Anda di halaman 1dari 30

INSTITUT PENDIDIKAN GURU

KAMPUS PENDIDIKAN TEKNIK


KUALA LUMPUR

KAJIAN KURIKULUM KEMAHIRAN HIDUP


SEKOLAH RENDAH
RBT 3103

ESEI
INOVASI KURIKULUM KEMAHIRAN
HIDUP SEKOLAH RENDAH
NAMA

: HARMIZI BIN MUSA


: 890305-07-5677
: MUHAMMAD RIZAM BIN BAKRI
: 900421-12-6693

NO. MATRIK

: 7924/ 7925

KUMPULAN

: 2 PISMP RBT 3

KOD DAN M/P: RBT 3103 KAJIAN KURIKULUM KHSR


NAMA PENSYARAH PEMBIMBING: DR TAJUL ARIFFIN BIN YANG
HUSSIN
TARIKH SERAHAN: 23 JULAI 2010

BIODATA DIRI

Nama

No kadpengenalan :
No matrik

HARMIZI BIN MUSA


890305-07-5677

7924

Negerikelahiran

BalikPulau,Pulau Pinang

Alamat e-mail

mrtebu_ska89@yahoo.com

Subjek :

KajianKurikulumKemahiranHidupSekolahRendah

Pensyarah
Prinsiphidup

:
:

Dr.TajulAriffin Bin Yang Hussin


SentiasaBerusahaHinggaMencapaiKejayaan.

BIOGRAFI

NAMA :MUHAMMAD RIZAM BIN BAKRI


NO. KAD PENGENALAN :900421-12-6693
NOMBOR MATRIK :7925
ALAMAT :NO. 11203 TAMAN KUHARA INDAH
LORONG 3,
BATU 2 JALAN KUHARA, 91000, TAWAU, SABAH
KELAS :1 PISMP RBT 3
HOBI :BERMAIN PERMAINAN PC DAN X-BOX

NOMBOR TELEFON :019-8011437


ABSTRAK
Kurikulumadalahrancanganpendidikan

yang

perubahan.Dalamkontekspendidikan
perancangandanpembentukankurikulum

sentiasa

mengalami

di
(Khususnya

Malaysia,
KBSR

adalahdidasariolehfalsafahdanmatlamatpendidikannegara

dan

KBSM)
yang

menentukanarahhaluan, asas dan sumber inspirasi kepada semua usaha dan


rancangan dalam bidang pendidikan.
Kurikulum atau pun skop kandungan sesuatu pelajaran adalah asas penting dalam
sistem pendidikan sesebuah negara. Sebagai sebuah negara yang sedang pesat
membangun, Malaysia memerlukan suatu kurikulum yang kemas dan sesuai untuk
mewujudkan sistem pendidikan yang dinamik serta selaras dengan cita-cita dan
kehendak negara ( Kamaruddin Haji Hussin, 1994 ).
Perkembangan kurikulum tidak berlaku dengan sendiri tanpa sebab yang
mempengaruhinya. Ia berlaku sejajar dengan kemajuan masyarakat dan negara dan
ia dianggap sebagai satu proses yang dinamik dan seimbang.

PENGHARGAAN

Assalamualaikum dan salam sejahtera.


Alhamdulilahsegala puji-pujian itu hanya untuk Allah S.W.T tuhan alam
semesta dan selawat ke atas junjungan besar Nabi Muhammad S.A.W. Kami
panjatkan kesyukuran ke hadrat ilahi kerana dengan limpah kurnianya dapatlah kami
menyiapkan tugasan yang telah diberikan dengan jayanya. Berbekalkan semangat
dan berkat kesabaran kami sepanjang menyiapkan tugasan ini, maka dapatlah kami
menyiapkan tugasan ini seperti yang telah ditetapkan.
Di kesempatan ini, kami ingin memanjatkan setinggi-tinggi ucapan terima
kasih khususnya kepada pensyarah Kajian Kurikulum kemahiran Hidup Sekolah
Rendah iaitu

Dr. Tajul Ariffin Bin Yang Hussin yang tidakjemu memberikan tunjuk

ajar sepanjang kami menyiapkan tugasan ini. Keperihatinan tuan amat kami
sanjungi.
Jutaan terima kasih juga kami ucapkan kepada rakan-rakan khususnya
pelajar-pelajar RBT3 yang banyak berkongsi idea yang bernas serta komen-komen
yang dapat memberansangkan agar kami menghasilkan tugasan yang lebih baik.
Akhir kata,kami hulurkan ucapan jutaan terima kasih yang tidak terhingga
kepada keluarga yang tidak jemu memberikan sokongan dan juga bantuan
kewangan.Semoga apa yang telah dilakukan adalah dengan niat yang ikhlas dan
suci demi kemajuan agama,bangsa dan negara serta diredhai-Nya.Sesungguhnya
yang baik itu datangnya dari Allah S.W.T dan yang buruk itu datangnya dari
kelemahan kami sendiri.

Sekian ,Terimakasih.

Isi Kandungan
PERKARA

BIODATA
ABSTRAK
PENGHARGAAN
ISI KANDUNGAN
CADANGAN PENAMBAHBAIKAN
REFLEKSI
BIBLIOGRAFI

M/S

FAKTOR-FAKTOR YANG MEMPENGARUHI PEMBENTUKAN KURIKULUM


1.0 Falsafah pendidikan
Falsafah pendidikan negara memainkan peranan yang penting dalam mencorak
sistem pendidikan di sesebuah negara, khususnya di Malaysia. Falsafah pendidikan
kebangsaan kita adalah seperti berikut :
"Pendidikan di Malaysia adalah suatu usaha berterusan ke arah
memperkembangkan lagi potensi individu secara menyeluruh dan
bersepadu untuk mewujudkan insan yang harmoni dan seimbang dari
segi intelek, rohani, emosi dan jasmani berdasarkan kepercayaan dan
kepatuhan kepada Tuhan. Usaha ini adalah bagi melahirkan rakyat
Malaysia yang berilmu pengetahuan, berketrampilan, berakhlaq mulia,
bertanggungjawabdanberkeupayaanmencapaikesejahterandirisertame
mberisumbanganterhadapkeharmoniandankemakmuranmasyarakatdan
negara" ( PPK, 1988 )

Falsafahpendidikannegaramempunyai implikasi yang besar terhadap pembentukan


kurikulum. KBSR dan KBSM adalah hasil perubahan yang diaspirasikan dalam
Falsafah Pendidikan Negara. Antara perubahan-perubahan yang jelas terdapat
dalam kedua-dua tersebut ialah ;
i.

Sukatan pelajaran yang digubal memberi penekanan kepada aspek


kesepaduan dan keseimbangan. Oleh itu konsep-konsep seperti
penggabungjalinan (penyatuan kemahiran-kemahiran) dan penyerapan
( penyatuan isi ) sentiasa dititik beratkan.

ii.

Penekanan baru diberikan kepada penerapan nilai-nilai murni. Ia


seharusnya diserapkan dalam setiap mata pelajaran yang diajar di
sekolah.

iii.

Program pendidikan disusun agar dapat melahirkan insan yang


seimbang dan harmonis dari segi intelek, rohani, emosi dan jasmani
berdasarkan kepercayaan dan kepatuhan kepada Tuhan.

iv.

Program

pendidikan

yang

menitik

beratkan

pendidikan

umum

diperkenalkan.
v.

Penekanan diberikan kepada pendidikan teknik dan vokasional.

vi.

Penekanan juga diberikan kepada bahasa merentasi kurikulum.

vii.

Pemupukan budaya sains dan teknologi terus ditekankan.

viii.

Pemupukan budaya keusahawanan dan budaya niaga ditegaskan.

ix.

Pengukuhan dan perluasan bahasa Melayu sebagai satu cabang ilmu


pengetahuan.

x.

Peningkatan pendedahan dan penguasaan bahasa Inggeris.

xi.

Penekanan

kepada

melahirkan

individu

yang

berkeyakinan

diridanbersikapberdikari.
( Kamaruddin Haji Husin, 1994 )

2.0Kehendak masyarakat
Kurikulum digubal dan dilaksanakan mengikut kehendak dan desakan masyarakat.
Masyarakat juga menentukan samada kurikulum itu sesuai atau pun tidak dengan
kehendak mereka. Namun begitu bukanlah mudah untuk memenuhi semua tuntutan
masyarakat terhadap kurikulum dan sumbangannya pada budaya, lebih-lebih lagi
dalam masyarakat yang kompleks dan mengalami perubahan yang pesat.
Hilda Taba( 1962 :24) menyatakan :
" It is not an easy task to establish what demands society makes on
education and what contribution education can or should make to

culture, especially in a complex society in which vast and rapid changes


are occurring."
Penilaian atau kajian berterusan adalah diperlukan untuk memastikan matlamat dan
kehendak masyarakat terhadap pendidikan benar-benar terlaksana. Misalnya dalam
masyarakat industri, pendidikan harus mempunyai strategi terhadap ciri-ciri ekonomi,
politik, sosial dan budaya masyarakat tersebut. Dalam masyarakat pertanian pula,
ciri-ciri kurikulumnya adalah berbeza.
Masyarakat mengkehendaki murid-murid mempelajari kemahiran-kemahiran asas
seperti membaca, menulis dan mengira; konsep-konsep asas cara hidup masyarakat
dari segi politik, sosial dan ekonomi; serta teknik-teknik asas untuk menyertai
kehidupan sesuatu masyarakat, seperti mengambil bahagian dalam perbincangan,
kepimpinan dan pemikiran kritis dalam suatu sistem demokratik.
KBSR telah digubal dengan tujuan untuk membolehkan murid-murid :
- menguasai bahasa Melayu dengan memuaskan.
- menguasai kemahiran asas berbahasa seperti bertutur, membaca dan menulis.
- menguasai kemahiran mengira
- menguasai Bahasa Inggeris
- membina dan memupuk akhlak yang mulia
- meningkatkan ilmu pengetahuan tentang manusia dan alam
- dapat bergaul dalam masyarakat
mengembangkan bakat dan daya kepimpinan

3.0Faktor politik

Francis P. Hunkin (1987) dalambukunya "Curriculum Planning menyatakan " :


"Curriculum Development is also a political process. It requires dealing with people
and their various power bases and their views of what makes for good education"
Wiles Bondi (1989) dalam bukunya `Curriculum Development : A Guide to Practice
turut menjelaskan pengaruh politik dalam pembentukan dan perkembangan sesuatu
kurikulum.
Ini jelas menunjukkkan bahawa perkembangan kurikulum dipengaruhi oleh proses
politik, kerana setiap kali pucuk pimpinan sesebuah negara itu bertukar, maka setiap
kali itulah kurikulum pendidikan akan dikaji semula. Kurikulum pendidikan menjadi
saluran penting bagi setiap badan pemerintahanmenguatkan pengaruh mereka.
Kerajaan bertanggungjawab menetapkan Dasar Pendidikan Negara sejajar dengan
hasrat pemerintah.
Di Malaysia misalnya, ketika British berkuasa di negara ini, dasar pelajaran hanya
bertujuan menjadikan anak-anak Melayu petani dan nelayan yang lebih baik
daripada ibubapa mereka. Pihak British tidak langsung menitikberatkan perpaduan
rakyat berbilang kaum di negara ini. Apabila negara mencapai kemerdekaan, Dasar
Pelajaran

Kebangsaan

turut

berkembang

dan

berubah.

Dasar

Pelajaran

Kebangsaaan yang termaktub dalam Akta Pelajaran 1961 menitikberatkan aspekaspek yang berkaitan dengan perpaduan negara dan penghasilan tenaga kerja.
Melalui kurikulum Pendidikan disalurkan aktiviti-aktiviti yang boleh membentuk
keperibadian dan perwatakan individu yang baik dan oleh membawa ke arah
perpaduan. Sukatan pelajaran yang sama isi kandungannya yang disyorkan oleh
Penyata Razak 1956 dianggap sebagai salah satu asas sistem pendidikan
kebangsaan bagi mewujudkan perpaduan negara itu.

4.0 Faktor pembangunan negara dan perkembangan dunia


Perkembangan kurikulum juga dipengaruhi oleh faktor pembangunan negara dan
perkembangan dunia. Negara yang ingin maju dan membangun tidak seharusnya

mempunyai kurikulum yang statik. Oleh itu ia harus diubahsuai mengikut peredaran
masa dan kemajuan sains dan teknologi. MenurutHidaTaba (1962)

"Technology has changed and is changing not only the face of the earth and
the institutions of our society, but man itself

Kenyataan di atas jelas menunjukkan bahawa perkembangan teknologi telah


membawa perubahan yang pesat pada kehidupan manusia di muka bumi ini. Oleh
itu perkembangan kurikulum haruslah sejajar dengan pembangunan negara dan
perkembangan dunia. Kandungan kurikulum pendidikan perlu menitikberatkan mata
pelajaran sains dan kemahiran teknik atau vokasional kerana tenaga kerja yang
mahir diperlukan dalam zaman yang berteknologidancanggihini.
(Ee Ah Meng, 1995)

5.0Faktor perubahan sosial


Selain menjadi tempat menyalurkan pengetahuan dan melatih kemahiran akademik,
sekolah juga merupakan agen sosial. Melalui pendidikan di sekolah, nilai-nilai sosial
yang diperlukan dalam dan negara diserapkan.
Dewasa ini masalah keruntuhan moral dan jenayah di kalangan remaja dan muridmurid semakin meningkat. Mereka terdedah dengan masalah penagihan dadah,
minum minuman keras, merokok, pergaulan bebas dan melakukan perkara-perkara
jenayah seperti mencuri, merompak, merogol dan sebagainya. Masalah ini jika tidak
dibendung dengan segera, akan merosak dan menghalang pembangunan negara.
Menyedari hakikat ini, negara telah mewujudkan Falsafah Pendidikan Negara yang
bertujuan memperkembangkan lagi potensi individu secara menyeluruh dan

bersepadu untuk mewujudkan insan yang harmonis dan seimbang dari segi intelek,
rohani, emosi dan jasmani.. Dengan itu perkembangan kurikulum harus sejajar
dengan perubahan sosial agar nilai-nilai murni dalam diri individu tidak pupus
ditelanaruspembangunan(Mohammad Nor, 1990; Kamaruddin Hj. Husin, 1994).

6.0 Faktor perancang dan pelaksana kurikulum


Perubahan yang begitu pesat dalam masyarakat dan dunia membuat kurikulum hari
ini perlu disesuaikan mengikut peredaran masa. Sehubungan dengan itu perancang
kurikulum

bertanggungjawab

menyemak

semula

dari

masa

ke

semasa.

Pengguguran, perubahan atau pertambahan terhadap kurikulum harus dilakukan


mengikut peredaran masa, kehendak masyarakat dan kemajuan negara.
Kita hidup dalam masyarakat yang berubah-ubah, iaitu pengetahuan baru sentiasa
ditemui,

sementara

pengetahuan

lama

yang

dibuktikan

kurang

tepat

diperkemaskinikan. Masalah pertambahan pengetahuan yang banyak menimbulkan


masalah pemilihan apa yang hendak dipelajari serta pertimbangan semula
bagaimana pembelajaran harus berlaku. Dengan menyedari bahawa murid-murid
harus disediakan untuk menyesuaikan diri dengan permintaan masyarakat yang
cepat berubah, guru-guru dan perancang kurikulum harus menyemak semula apa
yang mereka kemukakan kepada murid-murid (Kamaruddin Hj. Husin, 1994).
Berdasarkan maklumat yang diperolehi daripada pelaksana kurikulum harus sentiasa
peka dengan perubahan yang timbul serta bersedia mencari penyelesaian dalam
mengubah kurikulum merupakan orang yang penting dalam

7.0 Faktor murid , kehendak , dan keperluan masyarakat

Pelajar sebagai individu mempunyai kehendak dan keperluan asas ytang melibatkan
kehendak dan keperluan asa yang melibatkan keselamatan, kasih sayang,
bermasyarakat dan kehendak penyempurnaan kendiri. Kurikulum yang akan
dibentuk sewajarnya dapat memberi ilmu pengetahuan dan kemahiran agar
kehendak dan keperluannya sebagai muriod dan individu dapat dipenuhi. Ini
bermakna, kurikulum yang dibentuk akan menyediakan segala ilmu pengetahuan
dan kemahiran yang merangsang perkembangan potensi mereka secara menyeluruh
iaitu merangkumi intelek, jasmani, rohani dan sosial( Ee Ah Meng, 1995).
Perancangan kurikulum yang baik sentiasa mengambil kira keperluan murid serta
mampu memberi faedah secara menyeluruh. Ini bermakna faktor minat dan
perkembangan individu dalam bidang kognitif, psikomotor dan afektif perlu difikirkan
semasa membentuk kurikulum tersebut.
Kajian hendaklah dilakukan terhadap keperlun individu, sekurang-kurangnya dari
peringkat bayi

hingga remaja. Hasilnya, segala keperluan tersebut dapat

diserapkankedalamsistempendidikanitudandilaksanakan

di

sekolah-

sekolahdenganberkesan.

Murid adalah individu yang bakal menjadi sebahagian daripada anggota masyarakat.
Oleh itu, kurikulum haruslah bertanggungjawab menyediakan murid-murid dengan
pendidikan yang berkaitan dengan masyarakat di mana mereka tinggal dan juga
bentuk masyarakat yang akan mereka hadapi kelak.

8.0 Faktor perkembangan ilmu dan kepentingannya


Masa yang berlalu turut membawa perubahan kepada masyarakat yang seterusnya
menuntut mereka menerima pendidikan yang lebih sempurna selaras dengan
keperluan kemajuan yang kian pesat. Ilmu yang bersifat dinamik menyebabkan ia
sentiasa

berkembang.

Perkembanganinidisebarkankepadamasyarakatmenerusiperancangankurikulumyang
lebihkemasdansesuaidengankehendakmasyarakatdan negara.
Penemuan baru dalam pelbagai bidang seperti perubatan, teknologi dan sebagainya
menjadikan bidang itu terus berkembang. Perekembangan ini penting dalam
pembentukan kurikulum supaya ia dapat dikemaskini dari masa ke semasa agar ilmu
-ilmu baru ini dapat dissalurkan kepada murid-murid bagi mengimbangi keperluan
zaman.
Selain itu, pengenalan ilmu atau bidang-bidang baru ke dalam pendidikan membantu
meningkatkan taraf pendidikan itu sendiri. Contohnya, memperkenalkan ilmu
pengurusan dan perhubungan ke dalam bidang pendidikan, khususnya ke dalam
bidang kurikulum, meningkatkan lagi keberkesanan proses perkembvangan kuriklum
itu sendiri.

9.0 Pengaruh psikologi pendidikan


Teori disiplin mental yang berlandaskan konsep falsafah yang dimajukan oleh Plato
dan Aristotle banyak mempengaruhi pengajaran aritmetik pada abad ke 19. Salah
satu aspek disiplin mental yang penting ialah psikologi fakulti.
Pemikiran psikologi `behaviourisme telah bertapak dalam kurikulum pendidikan
kemahiran hidup sejak awal 60an. Dalam pemikiran ini murid telah dianggap
sebagai gelas kosong. Guru berperanan memasukkan pengetahuan klemahiran ke
dalam gelas tersebut. Pendekatan ini mengenepikan aktiviti pengembangan intelek
yang sekaligus membina sikap negatif dalam diri pelajar terhadap matematik.

Untuk mengatasi masalah itu, satu kurikulum kemahiran hidup yang memberikan
tumpuan kepada penyelesaian masalah dan pemikiran kritis telah diperkembangkan
pada

penghujung

tahun

70an.

Seterusnya

dalam

KBSM

danpembelajarankemahiranhidupditekankankepadafahamanbinaan

pengajaran
(konstuktivm)

dankemahiranberfikirsecarakreatifdankritis.(Nik Aziz Nik Pa, 1992)

PENUTUP
Proses perkembangan kurikulum sebagai sifatnya yang sentiasa berubah turut
dipengaruhi oleh faktor-faktor persekitaran yang merangsang reaksi manusia yang
terlibat

dalam

kepentingannya.

Hasrat

terhadap

perubahan

kurikulum

itu

menggambarkan keperluan pendidikan yang menjadi wadah peneerusan kepada


kemajuan tamadun bangsa dan negara itu sendiri.
Sebenarnya, faktor-faktor yang mempengaruhi pembentukan dan [perkembangan
kurikulum adalah elemen yang saling berkait antara satu sama lain. Dapatlah
dikatakan bahawa faktor-faktor yang mempengaruhi perkembangan kurikulum itu
sendiri mencerminkan idealisme dan perubahan keperluanmasyarakat dan negara,
melalui

institusi

persekolahan

mencetuskan tamadun baru.

yang

akan

meneruskan

kebudayaan

atau

Prinsip pengembangan dan inovasi kurikulum.


Proses merancang, melaksana dan menilai kurikulumbagi memenuhi matlamat,
tujuan dan objektifpendidikan yang sentiasa berubah.

Merancang: melahir, mereka bentuk dan menghasilkankurikulum


Melaksana: menterjemah rancangan kepada tindakan
Menilai: menaksir hasil perancangan dan tindakan

Proses ini melibatakan prosedur sedia ada dan baru


Terdapat dalam berbagai pendekatan dan modelperkembangan kurikulum

PendekatanTeknikaldanBukan Teknikal dalam Perkembangan Kurikulum


Pendekatan Teknikal
Melihat perkembangan kurikulum sebagai suatu perancangan rasional untuk
memilih, menyusun dan menyampaikan kurikulum.
Komponen yang terlibat boleh dikenalpasti dan dipetakan mengikur (carta) alir
tertentu.
PendekatanBukan-teknikal
Melihat perkembangan kurikulum sebagai suatu aktiviti yang subjektif dan dinamik,
berdepan dengan ketidaktentuan
Bergantung kepada intuisi

PerkembanganKurikulum: Apa yang diperkembangkan?


TIGA KOMPONEN:
Isi kandungan
Apa yang patut dimasukkan, apa yang patun ditinggalkan?
Pengalaman Pembelajaran
Apakah pengalaman pembelajaran yang sepatutnya?
PersekitaranPembelajaran
Apakah yang patutmemudahkan pengalaman pembelajaran?
Memperkembangkan Isi KandungandanErti Isi Kandungan, sama ada:
Traditionalis - sebagai pengetahuan daripada pelbagai disiplin ilmu
Konstruktivisme - sebagai pengetahuan yang terbina dalam minda manusia
Existentialism - sebagai pengalaman unik individu

Memperkembang Isi Kandungan: Antara Proses vs Isi


Pengetahuan Deklaratif: Pengetahuan tentang Apa
Fakta, konsep, generalisasi, prinsip, teori
Pembelajaran yang pasif, sebagai menyerap maklumat
Pengetahuan Prosedur: Pengetahuan tentang Bagaimana
Cara mengetahui, berfikir, inkuiri, menghasil dan mengguna pengetahuan
Pembelajaran aktif, memajukan pengetahuan
Memperkembangkan Isi Kandungan:
Bagaimana Menyusunnya

Secara logikal berdasarkan aturan dan konsep


Berdasarkan struktur disiplin, yang ditetapkan oleh sarjana
Secara psikologikal berdasarkan bagaimana kita belajar
Berdasarkan teori-teori psikologi

Secara politikal berdasarkan kepentingan isi kandungan


Berdasarkan tuntutan kumpulan pendesak agar isi kandungan tertentu diberi
penekanan, secara tertentu
Praktikal berdasarkan cara yang optima
Berdasarkan cara belajar yang paling maksimum, mudah, cekap, pantas, murah

Memperkembangkan Isi Kandungan:


Apa yang dipilih dan berdasarkan apa?
Mencukupi (Self-sufficient)
Membantu pelajar belajar dengan sendiri
Signifikan Menyumbang ke arah matlamat kurikulum
Sah Benar, autentik, tepat
Perlukan verifikasi (penentusah)
Minat
Bermakna kepada pealajar dan menarik minat seterusnya
Utiliti
Kebergunaan kepada pelajar dan masyarakat pada masa depan
Kebolehbelajaran Boleh dipelajari oleh sesiapa sahaja?
Fisibiliti (Boleh Menjadi) Dari segi masa, ruangdansumber

Memperkembang Pengalaman
Pembelajaran: Kurikulum Sebagai KataKerja
Kata Kerja: Menyampai kurikulum
Pengalaman yang dirancangn bagi pelajar untuk terlibat,membina makna, dan
mengerti tentang kurikulum.
Interaksi guru-pelajar melibatkan isi kandungan kurikulum
Pedagogi/Kaedah pengajaran:
Berpusatkan guru lwn Berpusatkan Pelajar
Aktiviti Pembelajaran:
Pasif lwn Aktif aktiviti

MemperkembangPersekitaran:
Menyediakan persekitaran pembelajaran

Adakah persekitaran menggalakan pembelajaran isikandungan dan pengalaman


yang dipilihdandisusun?
Saiz sekolah dan ruang yang optima
Sekolah kecil, saiz kelas kecil, dengan kemudahan tersediadalam ruang tertentu
Budaya sekolah yang mengalakkan pembelajaran
Sinergi pembelajaran; komuniti pembelajaran; ethos
Suasana yang aktif, hidup, selamat, kondusif

Memperkembang Persekitaran: CriteriaReka Bentuk


Kecukupan: Ruang yang cukup untuk perbagai tujuan
dan aktiviti?

Kesesuaian: memenuhi kehendak yang dihasratkan?


Kecekapan: menggalakan pembelajarn maksimum?
Ekonomik: penggunaan yang maksimum bagimencapai

maksimum
Lain-lain: Akoustik, Pencahayaan, Suhu, Komunikasi,Penyudahan (Finishing)

pembelajaran

Inovasi kurikulum kemahiran hidup sekolah rendah

Perlaksanaan inovasi kurikulum kemahiran hidup sekolah rendah.

Teknikdankonteksinovasi kurikulum
Model CIPP
Salah satu model yang boleh digunakan dalam penilaian kurikulum ialah Model CIPP
yang diutarakan oleh Stufflebeam et. al. (1974)
Rajah 8: Model CIPP.
PENILAIAN
KONTEKS

PENILAIAN
INPUT

PENILAIAN
PROSES

PENILAIAN
PRODUK

PENYEDIAAN DAN
PENSTURKTURAN
KURIKULUM

PELAKSANAAN
KURIKULUM

Penilaian Konteks
Melibatkan analisis masalah dan keperluan dalam pendidikan seperti persekitaran,
iklim, budaya institusi, dan sebagainya.

Penilaian Input
Melibatkan penganalisaan bahan sumber dan strategi yang perlu untuk mencapai
matlamat

dan

objektif

program

seperti

pensyarah,

kakitangan,

kurikulum,

kemudahan, pelajar dan lain-lain.

Penilaian Proses
Melibatkan kajian mengenai proses pelaksanaan seperti aktiviti pengajaran dan
pembelajaran, kemudahan bilik kuliah, kemudahan sokongan, dsb.

Penilaian Produk
Menentukan setakat mana matlamat program telah dicapai seperti bilangan dan
kualiti lulusan, pengiktirafan yang diperolehi dan sebagainya.

Model Tyler
Model Tyleratau Model Objektif diperkenalkan oleh Ralph Tyler dalam tahun 1949
dan dianggap sebagai model yang klasik dan banyak digunakan dalam bidang
perkembangan kurikulum.
Menurut Tyler, apabila membentuk kurikulum, terdapat empat soalan asas, yang
lebih dikenali sebagai Tylers Rationale, perlu dijawab. Soalan-soalan tersebut
adalah:
1. What educational purposes should the school seek to attain?
2. What educational experiences can be provided that are likely to attain
these purposes?
3. How can these educational experiences be effectively organized?
4. How can we determine whether these purposes are being attained?

Berdasarkan kepada Tylers Rationale atau soalan-soalan yang dikemukakan,


perkembangan kurikulum berdasarkan Model Tyler melibatkan empat langkah
berikut:
Rajah 4: Langkah-Langkah Dalam Model Tyler.
Menentukanmatlamatdanobjektif.

Memilihpengalamanpembelajaranataukandunganpelajar
anbagimencapaimatlamatdanobjektif.

Pengalaman pembelajaran atau kandungan pelajaran


perlu disusun secara sistematik.

Hasilmenggunakankurikulumperludinilaibagimenentukan
pencapaianobjektif.
Proses ini boleh digambarkan seperti di dalam Rajah 5.

Rajah 5: Proses Perkembangan Kurikulum.

OBJEKTIF

KANDUNGAN

KAEDAH

PENILAIAN

Menentukan Objektif
Berdasarkan Model Tyler, langkah pertama dalam perkembangan kurikulum
ialah menentukan matlamat dan objektif yang ingin dicapai, hasil daripada
proses pendidikan.
Menurut Tyler, objektifnya hendaklah selaras dengan:

keperluan pelajar.

keperluan semasa masyarakat.

pandangan pakar dalam berbagai bidang berkenaan.

Bagi menentukan objektif yang dibentuk bersesuaian, ianya hendaklah dibentuk


berdasarkan kepada:

falsafah dan matlamat pendidikan yang dibentuk atau telah sedia ada.

psikologi pelajar dari segi teori pembelajaran, kematangan pelajar dan


sebagainya.

Objektif yang dibentuk pula perlu menerangkan dengan jelas:

apakah yang hendak dicapai, bagi memudahkan proses


penilaian.

apakah perubahan yang ingin diperolehi oleh pelajar, bagi


menentukan pencapaian objektif.

PemilihanKandungan
Menurut Tyler, pemilihan kandungan merupakan proses yang kreatif. Perancang
kurikulum perlu memilih subjek, kandungan atau pengalaman pembelajaran yang
perlu didedahkan kepada pelajar bagi mencapai objektif yang telah ditetapkan.

KaedahPenyusunanKandungan
Kandungan kurikulum yang telah dipilih hendaklah disusun dengan teliti agar dapat
menghasilkan pembelajaran yang menyeluruh dan berkesan. Untuk tujuan ini, Tyler
mencadangkan tiga prinsip dalam penyusunan kandungan:

Prinsip Kesinambungan

Prinsip Kesinambungan atau Principle of Continuity bermaksud objektif atau


kandungan yang penting hendaklah sentiasa diulang dan didedahkan secara
berterusan dengan berbagai-bagai kaedah dan cara bagi menentukan ia dipelajari
dengan menyeluruh.

Prinsip Ketertiban

Prinsip Ketertiban atau Principle of Sequence menyarankan pembelajaran hendaklah


berterusan dan berturutan dengan berdasarkan pengalaman lalu, supaya pelajar
berpeluang mempelajari sesuatu dengan lebih luas dan mendalam.

Prinsip Kesepaduan
PrinsipKesepaduanatauPrinciple

of

Integrationmenetapkan

pengalamanpembelajarandihubungkaitkanantarasatusama

agar
lain

supayapembelajaranlebihbermaknadanmenyeluruh.
Pengalaman

pembelajaran

yang

disusun

berdasarkan

ketiga-tiga

prinsip

tersebutakandapatmemastikanpengetahuan yang dipelajarikekaldanberkesan.

PenentuanPenilaian
Peringkat seterusnya ialah menentukan kaedah penilaian yang boleh digunakan
untuk menentukan pencapaian objektif iaitu menentukan setakat mana objektif yang
telah dibentuk tercapai. Penilaian boleh dilakukan dengan berbagai kaedah dan pada

berbagai peringkat untuk mendapatkan bukti keberkesanan pembelajaran dan


pencapaian objektif yang telah dinyatakan.
Maklumat yang diperolehi daripada proses penilaian boleh digunakan untuk
menambahbaik kurikulum berkenaan.
Model Tyler merupakan model yang popular dan banyak digunakan dalam
perkembangan kurikulum kerana;

sistematik dan mudah digunakan. Ianya

melibatkan empat langkah iaitu penetapan objektif, pemilihan kandungan, penentuan


kaedah penyusunan dan penyampaian, dan menentukan kaedah penilaian. Selain
daripada itu model ini dianggap logikal kerana dimulakan dengan penentuan objektif.

CADANGAN PENAMBAHBAIKAN

1-Meningkatkan kualitidankeberkesanankepimpinankurikulumsekolah
Melaluipeningkatankualitidankeberkesananpemimpinkurikulum
di
sekolah,inisecaratidaklangsungakanmembantuinstitusipendidikanberkembangdankur
ikulumdapatdisampaikandengansempurna.
2-Membangunkan sekolahketahapprestasi yang tinggiberasaskanpotensinya
Ahlijawatankuasasentiasabergandingbahudanmengadakankolaborasisertamesyuarat
untukmeningkatkanpotensipengurusankurikulum
di
sekolah.sekolahmempunyaimatlamatdanhalatujuuntukmeningkatkanprestasikurikulu
mpelajar di sekolahrendahterutamanya KHSR.
3-Meningkatkan pencapaiandalampeperiksaanawamdarisegikuantitidankualiti
Peperiksaanawammenjadipenandaarasdalampenyampaiankurikulum
yang
disampaikankepadapelajar.penilaiandarisegikualitidankuantitimenjadipetunjukakanha
latujudankeberkesananpenyampaiankurikulum.
4-Memastikan penguasaankemahiranasasdalamkalanganmuridsekolahrendah.
Kemahiran yang diterapkandalamkurikulum KHSR sepertiaktiviti hands-on
dalamsesuatupenerapanpendidikankurikulum
KHSR
akanmembantupelajarmenguasaiakankemahiran yang diperlukanuntukmasadepan.
Kemahiranasasmerupakankemahiran
yang
terpentingsebelumpelajarmenguasaisesuatukurikulum yang disampaikan.
5- Memperkembangkurikulummengikuthalatujusertaobjektif yang rasional

KHSR
diperkembangkanseiringdenganduniamasakinisertamengikutmatlamatdanhalatuju
yang
relevan.Rasionalakansesebuahkurikulum
KHSR
akanmembantupelajarmendapatakanpenyampaian KHSR yang disampaikanoleh
guru.

REFLEKSI
Assalamualaikumdansalamsejahtera,
syukurkehadratilahikeranadenganberkatsertalimpahanrahmatNYAdapatjugasayamen
yelesaikantugasanberkaitanhuraiansukatanpelajaran

KHSR

(kemahiranhidupsekolahrendah)inidenganjayanya.
Sepanjangmelaksanakantugasaninisayatelahmenemuipelbagaiperkara

yang

amatbergunauntukdijadikanpanduanpadadirisaya

akanbergelarbakal

guru

RBT

yang

yang

kelak.
Sebagaiseorangbakal

guru

berwibawadanberkarismatiksayamestilahmampuuntukmenganalisishuraiansukatanp
elajarankemahiranhidupsekolahrendahbagimemudahkansayamenyampaikanilmu
yang

optimum

kepadaparapelajarsertadapatmenjadikansaya

mempunyaipenguasaansukatanpelajaran

guru

yang
yang

sempurna.Dalammelaksanakantugasanberkaitantajukinovasikurikulumkamahiranhid
upsekolahrendahini,
sayatelahmenemuipelbagaikekuatandankelemahanpadadirisayaantaramasalahawal
yang

timbulialahsemasasayamencarimaklumatberkaitanteori-teoridalamkurikulum,

semasamencarimaklumatberkaitanteori-teoridalamkurikulumadakalanyamaklumat
yang

sayacaritidakbertepatandanadakalanyasukaruntuksayamenganalisisnya.

Namunberkatkesungguhansayadalammelaksanakantugasan

yang

berkesansayaakhirnyaberjayamentafsirmaklumattersebutbagimemastikanianyaberte
patandansentiasamemenuhikriteriasoalan.

sayajugasebeluminitidakpernahmembuatdanmenggubalhuraiansukatanpelajarankem
ahiranhidupdanadakalanyamasalahtimbulkeranamaklumat

yang

dicaritidakbertepatandengankehendaksoalan,
bagimenyelesaikanmasalahinisayatelahbertanyakankepadapensyarahpenasihatsayai
aituDr.Tajulmengenaibagaimanahendakmemulakanproses
penambahbaikanterhadaphuraiansukatanpelajaran yang telahsediaada, berkattunjuk
ajar
dannasihatdaripensyarahpenasihattelahdapatmembantusayamerangkadrafawalbagit
ugasanini.
Padapertengahanmelaksanakantugasaninisayatelahturutmenunjukkanrangkakerjada
nternyataterdapatsedikitkesalahan

yang

dapatdiperbetulkanolehDr.Tajulsendiri.Berkatdaritunjuk

ajar

olehpensyarahpembimbingdandoronganrakanrakanseperjuanganmembuatkansayamampumelaksanakantugasaninihinggaakhirnya
.SayajugaamatberterimakasihkepadapensyarahpenasihatsayaiaituDr.TajulAriffinkera
nabanyakmemberikantunjuk

ajar

yang

bergunadankepadarakan-

rakanseperjuanganterimakasihataskerjasamaandasamadasecaralangsungdantidakla
ngsung.

Sekianterimakasih.

_________________
(HARMIZI BIN MUSA)
REFLEKSI

Alhamdulilah, bersyukur ke hadrat ilahi kerana dengan limpah kurnia-Nya


dapat kami menyiapkan kerja kursus yang diberikan mengikut tempoh yang di
tetapkan. Melalui kerja kursus yang diberikan ini kami telah banyak mempelajari
pelbagai input baharu kepada diri kami sendiri. Sebagai contoh ,kami telah
mempelajari bagaimana untuk berkerjasama dengan baik di dalam kumpulan dan
berkongsi maklumat antara satu sama lain serta menjalankan aktiviti secara
kolaboratif dengan pensyarah pembimbing iaitu Dr Tajul Ariffin Bin Yang Hussin.
Pelbagai input dan ilmu yang saya perolehi dalam menghasilkan tugas ini. Misalnya
menganalisis maklumat dan mencari bahan rujukan yang bersesuaian dengan
tugasan, selain itu saya telah mengaplikasikan bahan-bahan rujukan itu kepada alatalat berfikir iaitu peta minda dan pengurusan grafik.
Namun, terdapat beberapa permasalahan dan kekeliruan berhubung dengan
tugasan yang diberikan. Antara kekeliruan yang kami hadapi ialah mengenai tajuk
tugasan kami. Hal ini kerana terdapat pertembungan antara tajuk tugasan kami
dengan rakan yang lain apabila kami sudah melaksanakan tugasan mengikut tajuk

yang kami terima. Namun semua itu dapat diselesaikan dengan sikap positif yang
harus diamalkan iaitu tolak ansur untuk membina suasana harmoni di dalam
kalangan rakan guru pelatih. Selain itu, kami menghadapi halangan lain iaitu
mengumpul bahan maklumat. Hal ini kerana kami tidak mempunyai bahan-bahan
rujukan yang mencukupi. Akan tetapi segalanya dapat diselesaikan dengan bantuan
pensyarah pembimbing kerana telah memberikan nota-nota yang berkaitan dengan
tugasan esei Inovasi Kurikulum KHSR serta memberikan nasihat dan dorongan bagi
menyiapkan tugasan yang diberikan ini. Selain itu, pensyarah turut memberi tunjuk
ajar dan menyarankan beberapa buah buku yang bersesuaian dengan tajuk tugasan
ini. Selain itu, kesibukan dalam menyiapkan tugasantugasan lain juga sedikit
sebanyak menganggu fokus kami bagi menyiapkan tugasan ini namun kami telah
memberikan komitmen yang sepenuhnya terhadap tugasan ini. Namun, berkat usaha
dan semangat Malaysia boleh!, kami telah lakukan dengan bersungguh-sungguh
dan akhirnya saya berjaya mengatasi segala halangan tersebut. Hal ini kerana
dengan time management yang baik,kami telah menyiapkan semua tugasan yang di
berikan pada masa yang ditetapkan dengan sempurna. Alhamdulillah.
Harapan kami suatu hari nanti dengan maklumat yang diperolehi ini dapat
membantu individu-individu melalui pencarian demi pencarian maklumat yang kami
perolehi dapatlah ilmu yang sedikit ini di kongsikan bersama rakan-rakan serta anak
bangsa kelak untuk lebih meminati pelajaran ini. Harapan kami agar ilmu ini dapat
digunapakai pada generasi akan datang dan mendidik serta mencurahkan ilmu
kepada mereka.

Sekianterimakasih.

___________________________
(MUHAMMAD RIZAM BIN BAKRI)
BIBLIOGRAFI

Ee Ah Meng.(1995). Pendidikan Sebagai Atu Proses. Shah Alam: Fajar Bakti.


Kamaruddin Hj. Husin.(1994). Asa Pendidikan III: Perkembangan dan Perlaksanaan
Kurikulum. Kuala Lumpur: Longman.
Mohamed Nor(1990). Asas-Asas Pendidikan: Satu Pengenalan. Kuala Lumpur: Flo
Enterprise.
Mohd. Daud Hamzah(1995). Perkembangan Kurikulum Sekolah. Kuala Lumpur:
DBP.
Mohd. Daud Hamzah(1995).Penerokaan Teori Kurikulum. Kuala Lumpur: DBP.
Taba. H. (1962). Curriculum Development - Theory & Practise. New York: Harcourt,
Brace and World.
Wiles. J. & Bondi. J.(1989). Curriculum Development: A Guide to Practice. Ohio:
Merrill Publishing Company.