuatnya
udarauntukprosesbernafas.
Resikoterjadinyatrauma:adanyaresikoyangmenyebabkancederapadajaringan(ms.Luka,
lukabakar,ataufraktur).
Responalergilateks:responalergiterhadapprodukyangterbuatdarilateks.
Resikoresponalergilateks:kondisiberesikoterhadapresponalergiterhadapprodukyang
terbuatdarilateks.
Resiko terjadinya aspirasi: klien beresiko akan masuknya sekresi gastrointestinal, sekresi
orofaringeal,bendapadatataucairankedalamsaluranpernafasan.
Resiko terjadinya sindrom disuse (gejala yang tidak diinginkan): klien beresiko terhadap
kerusakan sistem tubuh akibat inaktifitas sistem musculoskeletal yang direncanakan atau
tidakdapatdihindari.
2.Perencanaan
Secaraumumrencanaasuhankeperawatanharusmencakupduaaspekyaitu:
Pendidikankesehatantentangtindakanpencegahandanmemodifikasilingkunganagarlebih
aman.
1.Contohrencanaasuhankeperawatan:
Diagnosakeperawatan:Resikotinggicedera:jatuhberhubungandenganpenurunansensori
(tidakmampumelihat)
Tujuan:Klienmemperlihatkanupayamenghindaricedera(jatuh)ataucidera(jatuh)tidak
terjadi
Kriteriahasil:Setelahdilakukantindakankeperawatanberupamodifikasilingkungandan
pendidikankesehatandalam1harikunjungandiharapkanKlienmampu:
a.Mengidentifikasibahayalingkunganyangdapatmeningkatkankemungkinancidera
b.Mengidentifikasitindakanpreventifatasbahayatertentu,
c.Melaporkanpenggunaancarayangtepatdalammelindungidiridaricidera.
3.Intervensi
a.Kajiulangadanyafaktorfaktorresikojatuhpadaklien.
b.Tulisdanlaporkanadanyafaktorfaktorresiko
c.Lakukanmodifikasilingkunganagarlebihaman(memasangpinggirantempattidur,dll)
sesuaihasilpengkajianbahayajatuhpadapoin1
d.Monitorkliensecaraberkalaterutama3haripertamakunjunganrumah
e.Ajarkankliententangupayapencegahancidera(menggunakanpencahayaanyangbaik,
memasangpenghalangtempattidur,menempatkanbendaberbahayaditempatyangaman)
f.Kolaborasidengandokteruntukpenatalaksanaanglaukomadangangguanpenglihatannya,
sertapekerjasosialuntukpemantauansecaraberkala.

Secaraumumkriteriahasilpalingpentingpadakasusresikotinggicideraadalahmembantu
klienuntukmengidentifikasibahaya,danmampumelakukantindakanmenjagakeamanan.
Kriteria hasil yang lebih spesifik diantaranya, Klien mampu: mengidentifikasi bahaya
lingkungan yang dapat meningkatkan kemungkinan cidera, mengidentifikasi tindakan
preventifatasbahayatertentu,melaporkanpenggunaancarayangtepatdalammelindungidiri
daricidera.

FORMATPENGKAJIANINDIVIDU
ASUHANKEPERAWATANGERONTIK
TanggalPengkajian:22Maret2012
A.DATABIOGRAFI
Nama:Ny.M
TTL:KualaKapuas,15September1939
JenisKelamin:Perempuan
Pendidikan:SD
Agama:Islam
StatusPerkawinan:Janda
TB/BB:151cm/45kg
Penampilan:Bersih,kurangrapi,gigiompong
CiriciriTubuh:Kulitkeriput,adabekaslukagoresdilututkiri,kifosis
Alamat:Jl.BatuManyarNo.21
OrangYangDekat:Ny.S
Hubungan:Anakkandung
Alamat/Telepon:Jl.BatuManyarNo.21
B.RIWAYATKEPERAWATAN
1.

Genogram

Keterangan::Lakilaki:GarisKeturunan
:Perempuan:TinggalSerumah
:GarisHubungan:Meninggal
2.RiwayatKeluarga
Klienadalahanakketigadari3orangbersaudara.Merupakananakdaripasanganpetani.
Ayahklienmeninggalduniasaatkliendudukdikelas4SD.Sedangkanibuklienmeninggal
saat klien kelas 6 SD. Klien sendiri tidak tahu penyakit apa yang pernah diderita oleh
mendiang orang tuanya. Setelah orang tua klien meninggal dunia, awalnya klien tinggal
bertiga dengan saudarasaudara klien saja sebelum akhirnya kakak pertamanya menikah.
Klienakhirnyatinggalberduadengankakakkeduanyasampaiakhirnyakakakklienjuga
menikah.Klienlupakapantepatnyaklienmenikah.Klienmenikahdenganseoranggurudan
memiliki4oranganak.Setelahsuamiklienmeninggalduniatahun2003karenastroke,klien
tinggaldengananakbungsunyadirumah.
C.RIWAYATPEKERJAAN
Pekerjaansaatini:
AlamatPekerjaan:
JarakDariRumah:
AlatTransportasi:
PekerjaanSebelumnya:
JarakDariRumah:
AlatTransportasi:
SumbersumberPendapatan&KecukupanTerhadapKebutuhan:
Sumberpendapatandidapatdarihasilpensiunansuamikliendandaripenghasilananakanak
klienterutamaanakbungsuklien.
D.RIWAYATLINGKUNGANHIDUP
Tipetempattinggal
Jenislantairumah:KayuUlin
Kondisilantai:Kering
Tanggarumah:
Penerangan:Cukup
Tempattidur:Aman
Alatdapur:Berserakan
WC:Cukupbaik,lumayanbersih,tapiagaklicin
Kebersihanlingkungan:Kurangbersih
Jumlahorangyangtinggaldalamsaturumah:3orang
Derajatprivasi:
Tetanggaterdekat:Ny.K

Alamatdantelepon:Jl.BatuberlianNo.11

E.RIWAYATREKREASI
Hobbi/Minat:BerkebundanMenyulam
KeanggotaanOrganisasi;OrganisasiWanitaWredatama
n:Terakhirkalipadatahun2011,klienpergimengunjungianaktertuanyadibanjarmasin
F.SISTEMPENDUKUNG
Perawat:Ny.N
Jarakdarirumah:2Km
RumahSakit:RSUDDr.MurjaniJarak3,5km
Klinik:Jarak
PelayananKes.Dirumah:
Makananygdihantarkan:
Perawatanseharihariyangdilakukandirumah:
Lainlain:
G.DISKRIPSIKEKHUSUSAN
KebiasaanRitual:Shalatwajib5waktu,shalatsunat
YangLainnya:mengajisetiapshalatmagribberakhir

H.STATUSKESEHATAN
StatusKesehatanUmumSelamaSetahunYangLalu:
Setahun yang lalu klien sempat dirawat di RS karena mengalami kecelakaan lalu lintas
dengananakklien.Klienmengalamilukalecetdipergelangantangandankakiklien.
StatusKesehatanUmumSelama5TahunYanglalu:
Klien sering mengeluh sakit di punggung, dan lutut klien terasa ngilu. Keluhan itu
berlangsungsampaisekarang.Klienjugapunyariwayatpenyakitgastritis.
KeluhanUtama:lututterasangilu
1.Provocative/Paliative:penumpukanKristalasamurat
2.Quality/Quantity:ngilungilu
: didaerahlututpalingterasasakit,selainitujugaterasasakitdipunggungsampaidaerah
pinggang
4.SeverityScale:6(dariskala010)
: sangatterasasaatmalamhari.Sifatnyahilangtimbuldanterkadangterasasakitberkisar
antara1015menit
Pemahaman&PenatalaksanaanMasalahKesehatan:
klienmenyadaridirinyasudahlansiadanseringsakitsakitan.Klientergolongorangyang
peduliterhadapkesehatannya,kalausakitklienakansegeraberobat.Klienjugatahukalau
diamenderitaarthritisgoutatauumumnyadikenalolehorangawam(termasukklien)dengan
asamurat.Tapikliensendiritidaktahudenganjelasapasebenarnyaasamuratitusendiridan
obatobatapayangdiminumklienselamaini.
Obatobatan:
Menurutklienobatyangdiminumnyaadalahparacetamoldanvitamin(karenasampelsudah
tidakada)
Alergi(CatatanAgentdanReaksiSpesifik)

Obatobatan:
Makanan:
FaktorLingkungan:
PenyakitYangDiderita
ArthritisGout(AsamUrat)

I.AKTIVITASHIDUPSEHARIHARI(ADL)
IndeksKATZ:A
Oksigenisasi:Baik,tanpaalatbantu
Cairan&Elektrolit:Klienminum46gelas/hari,kliensukaminumkopi
:Baik,klienterkadangmakannasilunak.Sayursayuranterutamakangkung,danikan
:BABkadanglancarkadangtidak,BAKdalamsehari35kali
: Terbatas,klienseringmerasalelahterutamamenahanrasacenatcenutdilututnya.Klien
jarangmelakukanaktivitasyangberlebihandanberat.
:Tidursiangkadangkadang,tidurmalamdaripukul21.00WIBdanterbangunpukul03.00
WIB
PersonalHygiene:Dapatdilakukansecaramandiri
:Sudahtidakmemilikikeinginanuntukmelakukanhubunganseksuallagi
:KlientidakpernahrekreasiselainmengunjungianaktertuanyadiBanjarmasintahun2011
lalu
J.PSIKOLOGI,KOGNITIFDANPERSEPTUAL
KonsepDiri:Baik,positif,klienmenyadaridirinyasudahlansia
Emosi:Labil,klienmudahtersinggung
:Baik,klienmudahmembaurdenganmasyarakatsekitarnya
Mekanismepertahanandiri:Baik
Statusmental
Tingkatkesadaran:Composmentis
Afasia:
Demensia:Tidak
Orientasi:Normal
Bicara:Normal
Bahasayangdigunakan:Dayak
Kemampuanmembaca:Bisa
Kemampuaninteraksi:Sesuai
Vertigo:Tidak
e(SPMSQ):6(KerusakanIntelektualSedang)
:6(GangguanIntelektualSedang)
:Skor4
:6(Sedang)
K.TINJAUANSISTEM
Keadaanumum:Baik
Tingkatkesadaran:Composmentis
Tandatandavital:TD:130/70mmHgN:68x/m
RR:20x/mT:36,3oC
TB:152cmBB:48Kg

L.PENGKAJIANPERSISTEM
PERNAFASAN(B1:BREATHING)
1.BentukDada:Simetris
2.SekresidanBatuk:TidakAda
3.PolaNafas
a.Frekuensinafas:20x/mdanteratur
4.BunyiNafas
b.Normal:Vesikulerdisemualapangparu
c.Abnormal:
d.Resonenlokal:
5.Pergerakandada:
6.TractilFremitus/FremitusLokal:
7.AlatBantuPernafasan:

CARDIOVASCULAR(B2:BLEEDING)
1.Nadi
Frekuensi:68x/mdanreguler
2.Bunyijantung:Normal
:IctuscordisterabapadaICS5kirakirasatujarimedialdarigarismidclavicula
4.Pembesaranjantung:Tidak
5.Nyeridada:Tidak
6.Edema:Tidak
7.Clubbingfinger:Tidak
PERSARAFAN(B3:BRAIN)
TingkatKesadaran:Composmentis
1.GCS
TotalGCS:14
2.Refleks:Normal
3.Koordinasigerak:Ya
4.Kejang:Tidak
5.Lainlain:
PENGINDERAAN(PERSEPSISENSORI)
1.Mata(Penglihatan)
a.Bentuk:Normal
b.Visus:
c.Pupil:Isokor
d.Gerakbolamata:Normal
e.Medanpenglihatan:Menyempit
f.Butawarna:Tidak
g.TekananIntraOkuler:Tidak
2.Hidung(Penciuman)
a.Bentuk:Normal
b.GangguanPenciuman:Tidak
3.Telinga(Pendengaran)

a.Aurikel:Normal
b.Membrantympani:Keruh
c.Otorrhae:Tidak
d.GangguanPendengaran:Ya
e.Tinitus:Ya
4.Perasa:Normal
5.Peraba:Normal
PERKEMIHANELIMINASIURI(B4:BLADDER)
Masalahkandungkemih:Sering
Produksiurine:250ml/hari
Frekuensi:26x/hari
Warna:KuningJernih
Bau:Amoniak
PENCERNAANELIMINASIALVI(B5:BOWEL)
1.MulutdanTenggorokan
a.Mulut:Selaputlendirmulutlembab
b.Lidah:Hiperemik
c.KebersihanRonggaMulut:Tidakberbau
d.Tenggorokan:SakitMenelan
e.Abdomen:Kenyal
f.PembesaranHepar:Tidak
g.PembesaranLien:Tidak
h.Asites:Tidak
2.MasalahUsusBesardanRectum/Anus
BAB:2X/hari,Tidakadamasalah
Obatpencahar:Tidak
Lavemen:Tidak
OTOT,TULANG,DANINTEGUMEN(B6:BONE)
1.OtotdanTulang
Kemampuanpergerakansendilengandantungkai(ROM):Bebas
Kemampuankekuatanotot:
Tidakadafraktur
Tidakadadislokasi
Tidakadahaematom
2.Integumen
Warnakulit:Hiperpigmentasi
Akral:Hangat
Turgor:TidakElastik
Tulangbelakang:Kiposis

M.REPRODUKSI
Perempuan:
Payudara:Bentuksimetris,Tidakadabenjolan

Kelamin:Bentuknormal,tidakadakeputihan,klienmenopause
N.ENDOKRIN
Klientidakmemilikikelainanendokrin
O.PENGETAHUAN
Pengetahuankliententangkesehatandirinya:klienmenyadaridirinyasudahlansiadanakan
rentan terhadap sakit. Klien memang selalu berobat tiap kali dia sakit. Tapi klien tidak
mengertimanfaatobatobatanyangdidapatnyasecaraspesifik.

ANALISADATA
NO

KELUHAN

ETIOLOGI

PROBLEM

Penumpukan
Kristal asam urat

Nyeri akut

DS: Aduh, kaki saya ini ngilu. Rasanya cenatcenut kalau jalan
DO:
- klien tampak memijat kedua kakinya
- klien tampak hati-hati saat merubah posisi dari
duduk jadi berdiri
- klien kifosis
1. P : penumpukan Kristal asam urat
Q : ngilu, cenat-cenut
R ; di daerah lutut paling terasa sakit, selain itu
juga terasa sakit di punggung sampai daerah
pinggang
S : 6 (dari 0-10)
T : di daerah lutut paling terasa sakit, selain itu
juga terasa sakit di punggung sampai daerah
pinggang
2
DS: Aduh, kaki saya ini ngilu. Rasanya cenatcenut kalau jalan
DS: mata saya kadang terasa kabur kadang
tidak
-

DO:
Fokus penglihatan mulai berkurang
Lapang pandang menyempit
Aktivitas terbatas karena sakit pada
ekstrimitas dan punggung, gerak agak pelan
dan hati-hati
Lingkungan kurang aman. WC agak licin. Di
halaman belakang terdapat beberapa pecahan
kaca, duri salak (di halaman belakang rumah

Penurunan sensori,
lingkungan kurang
kondusif,
fleksibelitas
ekstremitas
menurun

Resiko injuri

klien tumbuh 2 pohon salak), dan tanah agak


licin karena ditumbuhi lumut
RENCANAKEPERAWATAN
Dx.
Kep.

No.
1.

Tujuan

1.
2.
3.
4.
5.

Intervensi

Setelah dilakukan
1.
tindakan keperawatan
selama 2x24 jam
diharapkan nyeri hilang
atau terkontrol dengan
kriteria hasil:
2.
Klien tidak
mengungkapkan
perasaan nyeri
Gerak tidak terbatas
Aktivitas bisa sedikit
meningkat
3.
Skala nyeri 0 (dari 010)
Menunjukkan
ekspresi rileks
4.

5.

2.

Setelah
dilakukan
1.
tindakan
perawatan
selama
2x24
jam
diharapkan cidera tidak
terjadi dengan kriteria
2.
hasil:
1. Mengidentifikasi
bahaya apa saja yang

Rasional

Kaji karakteristik nyeri 1.

Nyeri merupakan respon


subjektif yang dapat dikaji
dengan menggunakan skala
nyeri.

Bantu klien dalam


2.
Nyeri mungkin
mengidentifikasi faktor
dipengaruhi oleh kecemasan
pencetus
atau peradangan pada sendi
3.
Ajarkan relaksasi: teknik
terkait ketegangan otot
rangka yang dapat
mengurangi intensitas
nyeri
4.
Tingkatkan pengetahuan
tentang penyebab nyeri
dan hubungan dengan
berapa lama nyeri akan
berlangsung
5.

Anjurkan klien untuk


tidak meminum minuman
seperti alkohol, kafein atau
mengonsumsi obat-obatan
diuretik, tapi perbanyak
minum air putih

Akan melancarkan
peredaran darah sehingga
kebutuhan oksigen pada
jaringan terpenuhi dan
mengurangi nyeri
Pengetahuan tersebut
membantu mengurangi
nyeri dan dapat membantu
meningkatkan kepatuhan
klien terhadap rencana
terapeutik
Pemakaian alkohol,
kafein, dan oba-obatan
diuretik akan menambah
peningkatan kadar asam urat
dalam serum.

Kaji adanya faktor1.


Mengidentifikasi adanya
faktor resiko injuri pada faktor-faktor resiko yang
klien.
mungkin akan timbul
Lakukan
modifikasi2.
Mengurangi risiko injuri
lingkungan agar lebih akibat lingkungan yang
aman
sesuai
hasil tidak aman
pengkajian terhadap resiko

dapat
meningkatkan
kemungkinan
cidera
terutama
bahaya3.
lingkungan
2. Mengidentifikasi
tindakan preventif atas
bahaya tertentu
3. Melaporkan
4.
penggunaan cara yang
tepat dalam melindungi
diri dari cidera.

Dx.
Kep.

No.
1. 1
.

1.

3.

4.

5.

Monitor klien secara


3.
Mencegah
kecelakaan
berkala terutama 2 hari akibat faktor-faktor resiko
pertama kunjungan rumah yang mungkin terjadi dan
dialami oleh klien
Ajarkan
klien
dan
4.
Mencegah
komplikasi
keluarga tentang upaya akibat
injuri
dan
pencegahan cidera
mempertahankan keamanan

Implementasi

2.

2. 2

injuri

1.

Mengkaji karakteristik nyeri (22/3/2012)


Hasil: nyeri dirasakan dominan dilutut, selain
itu nyeri juga dirasakan pada punggung
sampai kedaerah pinggang dengan skala nyeri6 (dari 0-10)
Membantu klien dalam mengidentifikasi
factor pencetus (22/3/2012)
Hasil: nyeri karena terjadinya penumpukankristal asam urat pada sendi
Mengajarkan relaksasi: anjurkan klienuntuk menggunakan air hangat untuk mandi(22/3/2012)
Hasil: klien memahami anjuran yang
diberikan dan akan mulai melakukan apa
yang dianjurkan
Meningkatkan
pengetahuan
tentang
penyebab nyeri dan hubungan dengan berapa lama nyeri akan berlangsung (22/3/2012)
Hasil: klien masih belum sepenuhnya
memahami HE yang diberikan. Klien hanya tahu kalau dirinya mengalami asam urat
begitu saja.
Menganjurkan klien untuk tidak meminum minuman seperti alkohol, kafein atau
mengonsumsi obat-obatan diuretik, tapi
perbanyak minum air putih (22/3/12)
Hasil: Karena klien suka kopi, klien
mengatakan kalau klien akan mencoba
mengurangi minum kopi secara bertahap
setelah mendengar anjuran yang diberikan
dan akan minum air putih lebih sering
dibandingkan dengan kopi.
Mengkaji adanya faktor-faktor resiko injuri

Evaluasi
S: kaki saya masih terasa ngilu
O:
klien
menunjukkan
bagian
kakinya yang sakit, tepatnya
dilutut.
Klien kifosis
Tampak hati-hati dan pelan saat
berjalan
Ekspresi wajah sedikit meringis
Saat merubah posisi dari duduk
jadi berdiri, tampak hati-hati
A: Masalah belum teratasi
P: Lanjutkan Intervensi
Kaji karakteristik nyeri
Bantu
klien
dalam
mengidentifikasi faktor pencetus
Ajarkan relaksasi: teknik terkait
ketegangan otot rangka yang
dapat mengurangi intensitas nyeri
Tingkatkan pengetahuan tentang
penyebab nyeri dan hubungan
dengan berapa lama nyeri akan
berlangsung
Anjurkan klien untuk tidak
meminum minuman seperti
alcohol, kafein atau obat-obatan
diuretik, tapi perbanyak minum air
putih
S: -

.
2.
a.

b.
c.
3.
4.

5.

pada klien (22/3/2012)


Hasil: faktor resiko yang ditemukan yaitu:
adanya nyeri pada ekstremitas yang akanmengurangi fleksibelitas dalam bergerak,
klien rentan terjatuh
Penurunan sensori penglihatan
Lingkungan yang kurang kondusif/ tidak
adekuat
Melakukan modifikasi lingkungan agar lebihaman sesuai hasil pengkajian (22/3/2012)
Hasil: bersama keluarga klien membersihkanlingkungan rumah klien, termasuk halaman
belakang yang beresiko tinggi menyebabkan
injuri atau trauma dengan membuang
pecahan-pecahan kaca, duri ataupun lumut
yang bisa menyebabkan klien jatuh

Memonitor klien secara berkala terutama 2


hari pertama kunjungan rumah (22/3/2012)
6. Hasil: masih terdapat faktor resiko injuri di
sekitar klien
7. Mengajarkan klien dan keluarga tentang
upaya pencegahan cidera (22/3/2012)
Hasil: klien dan keluarga memahami apa
yang diajarkan seperti mengatur pencahayaan
di rumah (karena klien mengalami penurunan
sensori), menjaga lingkungan agar tetap
bersih dan tidak menimbulkan resiko cidera
dan komplikasi cidera bagi klien

O:
Fokus
penglihatan
mulai
berkurang
Lapang pandang menyempit
Aktivitas terbatas karena sakit
pada ekstrimitas dan punggung,
gerak agak pelan dan hati-hati
Lingkungan sudah dibersihkan
dari faktor-faktor resiko
WC
masih
berpotensi
menimbulkan injuri bagi klien
karena lantainya yang agak licin
A: Masalah teratasi sebagian
P: Lanjutkan Intervensi
Kaji adanya faktor-faktor resiko
injuri pada klien
Lakukan modifikasi lingkungan
agar lebih aman sesuai hasil
pengkajian terhadap resiko injuri
Monitor klien secara berkala
terutama
2
hari
pertama
kunjungan rumah
Ajarkan klien dan keluarga
tentang upaya pencegahan cidera

BABIII
PENUTUP
A.KESIMPULAN
KebutuhanKeselamatandanKeamananjugamerupakankebutuhandasarbagilansia.Disini
perawat dalam pemenuhan kebutuhan keamanan dapat berperan secara langsung maupun
tidaklangsungyaitusebagaiPemberiPerawatanLangsung(caregiver),Pendidik,Pengawas
Kesehatan,Konsultan,danKolaborasi.Keselamatanadalahsuatukeadaanseseorangatau
lebih yang terhindar dari ancaman bahaya atau kecelakaan, sedangkan keamanan adalah
keadaanamandantentram.
B.SARAN
Perawat sebagai tenaga kesehatan yang profesional mempunyai kesempatan paling besar
untuk memberikan pelayanan/asuhan keperawatan yang komprehensif dengan membantu

klienmemenuhikebutuhandasaryangholistik,salahsatunyadalampemenuhankebutuhan
keselamatandankeamanan.

DAFTARPUSTAKA
Tarwoto,Wartonah.2010.KebutuhanDasarManusia.Jakarta:SalembaMedika
http://www.stikeskabmalang.wordpress.com/2009/09/19/pengkajian-danpencegahan-jatuh-pada-lansia/
http://www.cita09060144.student.umm.ac.id/2010/02/05/peran-perawat-dalampemenuhan-kebutuhan-keamanan-dan-keselamatan/

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

8
MAR

31

ASUHAN KEPERAWATAN PADA LANSIA DENGAN GANGGUAN


PEMENUHAN KEBUTUHAN NUTRISI (kelompok 1)

KEPERAWATAN GERONTIK
ASUHAN KEPERAWATAN PADA LANSIA DENGAN
GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI

DI SUSUN OLEH :
BAMBANG SURYADINOR
NITA RAHMADANI
NOVA ZAHROTUL HAYYA
SUMIRLAN TRISNO
AKADEMI KEPERAWATAN
PEMERINTAH KABUPATEN KOTAWARINGIN TIMUR
Jl. Batu Berlian No.11 Sampit

2012
KATA PENGANTAR
Puji syukur kepada Tuhan Yang Maha Esa karena berkat taufik dan
hidayah-Nya, makalah ini dapat diselesaikan. Makalah ini merupakan makalah
pengetahuan bagi mahasiswa/i akper pemkab kotim maupun para pembaca
untuk bidang Ilmu Pengetahuan.
Makalah ini sendiri dibuat guna memenuhi salah satu tugas
kuliah dari dosen mata kuliah Keperawtan Gerontik dengan judul ASUHAN
KEPERAWATAN PADA LANSIA DENGAN GANGGUAN PEMENUHAN
KEBUTUHAN NUTRISI.
Dalam penulisan makalah ini, penulis berusaha menyajikan bahasa yang
sederhana dan mudah dimengerti oleh para pembaca.
Penulis menyadari bahwa makalah ini jauh dari sempurna dan masih
banyak kekurangan. Oleh karenanya, penulis menerima kritik dan saran yang
positif dan membangun dari rekan-rekan pembaca untuk penyempurnaan
makalah ini. Penulis juga mengucapkan banyak terima kasih kepada rekan-rekan
yang telah membantu dalam penyelesaian makalah ini.
Akhir kata, semoga makalah ini dapat memberikan manfaat kepada
kita semua. Amin.

Sampit,

Maret 2012

Penulis

DAFTAR ISI
KATA
PENGANTAR .....................................................................................................
DAFTAR
ISI ....................................................................................................................
BAB I
PENDAHULUAN
1.1. LATAR
BELAKANG ............................................................................
1

ii
iii

1.2 TUJUAN
PENULISAN ........................................................................
2
1.3
RUMUSAN MASALAH.......................................................................
2
1.4
METODE
PENULISAN.........................................................................
2
1.5
SISTEMATIKA
PENULISAN................................................................
2
BAB II
PEMBAHASAN
2.1. PENGERTIAN........................................................................................
3
2.2 PROSES MENUA...................................................................................
4
2.3 KEBUTUHAN NUTRISI PADA LANSIA...........................................
7
2.4. FAKTOR YANG MEMPENGARUHI KEBUTUHAN GIZI PADA LANSIA
8
2.5. GANGGUAN NUTRISI PADA LANSIA............................................
9
2.6. STATUS GIZI PADA LANSIA............................................................. 11
2.7. ASKEP.................................................................................................... 12
BAB III
PENUTUP
A. KESIMPULAN ....................................................................................... 13
B. SARAN ................................................................................................... 13
DAFTAR PUSTAKA
LAPORAN KASUS

BAB I
PENDAHULUAN
1.1.

Latar Belakang
Manusia Lanjut Usia (MANULA) dimasukkan ke dalam kelompok rentan gizi,
meskipun tidak ada hubungannya dengan pertumbuhan badan , bahkan sebaliknya
sudah terjadi involusi dan degenerasi jaringan dan sel-selnya. Timbulnya kerentanan
terhadap kondisi gizi disebabkan kondisi fisik, baik anatomis maupun fungsionalnya.
Gigi-geligi pada MANULA mungkin sudah banyak yang rusak bahkan copot,
sehingga memberikan kesulitan dalam mengunyah makanan. Maka makanan harus
diolah sehingga makanan tidak perlu digigit atau dikunyah keras-keras. Makanan
yang dipotong kecil-kecil, lunak dan mudah ditelan akan sangat membantu para
MANULA dalam mengkonsumsi makanannya.
Fungsi alat pencernaan dan kelenjar-kelenjarnya juga sudah menurun, sehingga
makanan harus yang mudah dicerna dan tidak memberatkan fungsi kelenjar
pencernaan.makanan yang tidak banyak mengandung lemak, pada umumnya lebih
mudah dicerna, tetapi harus cukup mengandung protein dan karbohidrat. Kadar

serat yang tidak dicerna jangan terlalu banyak, tetapi harus cukup tersedia untuk
melancarkan peristalsis dan dengan demikian melancarkan pula defaecatie, dan
menghindarkan obstipasi.
Patut diingat bahwa keperluan enersi MANULA sudah menurun, jadi jangan di
sediakan seperti masih belum berusia lanjut. Ada baiknya bila mereka dijaga jangan
sampai menjadi kegemukan karena akan lebih mudah menderita berbagai kelainan
atau penyakit gizi yang berhubungan dengan kondisi obesitas. Frekuensi penyakit
Diabetes Mellitus, Cardiovascular diseases terdapat meningkat pada kelompok
MANULA. Yang umum sangat ditakuti ialah kemungkinan meningkat untuk mendapat
penyakit kanker.

1.2.

Tujuan
Setelah membaca makalah ini di harapkan mahasiswa mampu melakukan
Asuhan Keperawatan Dengan Gangguan Nutrisi Pada Lansia

1.3.

Rumusan Masalah

1.
2.

Apa pengertian nutrisi


Apa saja kebutuhan nutrisi pada lansia

3.
4.

Faktor apa saja yang mempengaruhi kebutuhan nutrisi pada lansia


Apa saja gangguan nutrisi pada lansia

5.

Factor apa saja yang mempengaruhi status gizi pada lansia

1.4.

Metode Penelitian
Metode

yang

di

gunakan

dalam

penulisan

makalah

ini

adalah

metode

kepustakaan.

1.5.

Sistematika Penulisan
Sistematika penulisan makalah ini yaitu Halaman Judul, Kata Pengantar, Daftar
Isi, Bab I Pendahuluan yang terdiri dari Latar Belakang, Rumusan Masalah, Tujuan
Penulisan, Metode Penulisan, dan Sistematika Penulisan, Bab II Pembahasan, Bab III
Penutup yang terdiri dari Kesimpulan dan Saran, Daftar Pustaka.

BAB II
PEMBAHASAN
2.1

Pengertian

Nutrisi adalah zat-zat gizi atau zat-zat lain yang berhubungan dengan kesehatan
dan penyakit, termasuk keseluruhan proses dalam tubuh manusia untuk menerima
makanan atau bahan-bahan dari lingkungan hidupnya dan menggunakan bahanbahan tersebut untuk aktivitas penting dalam tubuh serta mengeluarkan sisanya.
Nutrisi juga dapat dikatakan sebagai ilmu tentang makanan, zat-zat gizi dan zat-zat
lain yang terkandung, aksi, reaksi, dan keseimbangan yang berhubungan dengan
kesehatan dan penyakit.

Nutrisi yang adekuat merupakan suatu komponen esensial pada kesehatan


lansia. Faktor-faktor fisiologis yang dapat dikaitkan dengan kebutuhan nutrisi yang
unik pada lansia adalah menurunnya sensitivitas olfaktorius, perubahan persepsi
rasa dan peningkatan kolesistokinin yang dapat memengaruhi keinginan untuk
makan dan peningkatan rasa kenyang. Proses penuaan itu sendiri sebenarnya tidak
mengganggu proses penyerapan vitamin pada berbagai tingkatan yang luas.
Namun, laporan-laporan terakhir mengindikasikan bahwa lansia mengalami
defisiensi vitamin B12, vitamin D dan asam folat. Perubahan-perubahan dan
kebutuhan mineral meliputi rendahnya kebutuhan akan zat besi pada wanita lansia
daripada wanita usia produktif. Asupan kalsium sebagai salah satu mineral esensial
lainnya bagi lansia sekitar 600 mg per hari untuk wanita. Hal ini hanya
menggambarkan 30 sampai 40% dari tingkat kebutuhan yang disarankan. Suplemen
kalsium tidak akan diabsorpsi secara merata. Karena perbedaan derajat keasaman
yang dibutuhkan untuk absorpsi yang sesuai, kalsium sitrat malat merupakan bentuk
yang lebih dipilih untuk diberikan bagi lansia yang mengalami hipoklohidria atau
aklorhidria. Pada proses penuaan yang normal, peningkatan jaringan adipose secara
normal dapat menyertai penurunan massa tubuh dan cairan tubuh total.
2.2

Proses Menua
Proses menua dapat terlihat secara fisik dengan perubahan yang terjadi pada
tubuh dan berbagai organ serta penurunan fungsi tubuh serta organ tersebut.
Perubahan secara biologis ini dapat mempengaruhi status gizi pada masa

tua. Antara lain :


Massa otot yang berkurang dan massa lemak yang bertambah, mengakibatkan juga
jumlah cairan tubuh yang berkurang, sehingga kulit kelihatan mengerut dan kering,
wajah keriput serta muncul garis-garis menetap. Oleh karena itu, pada lansia
seringkali terlihat kurus.
Penurunan indera penglihatan akibat katarak pada lansia sehingga dihubungkan
dengan kekurangan vitamin A, vitamin C dan asam folat. Sedangkan gangguan pada
indera pengecap dihubungkan dengan kekurangan kadar Zn yang juga
menyebabkan menurunnya nafsu makan. Penurunan indera pendengaran terjadi
karena adanya kemunduran fungsi sel syaraf pendengaran.
Dengan banyaknya gigi yang sudah tanggal, mengakibatkan gangguan fungsi
mengunyah yang dapat berdampak pada kurangnya asupan gizi pada usia lanjut.
Penurunan mobilitas usus, menyebabkan gangguan pada saluran pencernaan seperti
perut kembung, nyeri yang menurunkan nafsu makan, serta susah BAB yang dapat
menyebabkan wasir.
Kemampuan motorik menurun, selain menyebabkan menjadi lamban, kurang aktif
dan kesulitan menyuap makanan, juga dapat mengganggu aktivitas kegiatan seharihari.
Pada usia lanjut terjadi penurunan fungsi sel otak, yang menyebabkan penurunan
daya ingat jangka pendek, melambatnya proses informasi, kesulitan berbahasa,
kesulitan mengenal benda-benda, kegagalan melakukan aktivitas yang mempunyai
tujuan (apraksia) dan gangguan dalam menyususn rencana, mengatur sesuatu,

mengurutkan, daya abstraksi, yang dapat mengakibatkan kesulitan dalam


emlakukan aktivitas sehari-hari yang disebut dimensia atau pikun. Gejala pertama
adalah pelupa, perubahan kepribadian, penurunan kemampuan untuk pekerjaan
sehari-hari dan perilaku yang berulang-ulang, dapat juga disertai delusi paranoid
atau perilaku anti sosial lainnya.
Akibat proses menua, kapasitas ginjal untuk mengeluarkan air dalam jumlah besar
juga bekurang. Akibatnya dapat terjadi pengenceran natrium sampai dapat terjadi
hiponatremia yang menimbulkan rasa lelah.
Incontinentia urine (IU) adalah pengeluaran urin diluar kesadaran merupakan salah
satu masalah kesehatan yang besar yang sering diabaikan pada kelompok usia
lanjut, sehingga usia lanjut yang mengalami IU seringkali mengurangi minum yang
dapat menyebabkan dehidrasi.
Secara psikologis pada usia lanjut juga terjadi ketidakmampuan untuk mengadakan
penyesuaian terhadap situasi yang dihadapinya, antara lain sindrom lepas jabatan
yang mengakibatkan sedih yang berkepanjangan.

Penyakit Sistem Pencernaan


Sistem pencernaan atau sistem gastroinstestinal (mulai dari mulut sampai anus)
adalah sistem organ dalam manusia yang berfungsi untuk menerima makanan,
mencernanya menjadi zat- zat gizi dan energi, menyerap zat-zat gizi ke dalam aliran
darah serta membuang bagian makanan yang tidak dapat dicerna atau merupakan
sisa proses tersebut dari tubuh. Saluran pencernaan terdiri dari mulut, tenggorokan
(faring), kerongkongan, lambung, usus halus, usus besar, rektum dan anus. Sistem
pencernaan juga meliputi organ-organ yang terletak diluar saluran pencernaan, yaitu
pankreas, hati dan kandung empedu.
Penuaan dicirikan dengan kehilangan banyak sel tubuh dan penurunan
metabolism di sel lainnya.Proses ini menyebabkan penurunan fungsi tubuh dan
perubahan komposisi tubuh. Perubahan pada system pencernaan :
Kehilangan gigi,penyebab utama adanya periodontal desease yang biasa terjadi
setelah umur 30 tahun.Penyebab lain meliputi kesehatan gigi yang buruk dan gizi
yang buruk.
Indera pengecap menurun.Adanya iritasi yang kronis dari selaput lendir.atropi
indera pengecap (80%),hilangnya sensitivitas dari syaraf pengecap di lidah
teritama rasa manis,asin,asam,pahit.Selain itu sekresi air ludah berkurang sampai
kira-kira 75% sehingga mengakibatkan rongga mulut menjadi kering dan bisa
menurunkan cita rasa.
Usofagus melebar.Penuaan usofagus berupa pengerasansfringfar bagian bawah
sehingga menjadi mengendur(relaksasi) dan mengakibatkan usofagus melebar
(presbyusofagus).Keadaan ini memperlambat pengosongan usofagus dan tidak
jarang berlanjut sebagaiher nianhiatal.Gangguan menelan biasanya berpangkal pada
daerah presofagus tepatnta di daerah osofaring penyebabnya tersembunyi dalam
system saraf sentral atau akibat gangguan neuromuskuler seperti jumlah ganglion
yang menyusut sementara lapisan otot menebal dengan manometer akan tampak
tanda perlambatan pengosongan usofagus.

Lambung,rasa lapar menurun (sensitivitas lapar menurun).Lapisan lambung


menipis diatas 60 tahun,sekresi HCL dan pepsin berkurang,asam lambung
menurun,waktu pengosongan lambung menurun dampaknya vitamin B12 dan zat
besi menurun.
Peristaltic lemah dan biaanya timbul konstipasi
Fungsi absopsi melemah (daya absorpsi terganggu).Berat total usus halus
berkurang diatas usia 40 tahun meskipun penyerapan zat gizi pada umumnya masih
dalam batas normal,kecuali kalsium (diatas 60 tahun)dan zat besi.
Liver (hati).Penurunan enzim hati yang terlibat dalam oksidasi dan reduksi,yang
menyebabkan metabolisme obat dan detoksifikasi zat kurang efisien.
Produksi saliva menurun sehingga mempengaruhi proses perubahan kompleks
krbohidrat menjadi disakarida. Fungsi ludah sebagai pelican makanan berkurang
sehingga proses menelan menjadi sukar.
Keluahn-keluhan seperti kembung, perasaan tidak enak di perut dan sebagainya,
seringkali disebabkan makanan yang kurang dicernaakibat berkurangnya fungsi
kelenjar pencernaan. Juga dapat disebabkan karena berkurangnya toleransi terhadap
makanan terutama yang mengandung lemak.
Keluhan lain yang sering dijumpai adalah konstipasi, yang disebabkan karena
kurangnya kadar selulosa, kurangnya nafsu makan bisa disebabkan karenanya
banyaknya gigi yang sudah lepas. Dengan proses menua bisa terjadi gangguan
motilits otot polos esophagus, bisa juga terjadi refluks disease (terjadi akibat refluks
isi lambung ke esophagus), insiden ini mencapai puncak pada usia 60 70 tahun.

2.3
Kebutuhan Nutrisi Pada Lansia
o Kalori
Hasil-hasil penelitian menunjukan bahwa kecepatan metabolisme basal pada orangorang berusia lanjut menurun sekitar 15-20%, disebabkan berkurangnya massa otot
dan aktivitas. Kalori (energi) diperoleh dari lemak 9,4 kal, karbohidrat 4 kal, dan
protein 4 kal per gramnya. Bagi lansia komposisi energi sebaiknya 20-25% berasal
dari protein, 20% dari lemak, dan sisanya dari karbohidrat. Kebutuhan kalori untuk
lansia laki-laki sebanyak 1960 kal, sedangkan untuk lansia wanita 1700 kal. Bila
jumlah kalori yang dikonsumsi berlebihan, maka sebagian energi akan disimpan
berupa lemak, sehingga akan timbul obesitas. Sebaliknya, bila terlalu sedikit, maka
cadangan energi tubuh akan digunakan, sehingga tubuh akan menjadi kurus.
o Protein
Untuk lebih aman, secara umum kebutuhan protein bagi orang dewasa per hari
adalah 1 gram per kg berat badan. Pada lansia, masa ototnya berkurang. Tetapi
ternyata kebutuhan tubuhnya akan protein tidak berkurang, bahkan harus lebih
tinggi dari orang dewasa, karena pada lansia efisiensi penggunaan senyawa nitrogen
(protein) oleh tubuh telah berkurang (disebabkan pencernaan dan penyerapannya
kurang efisien). Beberapa penelitian merekomendasikan, untuk lansia sebaiknya

konsumsi proteinnya ditingkatkan sebesar 12-14% dari porsi untuk orang dewasa.
Sumber protein yang baik diantaranya adalah pangan hewani dan kacang-kacangan.
o Lemak
Konsumsi lemak yang dianjurkan adalah 30% atau kurang dari total kalori yang
dibutuhkan. Konsumsi lemak total yang terlalu tinggi (lebih dari 40% dari konsumsi
energi) dapat menimbulkan penyakit atherosclerosis (penyumbatan pembuluh darah
ke jantung). Juga dianjurkan 20% dari konsumsi lemak tersebut adalah asam lemak
tidak jenuh (PUFA = poly unsaturated faty acid). Minyak nabati merupakan sumber
asam lemak tidak jenuh yang baik, sedangkan lemak hewan banyak mengandung
asam lemak jenuh.

o Karbohidrat dan serat makanan


Salah satu masalah yang banyak diderita para lansia adalah sembelit atau konstipasi
(susah BAB) dan terbentuknya benjolan-benjolan pada usus. Serat makanan telah
terbukti dapat menyembuhkan kesulitan tersebut. Sumber serat yang baik bagi
lansia adalah sayuran, buah-buahan segar dan biji-bijian utuh. Manula tidak
dianjurkan mengkonsumsi suplemen serat (yang dijual secara komersial), karena
dikuatirkan konsumsi seratnya terlalu banyak, yang dapat menyebabkan mineral dan
zat gizi lain terserap oleh serat sehingga tidak dapat diserap tubuh. Lansia
dianjurkan untuk mengurangi konsumsi gula-gula sederhana dan menggantinya
dengan karbohidrat kompleks, yang berasal dari kacang-kacangan dan biji-bijian
yang berfungsi sebagai sumber energi dan sumber serat.
o Vitamin dan mineral
Hasil penelitian menyimpulkan bahwa umumnya lansia kurang mengkonsumsi
vitamin A, B1, B2, B6, niasin, asam folat, vitamin C, D, dan E umumnya kekurangan
ini terutama disebabkan dibatasinya konsumsi makanan, khususnya buah-buahan
dan sayuran, kekurangan mineral yang paling banyak diderita lansia adalah kurang
mineral kalsium yang menyebabkan kerapuhan tulang dan kekurangan zat besi
menyebabkan anemia. Kebutuhan vitamin dan mineral bagi lansia menjadi penting
untuk membantu metabolisme zat-zat gizi yang lain. Sayuran dan buah hendaknya
dikonsumsi secara teratur sebagai sumber vitamin, mineral dan serat.
o Air
Cairan dalam bentuk air dalam minuman dan makanan sangat diperlukan tubuh
untuk mengganti yang hilang (dalam bentuk keringat dan urine), membantu
pencernaan makanan dan membersihkan ginjal (membantu fungsi kerja ginjal). Pada
lansia dianjurkan minum lebih dari 6-8 gelas per hari.
2.4
a.

Faktor-Faktor Yang Mempengaruhi Kebutuhan Gizi Pada Lansia


Tinggal sendiri: seseorang yang tinggal sendiri sering tidak memperdulikan tugas

memasak untuk menyediakan makanan


b.
Kelemahan fisik: akibat kelemahan fisik sehinga menyebabkan kesulitan untuk
berbelanja atau memasak, mereka tidak mampu merencanakan dan menyediakan
makanannya sendiri.

c.

.Kehilangan: terutama terlihat pada pria lansia yang tidak pernah memasak untuk
mereka sendiri, mereka biasanya tidak memahami nilai suatu makananyang gizinya

seimbang..
d. Depresi: menyebabkan kehilangan nafsu makan, mereka tidak mau bersusah payah
berbelanja, memasak atau memakan makanannya.
e. Pendapatan yang rendah: ketidak mampuan untuk membeli makanan yang cermat
f.

untuk meningkatkan pengonsumsian makanan yang bergizi.


Penyakit saluran cerna: termasuk sakit gigi dan ulkus.Berkurangnya kemampuan
mencerna makanan akibat kerusakan gigi atau ompong, Esophagus/kerongkongan
mengalami pelebaran Rasa lapar menurun, asam lambung menurun,Berkurangnya
indera pengecapan mengakibatkan penurunan terhadap cita rasa manis, asin, asam,
dan pahit., Gerakan usus atau gerak peristaltic lemah dan biasanya menimbulkan

konstipasi,Penyerapan makanan di usus menurun


g. penyalahgunaan alcohol: penyalah gunaan alcohol mengurangi asupan kalori atau
nonkalori seperti asupan energy dengan sedikit factor nutrisi lain.
h. Obat-obatan : lansia yang mendapatkan banyak obat dibandingkan kelompok usia
lain yang lebih muda ini berakibat buruk terhadap nutrisi lansia. Pengobatan akan
mengakibatkan kemunduran nutrisi yang semakin jauh.

2.5
1.

Gangguan Nutrisi Pada Lansia

Malnutrisi
Malnutrisi adalah suatu keadaan gizi buruk yang terjadi karena tidak cukupnya
asupan satu atau lebih nutrisi yang membahyakan status kesehatan (Watson, Roger.
2003. Perawatan Pada Lansia.Jakarta:EGC).

2.

Obesitas
Keadaan badan yang amat gemuk dan berat akibat timbunan lemak yang
berlebihan, dimana kelebihan lemak tubuh melebihi dari 20% dari jumlah yang di
anjurkan untuk tinggi dan usia seseorang. Pola konsumsi yang berlebihan terutama
yang mengandung lemak, protein dan karbohidrat yang tidak sesuai dengan
kebutuhan tubuh. Pencetus berbagai seperti Hipertensi, Penyakit jantung koroner,

Strok, seta Diabetes Melitus.


3. Osteoporosis
Kondisi dimana sering disebut tulang kropos yang disebabkan oleh penurunan
densitas tulang akibat kurangnya konsumsi kalsium dalam jangka waktu yang lama.
Mencapai maksimum pada usia 35 tahun pada wanita dan 45 tahun pada pria.
4. Anemia
Kondisi dimana sel-sel darah mengandung tingkat haemoglobil yang tidak normal,
kimia yang bertugas membawa oksigen di seluruh tubuh yang disebabkan kurang Fe,
asam folat, B12 dan protein. Akibatnya akan cepat lelah, lesu, otot lemah, letih,
pucat, kesemutan, sering pusing, mata berkunang-kunang, mengantuk, HB <8 gr/dL.
5.

Kekurangan vitamin
Bila konsumsi buah dan sayuran dalam makanan kurang dan di tambah dengan
kekurangan protein dalam makanan akibatnya nafsu makn berkurang, penglihatan
menurun, kulit kering, penampilan menjadi lesu dan tidak bersemangat.

6.

Kekurangan anti oksidan


(Banyak dijumpai dalam buah-buahan dan sayuran) mampu menangkal efek
merusak radikal bebas terhadap tubuh, sehingga konsumsi yang kurang dapat
meningkatkan resiko berbagai penyakit akibat radikal bebas, seperti serangan
jantung dan stroke, katarak, persendian hingga menurunnya penampilan fisik seperti
kulit menjadi keriput.

7.

Sulit buang air besar Karena pergerakan usus besar semakin lambat, makanan
lambat diolah dalam tubuh.Akibatnya, buang air besar jadi jarang.

8.

Kelebihan gula dan garam


Garam (natrium) dapat meningkatkan tekanan darah, terutama
pada orangtua

Makanan

tinggi

gula

membuat

tubuh

mudah

gemuk,

meningkatkan kolesterol dan gula darah


Karena itu, sebaiknya kurangi konsumsi gula dan garam

2.6

Status Gizi Pada Usia Lanjut

Metabolisme basal menurun, kebutuhan kalori menurun, status gizi lansia cenderung
mengalami kegemukan/obesitas
Aktivitas/kegiatan fisik berkurang, kalori yang dipakai sedikit, akibatnya cenderung
kegemukan/obesitas
Ekonomi meningkat, konsumsi makanan menjadi berlebihan, akibatnya cenderung
kegemukan/obesitas
Fungsi pengecap/penciuman menurun/hilang, makan menjadi tidak enak dan nafsu
makan menurun, akibatnya lansia menjadikurang gizi (kurang energi protein yang
kronis
Penyakit periodontal (gigi tanggal), akibatnya kesulitan makan yang berserat (sayur,
daging) dan cenderung makan makanan yang lunak (tinggi klaori), hal ini
menyebabkan lansia cenderung kegemukan/obesitas
Penurunan sekresi asam lambung dan enzim pencerna makanan, hal ini mengganggu
penyerapan vitamin dan mineral, akibatnya lansia menjadi defisiensi zat-zat gizi
mikro
Mobilitas usus menurun, mengakibatkan susah buang air besar, sehingga lansia
menderita wasir yang bisa menimbulkan perdarahan dan memicu terjadinya anemia
Sering menggunakan obat-obatan atau alkohol, hal ini dapat menurunkan nafsu
makan yang menyebabkan kurang gizi dan hepatitis atau kanker hati
Gangguan kemampuan motorik, akibatnya lansia kesulitan untuk menyiapkan
makanan sendiri dan menjadi kurang gizi
Kurang bersosialisasi, kesepian (perubahan psikologis), akibatnya nafsu makan
menurun dan menjadi kurang gizi
Pendapatan menurun (pensiun), konsumsi makanan menjadi menurun akibatnya
menjadi kurang gizi
Dimensia (pikun), akibatnya sering makan atau malah jadi lupa makan, yang dapat
menyebabkan kegemukan atau pun kurang gizi.

2.7

ASKEP

a.PENGKAJIAN
o Berat badan berhubungan dengan tinggi badan, contoh IMT (indeks massa tubuh)
atau catatan yang tepat
o Perubahan berat badanDifokuskan pada kehilangan atau pertambahan berat badan
saat ini
o Pertumbuhan gigi, Apakah lansia memakai gigi palsu atau apakah mereka memerlukan
gigipalsu? Apakah gigi palsu yang ada hilang atau rusak?
o Kebiasaan makan, Aspek pribadi, budaya, dan agama mengenal asupan nutrisi
o Kemampuan untuk makan, Dapatkah lansia memindahkan makanan dari piring ke
mult dan menelannya dengan baik
o Farmakologi, Apakah klien banyak meminum obat-obatan (termasuk medikasi yang
dilakukan sendiri) yang dapat berakibat buruk terhadap nutrisi.

BAB III
PENUTUP
3.1

KESIMPULAN
Lansia mengalami persoalan khusus tentang nutrisi. Mereka beresiko tinggi
menderita malnutrisi dan lebih rentan terkena dampak malnutrisi. Salah satu
indikator yang sangat penting pada status nutrisi adalah berat badan. Perawat
berperan sangat penting dalam pemenuhan nutrisi lansia terutama di Rumah Sakit.
Setiap orang harus makan. Makanan merupakan bagian yang paling pentingdalam
kehidupan sebagian lansia dan saat-saat bersantap menjadi bagian pentingyang
dialami manula setiap harinya. Makanan juga harus menjadi sumber kesehatan serta
kegembiraan bagi orang-orang yang berusia lanjut ini.

3.2

SARAN

Patut diingat bahwa keperluan enersi MANULA sudah menurun, jadi jangan di
sediakan seperti masih belum berusia lanjut. Ada baiknya bila mereka dijaga jangan
sampai menjadi kegemukan karena akan lebih mudah menderita berbagai kelainan
atau penyakit gizi yang berhubungan dengan kondisi obesitas. Frekuensi penyakit
Diabetes Mellitus, Cardiovascular diseases terdapat meningkat pada kelompok
MANULA.

DAFTAR PUSTAKA

Watson, Roger. 2003. Perawatan Pada Lansia. Jakarta : EGC


Nugroho, Wahyudi. 2000. Keperawatan Gerontik. Jakarta : EGC
Fakultas Kedokteran UI. 2000. Pedoman Pengelolan Kesehatan Pasien
Geriatri Untuk Dokter dan Perawat. Jakarta
Beck, Mary E. 2000. Ilmu Gizi dan Diet Hubungannya dengan Penyakitpenyakit untuk Perawat dan Dokter. Jakarta : Yayasan Essentia Medico
Tarwoto, Wartonah. 2003. Kebutuhan Dasar Manusia dan Proses
Keperawatan. Jakarta : Salemba Medika
Panduan Diagnosa Keperawatan NANDA 2005-2006. Prima Medika

FORMAT PENGKAJIAN INDIVIDU


ASUHAN KEPERAWATAN GERONTIK
Tanggal Pengkajian : 25 Maret 2012
A. DATA BIOGRAFI
Nama

:Tn S

TTL
Jenis Kelamin

:Sampit, 20 Oktober 1945


:laki-laki

Pendidikan
Agama

: SMA

Status Perkawinan
TB / BB

:Duda
: 162 cm, 50 Kg

Penampilan
Alamat

:Rapih danbersih
Ciri ciri tubuh :Kurus
: Jl. Merdeka, Kel. Ketapang
RT 3 RW V

: Islam

Kec.Mentawa Baru Hilir


Kabupaten. Kotawaringin Timur
Orang Yang Dekat
Hubungan
Alamat / Telepon

Telp/ Hp : -

:Ny E
:Anak
: Jl. Merdeka No.45

B. RIWAYAT KEPERAWATAN
1. Genogram

Keterangan

: Laki-laki
: Perempuan
: Meninggal dunia
: Tinggal serumah
: Garis pernikahan
: Garis keturunan
: Klien

2.

RiwayatKeluarga
Klien seorang duda, mempunyai anak satu. Klien hidup bersama anak laki-lakinya. Di
keluarga klien tidak ada yang menderita penyakit seperti diabetes, hipertensi, asma,
TB, atau hepatitis.

C. RIWAYAT PEKERJAAN
Pekerjaan saat ini
Alamat pekerjaan

: Berkebun
: Jl. MajuMundur

Jarak dari rumah


Alat transportasi

: 1km
: Jalan kaki

Pekerjaan sebelumnya
Jarak darirumah

: Swasta
: 3 Km

Alat transportasi
: Sepeda Motor
Sumber-sumber Pendapatan & Kecukupan Terhadap Kebutuhan:
Pendapatan berasal dari hasil berkebun dan dibiayai oleh anak.
D. RIWAYAT LINGKUNGAN HIDUP
Type tempa tinggal
:Rumah
Jenis lantai rumah
Kondisi lantai

:Kayu
:Kering

Tangga rumah
Penerangan

:Tidakada
:Cukup

Tempat tidur
Alatd apur

:Aman
:Rapi

WC
Kebersihan lingkungan

:Aman
:bersih

Jumlah orang yang tinggal dalam satu rumah :Sendiri


Derajat privasi
:Terjaga
Tetangga terdekat
Alamat dan telepon

: Ada
: Jl. Merdeka No. 46

E.

RIWAYAT REKREASI
Hobbi / Minat
KeanggotaanOrganisasi
Liburan / Perjalanan

F.

: Memancing
: Pengajian
: Jalan jalan, berkunjung ketempat Anak

SISTEM PENDUKUNG
Perawat / Bidan / Dokter / Fisioterapi
Jarak Dari Rumah

: Perawat
: 1 Km

RumahSakit
Klinik

: Ada Jarak 5 Km
: Ada Jarak 4 Km

Pelayanan Kes. Dirumah


Makanan Yang dihantarkan

: Tidakada
: Tidakada

Perawatan Sehari-hari Yang Dilakukan Keluarga : Check Up kePuskesmas


G. DISKRIPSI KEKHUSUSAN
Kebiasaan Ritual
: klien shalat 5 waktu, klien kadang menjalankan shalat
tahajud.
Yang Lainnya

: Tidakada

H. STATUS KESEHATAN
Status Kesehatan Umum Selama SetahunYangLalu
Anemia
Status KesehatanSelama 5 Tahun Yang Lalu
KeluhanUtama

: klien pernah menderita


: Tidak ada masalah

Klien mengatakan tidak nafsu makan


Pemahaman & Penatalaksanaan Masalah Kesehatan
puskesmas

: Klien sering berobat ke

Alergi :
Obat-Obatan
Makanan

:Tidakada
:Tidakada

FaktorLingkungan
I.

: Tidakada

AKTIVITAS HIDUP SEHARI-HARI (ADL)


IndeksKATZ
:B
Oksigenisasi
Cairan&Elektrolit

: Baik, RR 16 x/m
: Cukup, KlienMinum6gelas /hr

: Nafsu makan kurang, PolaMakan : 2x/hr, hanya mampu menghabiskan porsi


makanan, konjugtiva anemis, BB sebelumnya= 51 kg, BB saatini 50 kg, klien kurang
makan sayur dan jarang makan buah-buahan, klien hidup sendiri.
Eliminasi
: Baik, BAK 2x/hr BAB 1x/hr
Aktivitas
kegiatan

: Saat pagi klien berkebun, di rumah klien tidak ada

Istirahat & Tidur


Personal Hygiene

: Baik, klien tidur 8 jam/hr


: Baik, Klien Mandi 2x/hr

: Klien tidak ada niat lagi untuk berhubungan, klien tidak ada keinginan untuk
menikah lagi

si

:klien 6 bulan sekali melakukan perjalanan (berkunjung ke rumaha naknya).


J.

PSIKOLOGI, KOGNITIF DAN PERSEPTUAL


Konsep diri
: Klien merasa kehidupannya cukupt erpenuhi
Emosi
Adaptasi

: Stabil
: Baik

Mekanisme Pertahanan Diri : Baik


Status Mental
: Stabil
Tingkat Keasadaran
Afasia
Dimensia
Orientasi

: Compos Mentis
: Tidak
: Tidak
: Normal

Bicara
Bahasa Yang Digunakan

: Normal
:BahasaBanjar

Kemampuan Membaca
Kemampuan Interaksi

:Bisa
:Sesuai

Vertigo
:
Shirt Porteble Mental Status Questionaire (SPMSQ)
Mini Mental State Exam (MMSE)
Geriatrik Depresion Scale
APGAR
K. TINJAUAN SISTEM
KeadaanUmum
:Baik
Tingkat Kesadaran : Compos mentis
Tanda-Tanda Vital : TD
130/90 mmhg
RR
16 x/m
TB
168 cm

: 2 Fungsi Mental Utuh

: 2 Baik
: 4 Baik
: 6 Menengah

Nadi 80 x/m
Suhu 36,5oC
BB
50kg

PENGKAJIAN PERSISTEM
1) PERNAFASAN (B1 : BREATHING)
1. Bentuk Dada
: Simetris
2. SekresidanBatuk
: Tidakada
Nyeriwaktubernapas
: Tidakada
3. PolaNapas
: RR 16 x/m, Reguler
4. BunyiNapas
: Normal (tidakadaRonchi)
5. Pergerakan Dada
: Intercostal
6. TractilFremitis/Fremitus Vokal
:Tidakada
7. Alat Bantu Pernapasan
: Tidakada

2) CARDIOVASCULAR (B2: BLEEDING)


1. Nadi
: Frekuensi
80 x/m
2. Bunyi Jantung
: Normal

nt , Reguler

3.
4.
5.
6.
7.
3)
1.
2.
3.
4.
4)
1.
a.
b.
c.
d.
e.
f.
2.
3.
a.
b.
c.
d.
e.
4.
5.

5)

LetakJantung
: Ictus Cordis teraba pada intercostal V, kira-kira 1 jari medial
darigaris midklavikular
Pembesaran Jantung : Tidakada
NyeriDada
: Tidakada
Edema
: Tidakada
Clubbing Finger
: Tidak
PERSARAFAN (B3: BRAIN)
Tingkat kesadaran :
Compos Mentis
GCS :
Eye : 4
Verbal : 5
Motorik : 6
Total GCS
: 15
Refleks
: Normal
Koordinasi Gerak
: Ya
Kejang
: Tidak
PENGINDERAAN
Mata (Penglihatan)
Bentuk
Pupil
Gerak Bola Mata
Medan Penglihatan
ButaWarna
TekananInraOkuler
Hidung (Penciuman)
Bentuk
GangguanPenciuman
Telinga (Pendengaran)
Aurikel
Membran Tympani
Otorrchea
GangguanPendengaran
Tinitus
Perasa
Peraba

: Normal
: Ishokor
: Normal
: Normal
: Tidak
: Tidak
: Normal
: Tidak
: Normal
: Terang
: Tidak
: Tidak
: Tidak
: Normal
: Normal

PERKEMIHAN - ELIMINASI URI (B4: BLADDER)


Tidak ada nyeri saat berkemih, tidak sering berkemih, tidak ada urin yang tertahan
saat berkemih
MasalahKandungKemih : Tidakadamasalah
Produksi Urine
: 600 ml/hr
Frekuensi : 2x/hr
Warna:Kekuningan
Bau : Amoniak

6) PENCERNAAN-ELIMINASI ALVI (B5: BOWEL)


1. MulutdanTenggorokan
a. Mulut
: Rongga mulut bersih, tidak ada bau mulut
b. Gigi
: Gigi tidak lengkap, tidak ada lubang gigi,
Selaput Lendir Mulut
: Lembab
c. Lidah
: Bersih, ada sariawan
d. Kebersihan Rongga Mulut
: Tidak Berbau
e. Tenggorokan
: Tidak terlihat sulit menelan
f. Abdomen
: Kenyal
g. Pembesaran Hepar
: Tidak

h. Pembesaran Lien
i. Asites

: Tidak
: Tidak

2. Masalah Usus Besar dan Rectum / Anus

BAB 1 x/hr

Tidak ada masalah

Obat Pencahar
: Tidak

Lavemen
: Tidak
7) OTOT, YULANG DAN INTEGUMENT (B6: BONE)
1. OtotdanTulang

Kemampuan Pergerakan Sendi lengan dan Tungkai (ROM)


Bebas

Kemampuan kekuatan otot :


4
4
4
4

Fraktur
: Tidak

Dislokasi
:Tidak

Haemotom : Tidak
2. Integumen
Warna Kulit
: Kuning langsat
Akral
: Hangat
Turgor
: Tidakelastis
Tulang Belakang
: Normal
8) REPRODUKSI
Laki-laki :
Kelamin Bentuk
: Normal
Kebersihan Alat Kelamin
: Bersih
9) ENDOKRIN
1. Faktor Alergi
Manifestasi
Cara Mengatasi
2. Kelainan Endokrin

: Tidak
: Tidakada
: Tidakada
: Tidakada

10) PENGETAHUAN
Pengetahuan klien tentang kesehatan dirinya :
Klien mengetahui tentang kondisi kesehatannya dan klien sering cek up untuk
kesehatannya

ANALISA DATA
NO

KELUHAN

ETIOLOGI

PROBLEM

1.

DS : Klien mengatakan tidak nafsu makan


DO :
Gigi tidak lengkap
Lidah ada sariawan
PolaMakan : 2x/hr,
hanyamampumenghabiskan porsimakanan
Konjugtiva anemis
BB sebelumnya= 51 kg, BB saatini 50 kg
Klien kurang makan sayur dan jarang makan
buah-buahan
klienhidupsendiri

Intake yang
tidakadekuat

Ketidak
seimbangan
nutrisi : nutrisi
kurang dari
kebutuhan tubuh

RENCANA KEPERAWATAN
Dx.
Kep.

No.
1.

1.
2.
3.
4.
5.

Tujuan

Intervensi

Setelah dilakukan
1.
tindakan keperawatan
selama 1x24 jam
diharapkan
ketidakseimbangan 2.
nutrisi : nutrisi kurang
dari kebutuhan tubuh
teratasi dengan
Kriteria hasil :
Nafsu makan
3.
meningkat
Berat badan meningkat
Adanya perubahan pola
makan
Konjungtiva normal 4.
Klien tampak tidak
lemah

Timbang berat badan


setiap hari

Rasional
1. R/mengetahui perubahan
keadaan umum nutrisi pada
klien

Anjurkan makan sedikit 2. R/Dilatasi gaster dapat


tapi sering
terjadi bila pemberian
makan terlalu cepat setelah
periode puasa
Anjurkan makan-makanan3. R/membantu meningkatkan
yang lunak dan mudah
intake makanan
dicerna.

4. Membantu meningkatkan
Anjurkan keluarga untuk
nafsu makan
menyediakan makanan
kesukaan klien.
5. R/ Mencegah terjadinya
5. Anjurkan makan makanan mual dan membantu
yang disajikan dalam
meningkatkan nafsu makan
kondisi hangat

Dx.
Kep.

No.
1. 1
.

Implementasi

Evaluasi

Tgl 25 Maret 2012 (09.00 wib)


1. Menimbang berat badan setiap hari
Hasil : BB = 50 kg
2. Menganjurkan makan sedikit tapi
sering
Hasil :
Anjuran telah di berikan , klien akan
melakukan anjuran.
3. Menganjurkan makan makanan
yang lunak dan mudah dicerna
Hasil :
Klien setuju untuk makan makanan
yang lunak dan mudah dicerna

26 Maret 2012 (09.00 wib)


DS : Saya sudah
menghabiskan setengah
porsi makanan
DO :
K/u baik
Nafsumakanklienmeningka
t
Konjungtiva normal
TD : 100 / 70 mmhg
N : 80 x/m
RR : 20 x/m
S : 36,6 oC
BB 50 kg

4. Menganjurkan keluarga untuk


A : Masalah nutrisi kurang
menyediakan makanan kesukaan
dari kebutuhan tubuh
klien
teratasi sebagian
Hasil :
1. Nafsu makan meningkat
Anjuran telah diberikan, keluarga 2. Adanya perubahan pola
mengungkapkan akan melakukan
makan
apa yang di anjurkan.
3. Konjungtiva normal
4. Klien tampak tidak lemah
5. Menganjurkan makan makanan
yang disajikan dalamkondisi hangat P: Lanjutkan intervensi
Hasil :
Klien setuju untuk makan makanan
yang disajikan dalam kondisi hangat

Diposkan 31st March 2012 oleh Inka Februaria


0

Tambahkan komentar

Memuat
Template Dynamic Views. Diberdayakan oleh Blogger.