Anda di halaman 1dari 52

TERAPI KOMPLEMENTER (COMPLEMENTERE TERAPHY )

PENDAHULUAN

Manusia adalah makhluk ciptaan Tuhan yang paling sempurna. Setiap insan
dikaruniai oleh Tuhan Yang Maha Esa dengan organ tubuh yang canggih, seimbang dan
teratur serta diberi anugrah pikiran, supaya dapat digunakan untuk menimbang mana sesuatu
yang baik dan mana yang buruk untuk dirinya. Kesehatan adalah proses melalui mana kita
membentuk kembali dasar asumsi dan pandangan dunia tentang kesejahteraan dan melihat
kematian sebagai alami proses kehidupan (Dossey & Keegan, 2008). Ini adalah keadaan
lengkap fisik, mental, kesejahteraan sosial, dan bukan hanya ketiadaan penyakit saja.
Keadaan ini adalah satu di mana individu (perawat, klien, keluarga, kelompok, atau
masyarakat) mengalami rasa kesejahteraan, harmoni, dan kesatuan di mana pengalaman
subjektif tentang kesehatan, keyakinan kesehatan, dan nilai-nilai yang dihormati. Budaya
kerendahan hati ditujukan di mana perawat model nonjudgment, keterlibatan, dan keinginan
untuk memahami dimensi budaya dan kesehatan perawatan. Untuk menjadi budaya rendah
hati adalah untuk menunjukkan rasa hormat dan pemahaman orang lain yang mungkin
memiliki praktik, nilai, dan perspektif yang berbeda dari seseorang sendiri. Ini meliputi
kesediaan dengan budaya sendiri kritik seseorang dan motivasi untuk memahami budaya
orang lain, memberikan perhatian pada kesamaan, perbedaan, dan kekuasaan.
Terapi di keperawatan adalah konsep diri sebagai penyembuh harus dipahami dan
dialami oleh setiap perawat untuk akan pengetahuan dan terampil dalam
pengiriman,arahan,atau konseling,pasien dalam penggunaan berbagai terapi. Hal ini
mencakup pemahaman kesehatan.
Terapi Komplementer ini sudah dikenal secara luas serta telah digunakan sejak dulu
dalam dunia kesehatan. Namun, dalam beberapa survei yang telah dilakukan mengenai
penggunaan terapi komplementer, cakupan terapi komplementer sendiri masih agak terbatas.
Seperti Thomas Friedman (2005) mengatakan; saat ini, dunia kesehatan, termasuk salah
satunya praktisi keperawatan masih bingung tentang apa itu terapi komplementer.
Memperluas pengetahuan tentang perspektif obat pelengkap seperti terapi komplementer,
dilakukan oleh sebagian orang-orang dalam beberapa budaya di dunia yaitu sangat penting
untuk perawatan kesehatan yang kompeten. Dengan demikian sangat penting bagi perawat
profesional kesehatan untuk melakukan penilaian holistik pasien mereka untuk menentukan
arah yang luas dari penyembuhan praktek-praktek yang akan mereka jalankan.
Hal ini berlaku tidak hanya bagi pasien baru, tapi untuk semua pasien. Penggunaan
terapi komplementer / alternatif menjadi lebih kompleks terhadap tingkat pemahaman
pribadi. Dalam masing-masing terapi komplementer, komunikasi penyembuhan sering terjadi
antara perawat dan pasien. Ini adalah aliran bebas dari yang verbal dan nonverbal yaitu
sebagai pertukaran antara dua atau lebih orang. Terapi komplementer adalah salah satu model
terapi yang digunakan perawat dalam melakukan perawatan kepada pasien. Untuk perawat di
seluruh dunia yang menggunakan terapi komplementer kepada pasien dapat memberikan

layanan yang berkualitas holistik. Pelengkap & Alternatif Terapi di keperawatan dapat
menggambarkan bagaimana perawat dapat membantu pasien dalam penyembuhannya.
perawat mengakui bahwa penggunaan terapi komplementer dapat menyebabkan pemahaman
pribadi dan makna yang lebih komplek. Dalam masing-masing terapi komplementer,
komunikasi penyembuhan sering terjadi antara perawat dan pasien. Ini adalah aliran bebas
dari verbal dan nonverbal pertukaran antara dua atau lebih orang dan mungkin juga
memasukkan cerita terkait dengan makhluk yang signifikan, seperti hewan peliharaan, alam,
dan Tuhan atau Life Force di mana makna dan pengalaman dapat menyebabkan saling
memahami dan mengerti. Perawat harus mengintegrasikan kehadirannya. Kehadiran adalah
hal penting dalam penyembuhan dan cara mendekati seorang individu dalam cara saling
menghormati dan menghormati esensi nya. Hal ini berkaitan dengan cara yang
mencerminkan kualitas dan kolaborasi dengan orang lain. Hal ini memungkinkan perawat
untuk masuk ke dalam pengalaman yang mempromosikan potensi penyembuhan dan
pengalaman kesejahteraan pasien. Terapi di Perawatan adalah bahwa konsep diri sebagai
penyembuh harus dipahami dan dialami oleh setiap perawat untuk dia atau dia akan
berpengetahuan dan terampil dalam pengiriman, arahan, atau konseling pasien dalam
penggunaan terapi komplementer atau alternatif. Snyder Mariah adalah Profesor Emeritus di
University of Minnesota School of Nursing. Dia berkarir dalam mengajar kursus pelengkap
terapi, melakukan penelitian tentang penggunaan pelengkap terapi pada penderita demensia,
mengelola stres pada orang dengan penyakit kronis, dan membantu perawat internasional
dalam menggabungkan terapi komplementer dalam praktek dan pendidikan. Snyder adalah
anggota pendiri Pusat Spiritualitas dan Penyembuhan di Pusat Kesehatan Akademik di
University of Minnesota, dan juga merupakan kontributor utama untuk pembangunan
interdisipliner dari yang kecil-kecil yang pertama seperti di Amerika Serikat. Kegiatan ketika
dia pensiun yang dia lakukan adalah menggunakan terapi komplementer pada wanita dengan
kecanduan yang dipenjara. Minat yang kuat dalam terapi penyembuhan efektif dan praktek
dari negara dan budaya di seluruh dunia dalam penyediaan layanan kesehatan. Dunia menjadi
semakin kecil, dengan ini perlu memahami penggunaan terapi CAM dan praktek adat untuk
berbagai budaya dan populasiPerubahan ini dapat berfungsi untuk memperluas dan
memperdalam pemahaman kita tentang dasar dan penggunaan terapi komplementer.
Penggunaan terapi komplementer komplementer ini, manusia menjadi peduli dan
berpengetahuan. Ini adalah keadaan moral di mana perawat membawa pasien ke dalam
hubungan yang signifikan makhluk yang memperkuat makna dan pengalaman kesatuan dan
persatuan. Bekerja dengan pasien untuk memilih dan menerapkan terapi ini adalah hak
istimewa dan tanggung jawab. Hal ini bermanfaat bagi perawat masing-masing, yang
memiliki pengalaman terapi sebelum menggunakannya sehingga dapat mengantisipasi
berbagai emosi yang mungkin terwujud selama dan sesudah sesi. Perawat yang
mengintegrasikan komplementer atau terapi alternatif yang menunjukkan kapasitas
kepemimpinan untuk menginspirasi orang lain untuk bertindak untuk mengubah pelayanan
kesehatan yang dapat menyebabkan orang sehat dan dunia yang sehat (Nightingale Initiative
for Global Health, 2009). Untuk mengubah pelayanan kesehatan untuk memasukkan praktek
yang berpusat pada pasien dan melibatkan perawat dalam hubungan yang memadukan terapi
komplementer atau alternatif . Terapi ini menyebabkan perkembangan penyembuhan
individu, organisasi, dan masyarakat. Mayoritas masyarakat sudah menggunakan terapi ini,

dan permintaan hanya terus berkembang. Hal ini penting bagi perawat untuk memiliki
sumber daya yang tersedia dan memberikan informasi terkini tentang pengobatan
komplementer dan alternatif (CAM). Perawat perlu sumber daya untuk menyediakan pasien
dengan dasar informasi serta jawaban atas pertanyaan mereka tentang CAM terapi, termasuk
pertanyaan tentang keamanan dan kemanjuran. Perawat professional perlu informasi tentang
potensi kontraindikasi untuk terapi ini serta potensi interaksi mereka dengan bersamaan
ditentukan terapi medis konvensional. Kita juga perlu pengetahuan tentang terapi diri kita
sendiri sehingga kita dapat menawarkan pasien sebagai pilihan yang diperluas untuk
kenyamana. Perawat tidak kehilangan kesempatan untuk mempekerjakan terapi yang bisa
menguntungkan pasien yang kesakitan (dapat meringankan) atau mencegah kegelisahan, juga
penting bagi perawat untuk mengidentifikasi terapi yang mungkin disalahgunakan atau
memiliki efek samping pada pengguna. Penggunaan terapi komplementer adalah sebuah
usaha di mana perawat dapat integral terlibat. Banyak perawat telah menyediakan
kepemimpinan dalam penelitian, pendidikan, dan praktek aplikasi terapi ini. Sebagai
permintaan konsumen untuk penggunaan terapi komplementer terus meningkat, sangat
penting bahwa perawat mendapatkan pengetahuan tentang terapi pelengkap, sehingga mereka
dapat memilih dan memasukkan pasien dalam praktek, dan memberikan pasien dengan
informasi tentang terapi, dihubungi tentang penelitian dan praktek pedoman yang berkaitan
dengan pelengkap terapi, pasien waspada terhadap kontraindikasi mungkin dan bahkan
menggabungkan beberapa terapi ini ke perawatan diri mereka.

A.

Definisi terapi komplementer

Menurut Kamus Besar Bahasa Indonesia (KBBI), Terapi adalah usaha untuk
memulihkan kesehatan orang yang sedang sakit; pengobatan penyakit;
perawatan penyakit. Komplementer adalah bersifat melengkapi, bersifat
menyempurnakan.
Menurut WHO (World Health Organization), Pengobatan komplementer adalah
pengobatan non-konvensional yang bukan berasal dari negara yang
bersangkutan, sehingga untuk Indonesia jamu misalnya, bukan termasuk
pengobatan komplementer tetapi merupakan pengobatan tradisional.
Pengobatan tradisional yang dimaksud adalah pengobatan yang sudah dari
zaman dahulu digunakan dan diturunkan secara turun temurun pada suatu
negara. Tetapi di Philipina misalnya, jamu Indonesia bisa dikategorikan sebagai
pengobatan komplementer.
Terapi Komplementer adalah cara Penanggulangan Penyakit yang dilakukan
sebagai pendukung kepada pengobatan medis konvensional atau sebagai
pengobatan pilihan lain diluar pengobatan medis yang Konvensional.
Sesuai dengan Peraturan Menteri Kesehatan definisi pengobatan Komplementer
tradisional-alternatif adalah pengobatan non konvensional yang di tunjukan
untuk meningkatkan derajat kesehatan masyarakat, meliputi upaya
promotiv,preventive,kuratif, dan rehabilitatif yang diperoleh melalui pendidikan

terstruktur dengan kualitas, keamanan, dan evektivitas yang tinggi berandaskan


ilmu pengetahuan biomedik tapi belum diterima dalam kedokteran konvensional.
Dalam penyelenggaraannya harus sinergis dan terintregrasi dengan pelayanan
pengobatan konvensional dengan tenaga pelaksanaanya dokter,dokter gigi, dan
tenaga kesehatan lainnya yang memiliki pendidikan dalam bidang pengobatan
komplementer tradisional-alternatif. Jenis pengobatan komplementer tradisionalalternatif yang daoat diselenggarakan secara sinergis dan terintergrasi harus di
tetapkan oleh menteri kesehatan setelah memalui pengkajian.
Untuk mendukung penyelenggaran pengobatan tersebut Kementrian Kesehatan
telah menerbitkan keputusan menteri kesehatan No. 1076/Menkes/SK/2003
tentang pengobatan tradisional dan peraturan Menteri Kesehatan
No.1109/Menkes/PER/X/2007 tentang penyelenggaraan pengobatan
komplementer alternatif difasilitas kesehatan pelayanan kesehatan, jenis
pengobatan tenaga pelaksana termasuk tenaga asing.

B.

Kegunaan dari terapi komplementer

Para pengidap HIV (Human Immunodeficiency Virus), dengan pemenuhan nutrisi


dan ketenangan spiritual bisa memperpanjang harapan hidup mereka. Terapi
alternatif komplementer, seperti; akupunktur, akupressur, meditasi, dan
mengomsumsi tanaman obat dapat menambah daya tahan tubuh dan
pertumbuhan sel-sel imun. Pernyataan ini pernah dikemukakan oleh Putu Oka
Sukanta, akupunturis sekaligus pembicara dalam talk show yang diadakan
Indonesia HIV Prevention and Care Project (IHPCP) di Indonesia Sehat Expo 2007,
Jakarta Convention Center, Rabu (24/10). Menurut Putu Oka Sukanta, ketenangan
spiritual dan nutrisi peningkat daya tahan membuat virus lebih jinak dan
memperlambat perkembangannya dalam tubuh manusia, sehingga memberi
kesempatan CD4 yaitu sel pembentuk daya tahan tubuh untuk berkembang dan
memperbanyak diri.
Akupunktur dan akupressur diberikan untuk memperkuat organ-organ vital,
seperti; paru-paru, ginjal, lambung, dan limpa, pada masa awal infeksi HIV.
Sebelum daya tahan tubuh dan sel- sel CD4 turun karena infeksi HIV, organ
penting tersebut harus kuat, kata Putu Oka. Untuk penderita HIV, keempat
organ vital tersebut harus dijaga daya tahannya karena memiliki fungsi penting,
seperti paru-paru yang berfungsi mengikat oksigen, lambung untuk mengolah
makanan yang masuk, dan limpa yang berguna untuk menyerap sari-sari
makanan. Dengan akupressur, tambah Putu Oka, titik-titik tubuh yang
berhubungan dengan organ vital tersebut dipijat untuk menguatkan fungsi
organ.
Selain dengan teknik akupressur dan akupunktur, konsumsi tanaman obat juga
membantu penguatan fungsi organ vital. Pegagan misalnya, digunakan untuk
regenerasi sel pembentuk daya tahan tubuh dan juga untuk menguatkan fungsi
ginjal, kata Putu Oka yang juga mengelola Taman Sringanis, pelestari tanaman
obat dan pengembang kesehatan alami. Selain pegagan, tanaman penguat daya

tahan tubuh adalah meniran. Reaksi pertama yang ditunjukkan pengidap HIV
adalah penyangkalan dan stres. Padahal stres merupakan penyebab vital
menurunnya daya tahan tubuh, kata Putu Oka. Untuk mempertahankan
ketenangan batin pengidap HIV, diperlukan suatu metode, seperti meditasi dan
oleh napas untuk membantu penderita menenangkan diri. Teknik olah napas saat
meditasi membantu paru-paru mengikat oksigen. Idong salah satu pasien
pengidap HIV yang telah mengikuti terapi komplementer, mengaku sangat
merasakan manfaat positifnya. Dengan mengikuti meditasi, olah napas, dan
mengonsumsi tanaman obat, CD4 saya selalu di atas 600. Padahal umumnya
penderita HIV hanya memiliki CD4 di bawah 500, kata Idong. Dia mengaku
sampai kini belum mengonsumsi antiretroviral (ARV) karena kadar CD4-nya
belum di bawah 200. ARV sendiri hanya digunakan bagi mereka yang kadar CD4nya di bawah 200. ujarnya.

C.

Strategi dalam menjalankan terapi komplementer

Setiap melakukan tindakan atau rencana, kita sudah barang tentu akan
berhadapan dengan sebuah strategi. Strategi ini akan menentukan arah
perjalanan tindakan atau rencana yang akan kita lakukan. Termasuk salah
satunya adalah bagaimana strategi kita ketika ingin mendirikan terapi
komplementer?.
Strategi merupakan suatu kelompok keputusan, tentang tujuan-tujuan apa yang
akan diupayakan pencapaiannya, tindakan-tindakan apa yang perlu dilakukan,
dan bagaimana memamfaatkan sumber-sumber daya guna mencapai tujuan
tersebut (Jones, et al., 2003:2001)
Konsep strategi merupakan sebuah konsep yang perlu dipahami dan diterapkan
oleh setiap entrepreneur maupun setiap manajer, dalam segala macam bidang
usaha. Sejak beberapa tahun yang lampau, pengertian strategi makin banyak
mendapatkan perhatian dan dibahas dalam literatur dalam menajemen. Aneka
macam artikel bermunculan sehubungan dengan misalnya: strategi asortimen,
produk-strategi, permasalahan strategi, sampai dengan diversifikasi-strategi
bisnis. Di dalam mendirikan terapi komplementer sendiri, kita juga bisa
berlandas pada elemen esensial sebagai berikut:
1.
Tentukan terlebih dahulu tujuan-tujuan dan sasaran-sasaran yang paling
penting yang perlu dicapai.
2. Kebijakan yang paling penting yang mengarahkan atau membatasi kegiatan.
3. Tahapan-tahapan tindakan pokok atau program yang akan mencapai tujuan
yang ditetapkan di dalam batas-batas yang digariskan.

D.

Hal-hal yang dipehatikan dalam menjalankan terapi komplementer

a)
Terapi komplementer termasuk dari CV (Comanditaire
Venootschap)
CV atau Comanditaire Venootschap adalah bentuk usaha yang merupakan salah
satu alternatif yang dapat dipilih oleh para pengusaha yang ingin melakukan
kegiatan usaha dengan modal yang terbatas. Karena, berbeda dengan PT yang
mensyaratkan minimal modal dasar sebesar Rp50.000,- dan harus di setor ke
kasperseroan minimal 25%nya, sedangkan untuk CV tidak ditentukan jumlah
modal minimal. Jadi, misalnya seorang pengusaha ingin berusaha di industri
rumah tangga, percetakan, biro jasa, perdagangan, catering, serta terapi
komplementerdengan modal awal yang tidak terlalu besar, dapat memilih CV
sebagai alternatifbadan usaha yang memadai.
Perbedaan yang mendasar antara PT dan CV adalah, PT merupakan badanhukum
yang dipersamakan kedudukannya dengan orang dan mempunyai kekayaan
yang terpisah dengan kekayaan para pendirinya. Jadi, PT dapat bertindak
keluar,di dalam maupun di muka pengadilan, sebagaimana halnya yang memiliki
harta kekayaan sendiri. Sedangkan CV, dia merupakan badan usaha yang tidak
berbadan hukum, dan kekayaan para pendirinya tidak terpisahkan dari kekayaan
CV.
Karakteristik CV yang tidak dimiliki badan usaha lainnya adalah: CV didirikan
minimal oleh dua orang, dimana salah satunya akan bertindak selaku Persero
Aktif (persero pengurus) yang nantinya akan bergelar Direktur, sedangkan yang
lain akan bertindak selaku Persero Komanditer (Persero diam). Seorang persero
aktif akan bertindak melakukan segala tindakan pengurusan atas Perseroan;
dengan demikian, dalam hal terjadi kerugian maka Persero Aktif akan
bertanggung jawab secara penuh dengan seluruh harta pribadinya untuk
mengganti kerugian yang dituntut oleh pihak ketiga. Sedangkan untuk Persero
Komanditer, karena dia hanya bertindak selaku sleeping partner, maka dia hanya
bertanggung jawab sebesar modal yang disetorkannya ke dalam perseroan.
Perbedaan lain yang cukup penting antara PT dengan CV adalah, dalam
melakukan penyetoran modal pendirian CV, di dalam anggaran dasar tidak
disebutkan pembagiannya seperti halnya PT. Jadi, para persero harus membuat
kesepakatan tersendiri mengenai hal tersebut, atau membuat catatan yang
terpisah. Semua itu karena memang tidak ada pemisahan kekayaan antara CV
dengan kekayaan para perseronya.

b)

Cara mendirikan CV?

CV dapat didirikan dengan syarat dan prosedur yang lebih mudah daripadaPT,
yaitu hanya mensyaratkan pendirian oleh 2 orang, dengan menggunakan akta
Notaris yang berbahasa Indonesia. Walaupun dewasa ini pendirian CV
mengharuskan adanya akta notaris, namun dalam Kitab Undang-Undang Hukum
Dagang dinyatakan bahwa pendirian CV tidak mutlak harus dengan akta Notaris.
Pada saat para pihak sudah sepakat untuk mendirikan CV, maka dapat datang ke
kantor Notaris dengan membawa KTP. Untuk pendirian CV, tidak diperukan
adanya pengecekan nama CV terlebih dahulu. Oleh karena itu proses nya akan
lebih cepat dan mudah dibandingkan dengan pendirian PT. Namun demikian,
dengan tidak didahuluinya dengan pengecekan nama CV, menyebabkan nama
CV sering sama antara satu dengan yang lainnya. Pada waktu pendirian CV, yang
harus dipersiapkan sebelum datang ke Notaris adalah adanya persiapan
mengenai:
1.

Calon nama yang akan digunakan oleh CV tersebut

2.

tempat kedudukan dari CV

3.
Siapa yang akan bertindak selaku Persero aktif, dan siapa yang akan
bertindak selaku persero diam.
4.
Maksud dan tujuan yang spesifik dari CV tersebut (walaupun tentu saja
dapat mencantumkan maksud dan tujuan yang seluas-luasnya). Untuk
menyatakan telah berdirinya suatu CV, sebenarnya cukup hanya dengan akta
Notaris tersebut, namun untuk memperkokoh posisi CV tersebut, sebaiknya CV
tersebut di daftarkan pada Pengadilan Negeri setempat dengan membawa
kelengkapan berupa Surat Keterangan Domisili Perusahaan (SKDP) dan NPWP
atas nama CV yang bersangkutan.
Apakah itu akta, SKDP, NPWP dan pendaftaran pengadilan saja sudah cukup?
Sebenarnya semua itu tergantung pada kebutuhannya. Dalam menjalankan
suatu usaha yang tidak memerlukan tender pada instansi pemerintahan, dan
hanya digunakan sebagai wadah berusaha, maka dengan surat-surat tersebut
saja sudah cukup untuk pendirian suatu CV. Namun, apabila menginginkan ijin
yang lebih lengkap dan akan digunakan untuk keperluan tender, biasanya
dilengkapi dengan surat-surat lainnya yaitu:
1.

Surat Pengukuhan Pengusaha Kena Pajak (PKP)

2.

Surat Ijin Usaha Perdagangan (SIUP)

3.

Tanda Daftar Perseroan (khusus CV)

4.

Keanggotaan pada KADIN Jakarta.

Pengurusan ijin-ijin tersebut dapat dilakukan bersamaan sebagai satu rangkaian


dengan pendirian CV dimaksud, dengan melampirkan berkas tambahan berupa:
1.

Copy kartu keluarga Persero Pengurus (Direktur) CV

2.

Copy NPWP Persero Pengurus (Direktur) CV

3.

Copy bukti pemilikan atau penggunaan tempat usaha, dimana

a.
apabila milik sendiri, harus dibuktikan dengan copy sertifikat dan copy
bukti
b.

pelunasan PBB th terakhir

c.

apabila sewa kepada orang lain, maka harus dibuktikan dengan adanya

d.
perjanjian sewa menyewa, yang dilengkapi dengan pembayaran pajak
sewa oleh pemilik tempat. sebagai catatan berdasarkan SK Gubernur DKI Jakarta,
untuk wilayah Jakarta, yang dapat digunakan sebagai tempat usaha hanyalah
Rumah toko, pasar atau perkantoran. Namun ada daerah-daerah tertentu yang
dapat digunakan sebagai tempat usaha yang tidak membayakan lingkungan,
asalkan mendapat persetujuan dari RT/RW setempat.
4.
Pas photo ukuran 3X4 sebanyak 4 lembar dengan latar belakang warna
merah.

Jangka waktu pengurusan semua ijin-ijin tersebut dari pendirian sampai dengan
selesai lebih kurang selama 2 bulan. Sebagai penutup saya sarankan agar dalam
mendirikan suatu bidang usaha, alangkah baiknya untuk dipertimbangkan dari
segala segi, tidak hanya dari segi kepraktisannya, namun juga dari segi
pembagian resiko di antara para persero, agar tidak terjadi pertentangan di
kemudian hari.
Pelengkap terapi komplementer sering diberikan dalam konteks terapi lain. Hal
ini membuat kita sulit untuk membedakan efek dari terapi komplementer dari
orang-orang terhadap terapi lain yang diberikan secara bersamaan, sedangkan
bedah termasuk efek dari penyakit lainnya secara proses dan perawatannya.
Terapi komplementer mungkin memiliki efek langsung dan efek tidak langsung
serta efek bermanfaat dan merugikan. Dan ini harus ditentukan melalui
pengamatan sistematis dan penelitian.Walaupun mekanisme tindakan sudah
banyak dilakukan, namun terapi komplemnter masih tetap sulit dipahami. Sulit
untuk dimengerti efeknya tanpa melakukan framing terapi, baik di dalam budaya
ataupun praktek tradisi penyembuhan. Begitu juga dengan syarat serta hasil
yang mampu dicapai di seluruh budaya mungkin tidak sama, sehingga hambatan
untuk transglobalkomunikasi dan belajar dari pengalaman dan didukung bukti
dasar. Sekedar mengetahui bahwa terapi bermanfaat, tidak cukup. Pertanyaan
yang harus dijawab, misalnya: Kondisi dimana atau seperti apa yang membuat
terapi komplementer efektif dilakukan? Apakah saja dosis-dosis yang
dibutuhkan? Seberapa sering terapi harus diberikan untuk mencapai manfaat?
Berapa lama efeknya? Berapa banyak asuransi terapi yang mencakup?
Kebutuhan studi pada efektivitas-biaya terapi komplementer dan untuk
penelitian yang membandingkan secara kontras tentang terapi komplementer

dengan terapi konvensional lainnya (IOM, 2002). Pertimbangan Budaya Studi


terapi relevan dengan penuaan populasi, populasi bervariasi tahap
perkembangan, dan mereka yang memiliki latar belakang budaya yang beragam
juga diperlukan. Populasi ini memberikan tantangan untuk desain, perekrutan,
dan pelaksanaan studi. Subyek Lansia sering memiliki berbagai komorbiditas dan
dapat mengambil beberapa obat. Bahasa dan kurangnya pemahaman budaya
dapat menimbulkan hambatan bagi masuknya imigran baru. Akses ke anakanak, remaja, orang dewasa yang rentan, dan isu-isu etis yang unik seputar
perekrutan dan partisipasi mereka juga dapat dianggap sebagai hambatan bagi
masuknya kelompok ini. Ada hasil lain yang ingin dicapai oleh konsumen
perawatan kesehatan yaitu terapi ditampilkan memiliki efek kesehatan yang
menguntungkan serta bukanlah satu-satunya alasan yang sah untuk
penggunaannya. Imigran cenderung menggunakan terapi komplementer yang
pertama saja dan kemudian mencari bantuan medis konvensional jika ini tidak
efektif (Garce's, Scarinici, & Harrison, 2006).
Terapi komplementer mungkin memiliki signifikansi budaya atau kondisi terikat
dengan tradisi penyembuhan; terapi dapat menyebabkan perdamaian pikiran
pasien. Jika mereka dari negara-negara lain datang ke Amerika Serikat, budaya
kepercayaan dalam pengobatan terapi komplementer tidak berubah. Dalam
mempertimbangkan penggunaan terapi komplementer, biaya, risiko, dan nilai
untuk penerimaanya merupakan permasalahan esensial yang harus diperhatikan
terlebih dahulu.

E.
a.

Syarat-syarat dalam mendirikan terapi komplementer


Dasar Hukum

Pemerintah telah menerbitkan Peraturan Menteri Kesehatan RI Nomor 1109


Tahun 2007 tentang penyelenggaraan pengobatan komplementer-alternatif di
fasilitas pelayanan kesehatan. Menurut aturan itu, pelayanan komplementeralternatif dapat dilaksanakan secara sinergi, terintegrasi, dan mandiri di fasilitas
pelayanan kesehatan. Pengobatan itu harus aman, bermanfaat, bermutu, dan
dikaji institusi berwenang sesuai dengan ketentuan berlaku.
Permenkes RI No 1186/Menkes/Per/XI/1996 diatur tentang pemanfaatan
akupunktur di sarana pelayanan kesehatan. Di dalam salah satu pasal dari
Permenkes tersebut menyebutkan bahwa pengobatan tradisional akupunktur
dapat dilaksanakan dan diterapkan pada sarana pelayanan kesehatan sebagai
pengobatan alternatif di samping pelayanan kesehatan pada umumnya. Di
dalam pasal lain disebutkan bahwa pengobatan tradisional akupunktur dapat
dilakukan oleh tenaga kesehatan yang memiliki keahlian/keterampilan di bidang
akupunktur atau oleh tenaga lain yang telah memperoleh pendidikan dan
pelatihan akupunktur. Sementara pendidikan dan pelatihan akupunktur dilakukan
sesuai dengan ketentuan perundangan yang berlaku.

Sementara itu, Keputusan Menkes RI No 1076/Menkes/SK/VII/2003 mengatur


tentang penyelenggaraan Pengobatan Tradisional. Di dalam peraturan tersebut
diuraikan cara- cara mendapatkan izin praktek pengobatan tradisional beserta
syarat- syaratnya. Khusus untuk obat herbal, pemerintah mengeluarkan
Keputusan Menkes RI Nomor 121 Tahun 2008 tentang Standar Pelayanan Medik
Herbal. Untuk terapi SPA (Solus Per Aqua) atau dalam bahasa Indonesia sering
diartikan sebagai terapi Sehat Pakai Air, diatur dalam Permenkes RI No. 1205/
Menkes/Per/X/2004 tentang pedoman persyaratan kesehatan pelayanan Sehat
Pakai Air (SPA).
b.

Konsep Keilmuan

Terapi komplementer bertujuan untuk memperbaiki fungsi dari sistem-sistem


tubuh, terutama sistem kekebalan dan pertahanan tubuh, agar tubuh dapat
menyembuhkan dirinya sendiri yang sedang sakit, karena tubuh kita sebenarnya
mempunyai kemampuan untuk menyembuhkan dirinya sendiri, asalkan kita mau
mendengarkannya dan memberikan respon dengan asupan nutrisi yang baik dan
lengkap serta perawatan yang tepat. Ada banyak jenis metode dalam terapi
komplementer ini, seperti akupuntur, chiropractic, pijat refleksi, yoga, tanaman
obat/ herbal, homeopati, naturopati, terapi polaritas atau reiki, teknik-teknik
relaksasi, termasuk hipnoterapi, meditasi, visualisasi, dan sebagainya. Obatobat yang digunakan bersifat natural/ mengambil bahan dari alam, seperti jamujamuan, rempah yang sudah dikenal (jahe, kunyit, temu lawak dan sebagainya),
sampai bahan yang dirahasiakan. Pendekatan lain seperti menggunakan energi
tertentu yang mampu mempercepat proses penyembuhan, hingga
menggunakan doa tertentu yang diyakini secara spiritual memiliki kekuatan
penyembuhan.
Terapi komplementer relatif aman karena menggunakan cara- cara alami yang
jauh dari bahan- bahan kimia yang jelas-jalas banyak memberikan efek samping
pemakainya. Namun, walaupun alami tetap harus dikaji dan diteliti tingkat
keefektifan dan keamanannya. Memang penelitian tentang terapi komplementer
masih jarang, dikarenakan belum memiliki standar yang baku. Terapi ini tidak
selalu dirancang untuk mengobati penyakit tertentu, beberapa terapi alternatif
merawat orang secara keseluruhan, bukan suatu penyakit tertentu. Terapi ini
mungkin dapat mengembalikan keselarasan, keseimbangan, atau menormalkan
aliran energi. Penelitian ilmiah sangat mahal biayanya. Pembuat terapi alternatif
seringkali tidak mampu membayar untuk sebuah penelitian ilmiah. Pemerintah
lebih cenderung untuk mendanai penelitian obat-obatan barat karena dipandang
lebih efektif. Dengan hak paten, para produsen dapat memperoleh keuntungan
yang membantu mendanai penelitian. Sedangkan kebanyakan terapi
komplementer tidak dapat dipatenkan. Namun halangan-halangan ini bukan
berarti tidak ada terapi komplementer yang secara sukses diteliti, beberapa
terapi telah teruji dan terbukti kemanjurannya.

LITERATUR

http://www.odhaindonesia.org/trackback/25
http://www.kompas.com/kompas-cetak/0710/25/humaniora/3940886.htm
file:///E:/Terapi%20Komplementer.htm
http://www.kompas.com/kompas-cetak/0701/25/humaniora/3266911.htm
Sumber: http://irmadevita.com/2007/prosedur-cara-dan-syarat-pendirian-cv

TERAPI KOMPLEMENTER
Posted by I Gusti Ngurah Putu Jaya Antara on0

A. PENDAHULUAN
1.

Penggunaan
Pengobatan konvensional berubah dan Terapi Kesehatan Alternatif yang sedang
diperkenalkan dan digunakan, pengobatan baru yang dianggap menggabungkan obat
utama denganPengobatan alternatif dalam hal penyembuhan. Teknik-teknik penyembuhan
yang obat konvensional tidak miliki dalam terapi alternative, beberapa diantaranya adalah :
diet mode, pijat, terapi musik, iman kesembuhan, obat rakyat, naturopati, homeopati,
penyembuhan chiropractic, terapi magnet, terapi herbal, dan lain-lain. Kita bisa mendapatkan
rasa kontrol atas kesehatan kita melalui terapi kesehatan alternatif yang meningkatkan
kualitas umum kehidupan dengan membuat kita merasa lebih baik tentang diri kita.
Seseorang merasa lebih tenang bila tekanan, stres, insomnia, gugup dan putus asa berkurang.
Mereka mengurangi beberapa efek samping yang biasanya melihat dalam
pengobatan Kanker yang biasa dan juga membantu dalam mengurangi beberapa gejala seperti
miskin, kelelahan nafsu makan, rasa sakit, penyakit, sembelit diare, dan sesak napas.
Sering digunakan bersama dengan obat konvensional, terapi alternatif dapat
cenderung untuk menutupi rasa sakit yang mungkin menyembunyikan masalah mendasar
yang sebenarnya sangat serius. Saat ini ada kelompok pendukung kanker dan lain-lain yang
menawarkan gratis atau dengan biaya yang sangat rendah, terapi alternatif, beberapa
penampungan dan rumah sakit mulai menyediakan terapi alternatif untuk perawatan kanker,
bersama dengan pengobatan konvensional radioterapi dan kemoterapi untuk kanker. Terapi
ini sekarang digunakan oleh banyak kanker pasien untuk mendukung diri mereka sendiri
dalam perjuangan mereka melawan kanker. Namun, terapi kesehatan alternatif tidak harus
dilihat sebagai alternatif yang akan digunakan sebagai pengganti obat-obatan ortodoks, tetapi
harus digunakan sebagai dukungan yang sangat berharga yang mengakui aspek-aspek
spiritual dan emosional dan aspek fisik.
Ada
peningkatan
dalam
penggunaan
produk-produk
kesehatan
alternatif, Amerikamenggunakan banyak bumbu dan vitamin serta menghabiskan sekitar
milyaran produk-produk kesehatan alternative setiap tahunnya. Dalam penelitian yang
dilakukan oleh Davis, Eisenberg, Phillips dan Tindle pada 2005 ditetapkan bahwa terapi
komplementer dan alternatif yang digunakan oleh sekitar 72 juta orang di Amerika, juga
diindikasikan dari studi ini bahwa lebih dari miliaran orang per tahun dihabiskan untuk
keluar-saku-untuk terapi ini menurut Herman, Craig, &Caspi, 2005. Dalam masyarakat saat
ini, pengobatan komplementer sudah mulai diterima karena terapi alternatif membantu
mereka mengatasi dan mengelola efek pengobatan konvensional dengan mengurangi

perasaan cemas dan persaan mereka yang dapat dikontrol kembali dari kehidupan mereka
sendiri.
2. Proses
a. Penyembuhan dengan transfer energi dan pemindahan penyakit ke suatu media.
b. Terapi ketuk berbasis hypnosis, khusus untuk mengatasi masalah-masalah yang berhubungan
dengan penyakit psikis seperti : stres, cemas, phobia, perilaku/kebiasaan buruk, emosional
dan sejenisnya. Terapi ketuk juga bisa dilakukan dari jarak jauh.
c.

Tehnik penyembuhan diri sendiri (self healing) dengan yoga jari yang bisa dilakukan kapan
saja dan dimana saja dan sangat mudah dengan hasil positif yang telah teruji.

d. Tehnik penyembuhan diri sendiri (self healing) dengan metode senam tunggal penyembuh
penyakit dengan cara yang sederhana namun telah teruji menyembuhkan berbagai penyakit
medis dan non medis.
e.

Penyembuhan dengan audio healing. Anda juga akan mendapatkan gratis audio-audio yang
dapat membantu menyembuhkan penyakit pasien. Beberapa contoh audio healing misalnya
penyembuhan segala penyakit, reparasi DNA, autis/adhd, kecanduan narkoba, kanker,
insomnia dll.
3. Dampak
Terapi memiliki dampak positif dan negatif. Adapun beberapa dampak positif dari
terapi, yaitu :
1.
Mengurangi rasa nyeri, contohnya terapi pijat untuk orang yang mengalami keseleo atau
salah urat.
2.
Meningkatkan daya tahan tubuh, contohnya akupuntur, terapi pijat.
3.
Produksi hormon dapat dikendalikan, contohnya akupuntur, terapi gelombang otak.
4.
Membuat kulit dan selaput lendir menjadi lebih peka terhadap rangsang
5.
Melancarkan sirkulasi darah, contohnya terapi magnet, akupuntur, acupressure, massage
therapy.
6.
Otot yang kaku dapat terelaksasi sempurna, contohnya akupuntur, terapi pijat, dll.
7.
Mengobati penyakit, contohnya terapi radiasi, terapi magnet, terapi herbal, dll.
8.
Membuat penampilan orang lebih menarik, contohnya akupuntur kecantikan yang dapat
mnurunkan ataupun menaikkan berat badan.
9.
Mengurngi stress dan cemas, contohnya massage therapy dengan aroma terapi.
10. Menambah tinggi badan, contohnya terapi gelombang otak.
Sementara itu, dampak negative dari terapi, diantaranya :
1.
Beberapa terapi ada yang dapat menimbulkan rasa sakit ,seperti terapi pijat. Ada beberapa
orang sehari setelah dipijat merasakan nyeri pada tubuhnya.
2.
Dapat menimbulkan alergi tertentu. Contohnya, pada penggunaan minyak dalam terapi pijat,
beberapa orang memiliki sensitivitas tinggi terhadap kandungan dalam minyak tersebut
sehingga dampak alergi, seperti gatal dan bercak-bercak merah.
3.
Cenderung memerlukan waktu yang cukup lama dalam penggunaanya untuk menyembuhkan
suatu penyakit tertentu. Contohnya terapi radiasi dalam penyembuhan kanker tidak bias
dilakukan dalam satu kali pelaksanaan namun perlu adanya tahapan-tahapan lebih lanjut.
4.
Beberapa terapi terkadang menimbulkan efek samping yang merusak salah satu bagian
tubuh. Contohnya, terapi radiasi pada penderita kanker yang menyebabkan rontoknya rambut
dan adanya resiko terjadinya kanker kulit.
5.
Dapat mengganggu proses metabolisme tubuh. Contohnya, pasien setelah menjalani terapi
radiasi mengalami gangguan tidur dan berkurangnya nafsu makan.

B. KONSEP TEORI
1.

Pengertian
Terapi (dalam Yunani: ),
atau pengobatan,
adalah
remediasi
masalah kesehatan, biasanya mengikuti diagnosis. Orang yang melakukan terapi disebut
sebagai terapis. Dalam bidang medis, kata terapi sinonim dengan kata pengobatan. Di antara
psikolog,
kata
ini
mengacu
kepada psikoterapi. Terapi
pencegahan atau terapi Profilaksis adalah pengobatan yang dimaksudkan untuk mencegah
munculnya
kondisi
medis.
Sebagai
contoh
adalah
banyaknyavaksin untuk
mencegah infeksi penyakit. Terapi abortive adalah pengobatan yang dimaksudkan untuk
menghentikan kondisi medis dari perkembangan lebih lanjut. Pengobatan yang dilakukan
pada tanda-tanda paling awal dari munculnya penyakit, seperti gejala sakit kepala migrain,
adalah sebuah terapi abortive. Terapi supportive adalah suatu terapi yang tidak merawat atau
memperbaiki kondisi yang mendasarinya, melainkan meningkatkan kenyamanan pasien.
Terapi merupakan kaedah untuk membantu seseorang pelajar untukbergerak balas
terhadap aktiviti atau kemahiran. Menurut kamus perubatan Mosby (2001) terapi
didefinisikan dengan rawatan pemulihan ke atas pesakit yang pernah menghidapi sebarang
penyakit atau mengalami sesuatu kecederaan bertujuan mengembalikan kefungsian badan
secara normal.Definisi terapi dalam konteks pendidikan ialah kaedah untuk membantu
seseorang murid untuk bergerak-balas terhadap sesuatu aktiviti atau kemahiran.

2.

Konsep
Konsep terapi dalam pendidikan khas adalah didasari dari konsep kepelbagaian
kategori individu berkeperluan khas. Murid-murid berkeperluan khas mempunyai sama ada
ketidakupayaan, kecacatan halangan atau rintangan untuk mencapai perkembangan dari segi
kognitif, emosi, sosial atau psikomotor. Sehubungan itu, kaedah terapi dapat membantu
murid-murid bermasalah pembelajaran mencapai perkembangan yang tersebut di atas.
Terapi dalam pendidikan khas adalah salah satu kaedah yang digunakan dalam
pengajaran dan pembelajaran di sekolah. Aktiviti-aktiviti dalam terapi dapat membantu murid
menguasai sesuatu kemahiran dari satu peringkat ke satu peringkat yang lebih tinggi.

Efek terapi (dampak positif) yang diinginkan dari sebuah pengobatan, terapis juga
dapat menyebabkan dampak negatif yang tidak diharapkan. Ketika dampak negatif yang
ditimbulkan lebih kecil/lemah dari dampak positifnya, maka hal itu sering disebut
sebagai Efek samping. Efek samping merupakan hasil dari dosis atau prosedur yang tidak
tepat (yang biasanya disebabkan oleh kesalahan medis). Beberapa efek samping hanya
muncul pada awal/permulaan perawatan, ketika peningkatan dan penghentian perawatan.
Penggunaan obat atau intervensi medis lainnya yang merupakan kontraindikasi dapat
meningkatkan risiko efek samping. Beberapa pasien terkadang menghentikan terapi karena
efek samping yang ditimbulkannya. Tingkat keparahan dari efek samping ini bervariasi,
mulai dari rasa mual hingga dapat mengakibatkan kematian. Efek samping yang umum
terjadi
di
antaranya
perubahan
berat
badan,
perubahan
tingkat enzim,
perubahan patologis yang terdeteksi pada level mikroskopis, makroskopis, atau psikologis.
Efek samping dapat menyebabkan perubahan yang dapat dipulihkan kembali maupun
permanen, termasuk peningkatan atau penurunan kerentanan individu terhadap obat /
bahan kimia, makanan, atau prosedur tertentu (misalnya interaksi terhadap obat).

3. Indikasi
1.
2.
3.
4.

5.
6.
7.

Berbagai keadaan nyeri seperti nyeri kepala, migren, nyeri bahu, nyeri lambung, nyeri sendi dan lain-lain
Kelainan fungsional seperti asma, alergi, insomnia, mual pada kehamilan
Beberapa kelainan saraf seperti hemiparesis, kesemutan, kelumpuhan muka.
Berbagai keadaan lain seperti mengurangi nafsu makan, menurunkan kadar gula darah,meningkatkan stamina,
efek analgesi pada operasi dan lain-lain

Klien Psikotik seperti kecemasan, panik, depresi ringan


Klien yang mengalami stress dalam kehidupan penyakit / kematian.
Klien dengan gangguan keluarga, ketergantungan, dan sejenisnya
4. Kontra Indikasi
1. Kontraindikasi absolut pada penderita hemofilia.
2. Kontraindikasi dapat timbul pada pasien yang baru saja menerima, sedang diberi, ataupun selesai mengalami
pengobatan dengan antikoagulan. Dalam kondisi ini dapat dilakukan hanya setelah rehat dari pengeobatan jenis
ini setidaknya dua minggu.

3.
4.
5.
6.
7.
8.

Waham
Depresi berat
Sosio / Psikopat
Sedang menjalani terapi lain
Tidak ada harapan sembuh
Pembosan

C. STANDAR OPERASIONAL PROSEDUR

Standar Operasional Prosedur dari terapi adalah


1. Klien datang secara langsung bertemu dengan terapis
2. Dilakukan Observasi Wawancara untuk mengetahui secara luas dan mendalam keadaan /
masalah klien
3. Ditetapkan jenis terapi yang cocok untuk masalah yang diderita, berupa Konseling, dan
Intervensi pikiran bawah sadar (hypnose).
4. Ditetapkan jadwal terapi, jumlah pertemuan yang disepakati bersama antara Klien dan
Terapis.
5. Persiapan diri terapis :
1) Cuci tangan
2) Memakai alat perlindungan diri
6. Persiapan alat-alat sesuai dengan terapi yang akan dilakukan
7. Persiapan pasien sesuai dengan terapi yang akan dilakukan
8. Persiapan lingkungan
9. Dilanjutkan dengan terapi yang akan dilakukan
10. Sesudah terapi ajari latihan-latihan yang perlu dilakukan secara mandiri untuk mempercepat
penyembuhan.
Catatan :

Arahkan klien untuk mandiri dan sembuh dari masalahnya.

Klien dibuatkan disk yang berisi Terapi yang dapat didengarkan untuk mempercepat dan
memperkuat efek penyembuhan.

terapi komplementer
DISUSUN OLEH IBU AMBAR, STIKES LINTAS JALUR KENDAL

TERAPI KOMPLEMENTER

I.

PENGERTIAN

Terapi Komplementer adalah cara penanggulangan penyakit yang dilakukan


sebagai pendukung kepada pengobatan medis konvensional atau sebagai
pengobatan pilihan lain diluar pengobatan medis yang konvensional.
Terapi Komplementer adalah semua terapi yang digunakan sebagai tambahan
untuk terapi konvesional yang direkomendasikan oleh penyelenggara pelayanan
kesehatan induvidu.
Pengobatan Komplementer adalah pengobatan non konvensional yang bukan
berasal dari Negara yang bersangkutan (WHO).

II. TUJUAN
Sebagai pengobatan pilihan lain diluar pengobatan medis.
Untuk memperbaiki fungsi dari system system tubuh, terutama system
kekebalan dan pertahanan tubuh.
Lebih berserah diri dan ikhlas menerima keadaan.

III. MACAM MACAN TERAPI KOMPLEMENTER


1.

System medis Alternatif

a.

Akupuntur

Suatu metode tradisional Cina yang menghasilkan analgesia atau perubahan


fungsi system tubuh dengan cara memasukan jarum tipis sepanjang rangkaian
garis atau jalur yang disebut meredian. Manipulasi jarum langsung pada
meridian energi akan mempengaruhi organ internal dalam dengan pengalihan qi
b.

Ayurveda

System pengobatan tradisional Hindu yang memkombinasikan obat herbal, obat


pencahar dan minyak gosok.
c.

Pengobatan Homeopatic

System mengobatan medis yang didasari pada teori bahwa penyakit tertentu
dapat diobati dengan memberikan dosis kecil substansi yang ada pada individu
sehat akan menghasilkan gejala seperti penyakit.
d.

Pengobatan Naturopatik

System pengobatan didasari pada makanan alami, cahaya, kehangatan, pijatan


air segar, olah raga teratur dan menghindari pengobatan, mengenali
kemampuan mnyembuhkan tubuh alami.
e.

Pengobatan Tradisional Cina

Kumpulan tehnik dan metode sistematik termasuk akupuntur, pengobatan


herbal, pijatan, akupreser, moxibustion (menggunakan panas dari herbal yang
dibakar), qigong (menyeimbangkan aliran energi melalui gerakan tubuh).

2.

Terapi Biologis

Menggunakan substansi alam seperti herbal, makanan dan vitamin.


a.

Zona

Progam diet yang memerlukan makanan berprotein, karbohidrat dan lemak


dengan perbandingan 30:40:30.
Digunakan untuk menyeimbangkan insulin dan hormone lain untuk kesehatan
yang optimal.
b.

Diet Mikrobiotik

Diutamakan diet vegetarian.


c.

Pengobatan Ortomolekuler

Meningkatkan nutrisi seperti vitamin c dan bertakoren.

3.

Menipulasi Dan Metode Didasari Tubuh

Didasari pada manipulasi dari atau penggerakan dari satu atau lebih bagian
tubuh.
a.

Akupresur

Tehnik terapetik mempergunakan tekanan digital dalam cara tertentu pada titik
yang dibuat pada tubuh untuk mengurangi rasa nyeri menghasilkan analgesic
atau mengatur fungsi tubuh.
b.

Pengobatan Kiropratik

System terapi yang melibatkan manipulasi kolumna spinalis dan memasukan


fisiotherapy dan terapi cliet.
c.

Metode Feldenkrais

Terapi alternatif yang didasarkan pada citra tubuh yang baik melalui perbaikan
pergerakan tubuh.
d.

Tai chi

Terapi alternatif yang menghubungkan pernafasan, pergerakan dan meditasi


untuk membersihkan, memperkuat dan sirkulasi energi dan darah kehidupan
yang penting.
e.

Terapi Pijat

Manipulasi jaringan ikat melalui pukulan, gosokan atau meremas untuk


meningkatkan sirkulasi, memperbaiki sifat otot dan relaxsi.
f.

Sentuhan Ringan

Sentuhan pada klien dengan cara yang tepat dan halus untuk membuat
hubungan menunjukkan penerimaan dan memberikan penghargaan.
4.

Intervensi tubuh dan pikiran

Menggunakan berbagai tehnik yang di buat untuk meningkatkan kapasitas


pikiran untuk mempengaruhi tubuh.
a.

Terapi Seni

Menggunakan seni untuk mendamaikan konflik emosional, meningkatkan


kewaspadaan diri dan mengungkapkan masalah yang tidak di katakan dan
didasari klien penyakit mereka.
b.

Umpan balik biologis

Suatu proses yang memberikan individu dengan informasi visual dan suara
tentang fungsi fisiologis otonomi tubuh.

5.

Intervensi tubuh-pikiran

Menggunakan berbagai tehnik yng dibuat untuk meningkatkan kapasitas pikiran


guna mempengaruhi fungsi dan gejala tubuh.
a.

Terapi Dansa

Sarana memperdalam dan memperkuat terapi karena merupakan ekspresi


langsung dari pikiran dan tubuh.
b.

Terapi Pernafasan

Menggunakan segala jenis pola pernafasan untuk merelaxasi, memperkuat atau


membuka jalur emosional.
c.

Imajinasi Terbimbing

Tehnik terapiutik untuk mengobati kondisi patologis dengan berkonsentrasi pada


imajinasi atau serangkaian gambar.
d.

Meditasi

Praktik yang ditujukan pada diri untuk merelaxasi tubuh dan menenangkan
pikiran menggunakan ritme pernafasan yang berfokus.
e.

Terapi Musik

Menggunakan music untuk menunjukkan kebutuhan fisik, psikologis, kogniti dan


sosial individu yang menderita cacat dan peny.
f.

Usaha Pemulihan (doa)

Berbagai tehnik yang menggunakan dalam banyak budaya yang


menggabungkan pelayanan, kesabaran, cinta atau empati dengan target doa.
g.

Psikoterapi

Pengobatan kelainan mental dan emosional dengan tehnik psikologi


h.

Yoga

Tehnik yang befokus pada susunan otot, postur, mekanisme pernafasan dan
kesadaran tubuh.

6.

Terapi Energi

Melibatkan penggunaan medan energi


a.

Terapi Reiki

Terapi yang berasal dari praktik budha kuno di mana praktisi menempatkan
tangannya pada atau diatas bagian tubuh dan memindahkan keharmonisan dan
keseimbangan untuk mengobati gangguan kesehatan.
b.

Sentuhan terapiutik

Pengobatan melibatkan pedoman keseimbangan energi atau praktisi dalam


suatu cara yang disengaja tidak semua pasien.

IV. EFEK SAMPING TERAPI KOMPLEMENTER


Pada terapi akupuntur dapat terjadi komplikasi seperti infeksi karena sterilesasi
jarum yang tidak adekuat atau jarum yang ditinggalkan dalam tempat untuk
waktu yang lama, jarum yang patah, perasaan mengantuk pasca pengobatan.
Kontraindikasi pengobatan pada individu yang memiliki kelainan perdarahan
trombositopeni, infeksi kulit atau yang memiliki ketakutan terhadap jarum.
Kontaminasi dengan herbal atau bahan kimia lain termasuk pestisida dan logam
berat juga terjadi, tidak semua perusahaan menjalankan pengawasan kualitas
yang ketat dan garis pedoman pabrik yang menentukan standar untuk kadar
pestisida yang dapat diterima, bahan pelarut sisa tingkat bacterial dan logam
berat untuk alasan ini pembelian obat herbal hanya dari pabrik yang mempunyai
reputasi. Label pada produk herbal harus mengandung nama ilmiah tanaman
nama dan alat pabrik yang sebenarnya, tanggal kemasan dan tanggal
kadaluarsa.
Di Indonesia ada 3 jenis tehnik pengobatan komplementer yang telah di
terapkan oleh Derpartemen Kesehatan untuk di Integrasikan ke dalam pelayanan
konvensional yaitu:
1.

Akupuntur Hiperbarik

Dilakukan oleh dokter umum berdasarkan kompetensinya.


2.

Terapi Hiperbarik

Yaitu suatu metode terapi dimana pasien di masukan ke dalam sebuah ruangan
yang memiliki tekanan udara atmosfir normal, lalu di beri pernafasan oksigen
murni (100%)
3.

Terapi herbal medic

Yaitu terapi dengan menggunakan obat bahan alami baik berupa herbal
terstandar dalam kegiatan pelanyanan penelitian maupun berupa fitofarmaka.

DASAR HUKUM
1.
Peraturan Menteri kesehatan RI nomor 1109 tahun 2007 tentang
penyelenggaraan pengobatan komplementer-alternatif pelayanan kesehatan.
2.
Permenkes RI no 1186 / Menkes / per / XI / 1996 tentang pemanfaatan
akupuntur di sarana pelayanan kesehatan.
3.
Keputusan Menteri Kesehatan RI no 1076 / Menkes / SK / VII / 2003
tentang penyelenggaraan pengobatan tradisional.
4.
Keputusan Menteri Kesehatan RI no 121 tahun 2008 tentang standar
pelayanan Medik Herbal.

PENERAPAN DALAM PRATIK KEPERAWATAN


Keperawatan holistic menghormati serta mengobati jiwa, tubuh dan
pikiran klien, perawatan menggunakan Intervensi Keperawatan holistic seperti
terapi relaxasi, terapi music, sentuhan ringan dan usaha pemulihan (doa).
Intervensi seperti ini mempengaruhi Individu secara keseluruhan (jiwa, tubuh,
pikiran) dan merupakan pelengkap yang bersifat efektif ekonomis, non, invasive
serta non farmakologis untuk pelayanan medis terapi tersebut di susun dalam 2
tipe:
1.

Terapi yang dapat diakses keperawatan.

Di mana seorang perawat dapat mulai mempelajari dan mempergunakanya


dalam pelayanan klien.
2.

Terapi latihan spesifik

Di mana seorang perawat tidak dapat melakukan tanpa pelatihan tambahan dan
atau sertifikat.

1.

TERAPI YANG DAPAT DIAKSES KEPERAWATAN

Relaksasi
Tujuan : agar individu mampu memonitor dirinya secara terus menerus terhadap
indicator ketegangan serta untuk membiarkan, melepaskan dengan sadar
ketegangan yang terdapat di bebagai tubuh.
Macam relaxsasi:
a.

Relaksasi progresif

Mengajarkan individu bagaimana beristirahat dengan efektif dan mengurangi


ketegangan pada tubuh.

b.

Relaksasi pasif

Mengajarkan individu untuk merelaksasikan sekelompok otot secara pasif.


Cara terapi relaksasi :
a.

Meditasi dan pernafasan berirama


Menyediakan lingkungan yang tenang.

Membantu klien untuk mendapatkan kenyamanan saat sedang duduk atau


berbaring,minta klien untuk tetap diam sebisa mungkin dan bergerak jika perlu
agar tetap merasa nyaman.

Menginstruksikan klien untuk bernafas kedalam dan keluar secara


perlahan dan dalam menggunakan otot perut.

Pada awal setiap mengeluarkan nafas,minta klien untuk menyebut angka


satu dalam pikirannya,lanjutkan ketahap meditasi.

Menjelaskan ketika pikiran mengembara,bawa kembali untuk memulai


mengeluarkan nafas dalam tanpa pertimbangan.

Minta klien melakukan setiap jenis latihan selama 5,10,15 dan 20 menit

Lakukan setiap hari untuk minimal satu jenis latihan.

b.

Relaksasi dan progesif


Menyediakan linkungan yang tenang

Membantu klie untuk mendapatkan kenyamanan saat sedang duduk atau


berbaring, meminta klien untuk tetap diam sebisa mungkin dan bergerak jika
perlu agar tetap merasa nyaman.

Mengintrusikan klien untuk menutup mata dan mempertahankan sikap


mau menerima.

Menginstuksikan untuk bernafas dalam dan keluar secara perlahan dan


dalam menggunakan otot otot patu paru

Saat klien bernafas secara perlahan dan nyaman, instrukasikanb klien


untuk merelaksasikan dan meregangkan otot sesuai urutan yang di perintahkan,
menengankan dan merelasaksikan serta merasakan tiap bagian yang
berelaksasi.

Instruksikan klien untuk menegangkan dan kemudian merelaksasikan


betis, lutut, dan seterusnya.
c.

Relaksasi dengan gerakan sensoris

Menyediakan tempat yang tenang


Membantu klien untuk mendapatkan kenyamanan saat sedang duduk atau
berbaring, meminta klien untuk tetap diam sebisa mungkin dan bergerak jika
perlu agar tetap merasa nyaman.

Menginstruksikan klien untuk menutup mata dan mempertahankan sikap


mau menerima.

Menginstruksikan klien untuk bernafas ke dalam dan ke luar secara


perlahan dan dalam menggunakan otot otot perut.

Instrusikan klien untuk mengulang secara perlahan lahan menyelesaikan


setiap kalimat berikut dengan suara rendah atau untuk dirinya:
Sekarang saya sadar melihat.
Sekarang saya sadar merasakan
Sekarang saya sadar mendengarkan..

Instrusikan klien untuk mengulng dan menyelesaikan setiap kata empat


kali, kemudian tiga kali, kemudian dua kali dan terakhir satu kali.
d.

Relaksasi dengan music


Menfasilitasi klien dengan alat perekam dan alat pendengar.

Meminta klien untuk mendapatkan posisi yang nyaman (duduk atau


berbaring dengan tangan dan kaki di silang) dan untuk menutup mata dan
mendengarkan music melalui alat pendengar.

Instrusikan klien untuk membanyangkan terapung atau ditiup dengan


music ketika sedang mendengarkan.
Evaluasi:

Mangkaji tanda tanda vital klien terutama pola pernafasan.

Minta klien untuk menggambarkan tingkat ketegangan atau perasaan


kawatir.

2.
a.

Mengamati klien terhadap adanya perilaku yang menunjukan kecemasan.

TERAPI LATIHAN SPESIFIK


Umpan balik biologis

Merupakan suatu kelompok prosedur terapeutik yang menggunakan alat


elektronik, atau elektromekanik untuk mengukur, memproses dan memberikan
informasi bagi individu tentang aktivitas system saraf otonom dan neuro
moskuler.
b.

Sentuhan terapiutik

Sentuhan terapiutik merupakan satu potensi alami manusia yang terdiri dari
meletakkan tangan praktisi pada atau dekat dengan tubuh seseorang kemudian
praktisi mencoba mengarahkan energi yang ada dalam tubuhnya untuk
membawa individu kembali masuk kedalam keseimbangan energi yang sama
dengan praktisi.
c.

Terapi kiropraktik

Manipulasi spinal yang diarahkan pada sendi tertentu ole praktisi dengan
menggunakan tangan atau alat.
d.

Akupuntur

Merupakan metode stimulasi titik tertentu pada tubuh dengan memasukan jarum
kusus untuk memodifikasi persepsi rasa nyeri, menormalkan fungsi fisiologis
serta mengobati dan mencegah penyakit.
e.

Terapi herbal

Menggunakan tanaman, hewan, atau mineral.

KELOMPOK 9 : TERAPI MEDIK DAN TERAPI KOMPLEMENTER


YANG LAZIM DIGUNAKAN PADA LANSIA
MAKALAHKOMUNITAS
TERAPIMEDIKDANTERAPIKOMPLEMENTERYANGLAZIMDIGUNAKANPADALANSIA

DisusunOleh:
Kelompok9

1.LailiyahIndri(101.0057)
2.RahayuApriliyaW.(101.0089)
3.Septiananingsih(101.0103)
4.VitaAristiarini(101.0113)

PROGRAMSTUDIS1KEPERAWATAN
SEKOLAHTINGGIILMUKESEHATANHANGTUAHSURABAYA
2013

BAB1
PENDAHULUAN
1.1.LatarBelakang
Penuaanadalahsuatuprosesakumulasidarikerusakanselsomatikyangdiawalioleh
adanyadisfungsiselhinggaterjadidisfungsiorgandanpadaakhirnyaakanmeningkatkan
risikokematianbagiseseorang.Apabiladilihatdarisudutpandangyanglebihluas,proses
penuaanmerupakansuatuperubahanprogresifpadaorganismeyangtelahmencapai
kematanganintrinsikdanbersifatirreversibelsertamenunjukkanadanyakemunduransejalan
denganwaktu.
Padahakikatnyamenjadituamerupakanprosesalamiahyangberartiseseorangtelah
melaluitigatahapkehidupannya,yaiyu:masakanakkanak,masaremaja,danmasatua.Tiga
tahapiniberbeda,baiksecarabiologismaupunpsikologis.Memasukimasatuaberarti
mengalamikemunduranbaikfisikmaupunpsikis.
Corakperkembanganprosespenuaanbersifatlambatnamundinamisdanbersifat
individualbaiksecarafisiologismaupunpatologis,karenabanyakdipengaruhiolehriwayat
maupunpengalamanhidupdimasalaluyangterkaitdenganfaktorbiologis,psikologis,
spiritual,fungsional,lingkunganfisikdansosial.Perubahanstrukturdanpenurunanfungsi
sistemtubuhtersebutdiyakinimemberikandampakyangsignifikanterhadapgangguan
homeostasissehinggalanjutusiamudahmenderitapenyakityangterkaitdenganusia
misalnya:stroke,Parkinson,danosteoporosisdanberakhirpadakematian.Penuaanpatologis
dapatmenyebabkandisabilitaspadalanjutusiasebagaiakibatdaritrauma,penyakitkronis,
atauperubahandegeneratifyangtimbulkarenastresyangdialamiolehindividu.Stres
tersebutdapatmempercepatpenuaandalamwaktutertentu,selanjutnyadapatterjadi
akselerasiprosesdegenerasipadalanjutusiaapabilamenimbulkanpenyakitfisik.
Olehkarenaitudiperlukannyapelaksanaanprogramterapiyangdiperlukansuatu
instrumentatauparameteryangbisadigunakanuntukmengevaluasikondisilansia,sehingga
mudahuntukmenentukanprogramterapiselanjutnya.Tetapitentunyaparametertersebut
harusdisesuaikandengankondisilingkungandimanalansiaituberada,karenahalinisangat
individualsekali,danapabiladipaksakanjustrutidakakanmemperolehhasilyang
diharapkan.Dalamkeadaaninimakaupayapencegahanberupalatihanlatihanatauterapi
yangsesuaiharusdilakukansecararutindanberkesinambungan.
1.2.RumusanMasalah
1.Apayangdimaksuddenganterapimedis?
2.Apayangdimaksuddenganterapikomplementer?
3.Terapimedicdankomplementerapayanglazimdigunakanpadalansia?
1.3.Tujuan

1.Mengetahuitentangterapimedis
2.Mengetahuitentangterapikomplementer
3.Mengetahuiterapimedicdankomplementeryanglazimdigunakanpadalansia

BAB2
TINJAUANPUSTAKA
2.1Terapimedis
Rehabilitasimerupakansemuatindakanyangbertujuanuntukmengurangidampak
disabilitysertahandicapagarindividulansiadapatberintegrasidalammasyarakat.
Rehabilitasiadalahaspekyangtidakdapatdipisahkandalampelayanankesehatan
lansia.(BritishG.Society).
Terapimedicadalahprosespelayanankesehatanyangbertujuanuntuk
mengembangkankemampuanfungsionaldanfisikologikdankalauperlumengembangkan
mekanismekompensasinyaagarindividudapatmandiri.
Terapimedikadalahsuatubentukpelayanankesehatanyangbertujuanuntuk
memulihkanataumengoptimalkankemampuanseseorangsetelahmengalamigangguan
kesehatanyangberakibatpadapenurunankemampuanfisik.
Reintegrasiadalahrentetanusahauntukkembalipadakemampuanfungsionalyang
pernahdimiliki.Reintegrasiterhadapkehidupannormaladalahhalyangsamgatdidambakan
olehseorangpasien.Harapaninilahyangmewakilikualitashidupyangdiinginkan.upaya
reintegrasidiartikansebagaireorganisasikondisifisik,psikis,dansocialsertaspiritual
menujukesatuanyangharmonissehinggaadaptasiterhadapkehidupandapatdiperoleh,
setelahmengalamisakitatautrauma.
Dengandemikiandapatditarikkesimpulanbahwaintiupayamempertahankandan
meningkatkankualitashidupseseorangyangmenderitasakitadalahyangmelaksanakan
upayaberdasarkankonseprehabilitasi.Konseprehabilitasimenyatudanberkesinambungan
denganprosespenyembuhanpenyakit,termasukberbagaireaksidanefeksampingterapi,
khususnyapadapenyakitgeriatric.
TujuanRehabilitasiMedikpadaUsiaLanjut:
1.Memberikanpelayananrehabilitasimedikyangkomprehensif.
2.Berperandalammempertahankandanataumeningkatkankualitashiduppasien(kesehatan,
vitalitas,fisik,danfungsi).
3.Mencegahataumengurangiketerbatasan(impairment),hambatan(disability)dankecacatan
(handicap).
2.2Terapikomplementer
MenurutKamusBesarBahasaIndonesia(KBBI),Terapiadalahusahauntuk
memulihkankesehatanorangyangsedangsakit;pengobatanpenyakit;perawatan
penyakit.Komplementeradalahbersifatmelengkapi,bersifatmenyempurnakan.
MenurutWHO(WorldHealthOrganization),Pengobatankomplementeradalah
pengobatannonkonvensionalyangbukanberasaldarinegarayangbersangkutan,sehingga
untukIndonesiajamumisalnya,bukantermasukpengobatankomplementertetapimerupakan
pengobatantradisional.Pengobatantradisionalyangdimaksudadalahpengobatanyangsudah
darizamandahuludigunakandanditurunkansecaraturuntemurunpadasuatunegara.
TetapidiPhilipinamisalnya,jamuIndonesiabisadikategorikansebagaipengobatan
komplementer.
TerapiKomplementeradalahcaraPenanggulanganPenyakityangdilakukansebagai
pendukungkepadapengobatanmediskonvensionalatausebagaipengobatanpilihanlain
diluarpengobatanmedisyangKonvensional.

SesuaidenganPeraturanMenteriKesehatandefinisipengobatanKomplementer
tradisionalalternatifadalahpengobatannonkonvensionalyangditunjukanuntuk
meningkatkanderajatkesehatanmasyarakat,meliputiupayapromotiv,preventive,kuratif,
danrehabilitatifyangdiperolehmelaluipendidikanterstrukturdengankualitas,keamanan,
danevektivitasyangtinggiberandaskanilmupengetahuanbiomediktapibelumditerima
dalamkedokterankonvensional.Dalampenyelenggaraannyaharussinergisdanterintregrasi
denganpelayananpengobatankonvensionaldengantenagapelaksanaanyadokter,doktergigi,
dantenagakesehatanlainnyayangmemilikipendidikandalambidangpengobatan
komplementertradisionalalternatif.Jenispengobatankomplementertradisionalalternatif
yangdaoatdiselenggarakansecarasinergisdanterintergrasiharusditetapkanolehmenteri
kesehatansetelahmemaluipengkajian.
Terapikomplementerbanyakmenggunakanpadaefektifitasdaribeberapa
terapi(Snyderdanlindquist,1998).Florencenightingalemenggambarkanpenggunaanterapi
komplementer,sepertimusik,didalamperawatanholistikklien(nigthingale,1860/1969).
Surverdiafrikamengemukakanbahwa42%repondenmenggunakan1atau
lebihterapikomplementer(eisenbergdkk,1998).Penggunaanterapikomplementer
meningkatkanhampir10%berdasarkanhasilsurveitahun90(eisenbergdkk,1993).Terapi
komplementerlebihpopulerdiEropadaripadadiAmerikaSerikat(peletier,2000).Dijerman
penggunaanherbalmerupakanbagiandarikeperawatankesehatan.Hasilpenelitiantentang
obatherbalmenunnjukkanbahwa7090%dariterapikesehatandiseluruhdunia
menggunakanterapikomplementersecararutinsebagaibagianperawatankesehatan
(kraitzerdanjansen,2000).
2.2.1PengertianTerapikomplementer
Istilahterapimodalitasdalamilmukeperawatanlebihdikenaldenganterapi
komplementer,terapialternativ,terapiholistis,terapinonbiomedis,pengobatanintegratif
atauperawatankesehatan,perawatannanalopati,danperawatannontradisional.Terapi
modalitasmerupakanmetodepemberianterapiyangmenggunakankemampuanfisikatau
elektrik.Terapimodalitasbertujuanuntukmembantuprosespenyembuhandanmengurangi
keluhanyangdialamiklien(lundydanjenes,2009).Terapikomplementeradalahistilah
untukterapiyangbukanbagiandaritepimediskofensional.
Terapikomplementeratauterapimodalitasdiakuisebagaiupayakesehatan
nasionalolehnasionalcenterforcomplementary/alternativemedicine(NCCAM)diamerika.
Penggunaanistilahkomplementerdisebabkankarenapemakaianbersamaterapilain,bukan
sebagaipenggantidanpengobatanbiomedis.Terapikomplementerjugadigunakandalam
praktikkeperawatanprofesionalsebagaiterapialternativdibeberapiklinikkeperawatan,
misalnyalatihanrelaksasiotoprogesifpadapenanganankliendenganepilepsiyang
menyertaipenggunaanobatantiepilepsi.Studymenunjukkanbahwapenggunaanrelaksasi
ototprogesifdapatmeningkatkankontrolkejang(whaitmadkk.,1990).Namundemikian,
tera[ikomplkementerdapatdigunakanmandiriatautidakberhubungandenganterapi
biomediskarenadiposisikansebagaiupayapromosikesehatan,misalnyakliendpijatsecara
rutinuntukmencegahmunculnyastres.
Terapikomplementermerupakanterapiholistisatauterapinonbiomedis.
Hasilpenelitiantentangpsikoneuroimunologimengungkapkanbahwaprosesinteraktifpada
manusiadengantubuh,pikiran,daninteraksisosialmempengaruhikesejahteraanseseorang.
NCCAM.Menetapkanbahwaterapikomplementersecaragarisbesardidasarkansebagai
kategoriterapipikiranpenghubungtubuh(mindbodyterapies)sementaraterapibiomedis

lebihbanyakmempengaruhiseluruhtubuhdanberfokuspadadampakterapiterhadap
pengibatanataupenangananmasalahfisik.Sebagaicontoh,padaterapibiomedis,evaluasi
efekobatantihipertensihanyaditentukanmelaluitekanandarahdantidakmemperhatikan
bagaimanaobatmempengaruhialamrohanidanpsikologis.
NCCAMmendefinisikanterapikomplementeradalahsuatupenyembuhan
yangmencakupsistemkesehatan,modalis,praktikdanteorisertakeyakinanadari
masyarakatataubudayadalamperiodesecaratertentu.CAMmencakupsemuapraktikserta
ideideyangdimaknaisebagaiupayamencegahataumengobatipenyakitatau
mempromosikankesehatandankesejahteraan.
2.2.2KlasifikasiTerapikomplementer
Terdapatlebihdari1800terapikomplementeryangdiidentifikasi
berdasarkansistemperawatan,terapiyangcukupdikenalluasdandigunakan,variasidari
terapi,praktikbudayaasliyangtidakdikenal,danmekanismeangmendasaritindakanterapi
yangtidakdiketahui.
KategoriterapikonmpkementermenurutNCCAMadalahsebagaiberikut:
1.Terapipikiran,tubuh(mindbodyterapies)
2.Terapiberbasisbiologi(biologokallibasedterapies)
3.Terapimanipulatifedanberbasistubuh(manipulatifeandbodybasedterapies)
4.Terapienergiyangtermasukdalamkategorienergihayatibioelektromagnetik(energiand
biofildterapies)
MenurutNCCAMterapikomplementermenjadipengobatanuntukkondisi
tertentudanmerupakanbagianintegraldarisistempelayanankesehatanternasukprofesi
perawat.
Basisfilosofiyangmendasaripenggunaanterapikomplementerberbedadengan
modalbiomediskonfensional.Biomedisberusahamenghilangkandanmemperbaikietiologi
ataumasalahyangmendasarisertamenekankanpadapengobatantraumamaupunsituasi
daruratlainya(weil,1995).Sementaraitutujuanterapikomplementerdalamsistem
keperawatanadalahuntukmencapaikeselarasandankeseimbangandalamdiriseseorang.
Zollmandanvickers(1999)menyatakantujuandariintervensiterapeutikadalahuntuk
mengembalikankeseimbangandanmemfasilitasirespontubuhdaripadamenyembuhkan
prosespenyakitataupenghentiangejala.Olehkarenaitu,perawatmemberikanperawatan
yangmencakupmodifikasigayahidup,perubahandiet,olahraga,pengobatankhusus,
konseling,latihan,bimbingan,padapernafasan,relaksasi,sertaresepherbal.Konsepini
menenkanpentingnyasistemperawatanyangmenerapkanpendekatankepedulianholistik
terhadapperawatanklienyangakanmeningkatkanpelayanankesehatan.
2.2.3Penggunaanterapikomplementer
Foktoryangmempengaruhiperkembanganataupenggunaanterapi
komplementer(Astin,1998:kaptchukdaneisenberg1998:jobs,1998:mitzdorfdkk,1999)
antaralain:
1.Adanyakenyakinanbahwaterapibiomedistidakmenyentuhseluruhdominanyangdimiliki
individu.
2.Adanyaefekbiomedisyangdianggaplebihburukdaripadaefekterapiyangdiharapkan;
3.Konsumenmenginginkanpenyedialayanankesehatanyangpesuli(carig).
4.Konsumenmenginginkanpengakuandanperlakuansecarautuhatauholistis.

5.Konsumenmenginginkanketerlibatandalampengambilankeputusandalammenangani
masalahkesehatanyangdihadapi.
6.Faktorlainyangtelahmeningkatkanpenggunaanterapikomplementeradalahpeningkatan
pengeseranbudayayangmenggunakanpelayanankesehatanselainsistembiomedis.
Terapikomplementersangatpentingdalamkliendengankondisikesahatan
fonisyangmeliputispiritual,sosial,psikologi,danmasalahfisik(haines,McKibbondan
Kanani,1996).
TerapikomplementerkeperawatanNightingalemenyerahkanpenggunaanterapi
komplementerdalamperawatanklien.Fundamentalofnursingmenjelaskanbeberapa
penggunaanprinsipterapikomplementersepertipijat(massage),panasdandingin,dangizi.
Padaakhir1950an,proseskeperawatandiperkenalkandenganmenggunakan5langkah
pendekatanpemecahanmasalahuntukkeperawatanyaitupengakajian,diagnosis
keperawatan,perencanaan,intervensi,danevaluasi.Keterampilanpengakajiansangatpenting
karenaberkaitandenganlangkahselanjutnya,yaituintervensi.Perpedaandalammenyusun
intervensidipengaruhiolehpengelompokanyangmeliputitundakandependen(dependent),
kolaborasi(interdependent),mandiri(independent).
Perawatmemilikiotonomiyangluasdalammemberikanintervensi,
terutamatindakanmandiri,sebagaitindakanprofesiyangditunjangpendidikantinggi.
Kondisiinimemberikankesempatankepadaperawatuntukdapatmemberikanpraktik
keperawatankomplementer.MenurutSydner,Bulechek,danMcCloskey(1985),beberapa
intervensikeperawatanmandiriyangtermasukterapikomplementerantaralainmusik,
imagery,relaksasiototprogesif,jurnaling,reminischance,danpijat.Indetifikasidan
klasifikasiintervensikeperawatanolehinternasionalcouncilofnursespoject(ICNP)dan
nationalinterventionclssificationproject(NIC)telahmemperluasruanglingkupintervensi
yangmencangkupseluruhkegiatankeperawatan(ICNP,1997;McCloskey,danbulechek.
1996).Dengandemikianberdasarkankonsepkeperawatan,istilahintervensitidak
membedakanterapikomplementerdengantindakankeperawatanlainnyaspertipemantauan
statusperawatanklienataukoordinasi.Perawatharusmenggunakanterapikomplementer
yanglebihbanyakuntukmembantuklienmencapaihasilksehatanyanglebihoptimal.
Tabel1.1klasifiskasiberdasarkanNationalCenterforComplementary/AlternativeMedicine
Jenis
Contoh
Terapi pikiran Yoga, tah chi, internal qi gong, meditasi ,
tubuh
imagery,hipnosis, biofedback, dukungan
(mindbody).
kelompok,terapiseni,terapimusik,terapidansa,
Pendekatan prilaku journaling , humor, psikoterapi tubuh, dan
psikologi, sosial, pengakuan nonlocality, soul retrieval,
dan spiritual untuk penyembuhan spiritual, holistik nursing, plasebo
kesehatan.
sweatlodges.
Terapi sistem Pengobatan tradisional cina (akupuntur, formula
pengobatan
herbal,diet,exterlandaninternalqigong,taichi,
alternatif(alternatif pijatan dan manipulasi, acupotomy), sistem adat
medical sistem ). tradisional seperti pengobatan asli penduduk
pengobatan
amerika, pengobatan ayuverda, unanitibbi,
nonmedis yang pengobatankampo,pengobatantradisionalafrika,
melibatkanteoridan pengobatan tradisional aborigin, curanderismo,
praktik dari sistem sistempengobatanbaratyangtidakkonvensional

yangkomplet.

(hemeopati, radiestasia,, caycebased systems,


radionics).Naturopati.
Terapi berbasis Herbal, diet khusus (pritkin, omishatki, tinggi
biologi (biological serat, makrobiotik), pengobatan orthomolecular
basedtherapies).
(gizi), intervensi farmakologi/biologis/
Terapiyangbersifat instrumental (kartilago ozon, cone therapy,
alami.
sengatanlebahelektrodiasnostik,iridologi
Praktik, intervensi,
dan produknya
berbasisbiologis
Terapi manipulatif Pengobatankiropraktikpijatandangerakantubuh
dan berbasis tubuh atau body work (kranialsakrum astheopatic
(manipulative and manipulative treatment. Pijatan swedia,
bodysistems)
refleksologimetodepilates,polaritas,geraktubuh
Sistem

yang trager,teknikalexander,teknikfeldenkrais.Pijatan
berdasarkan pada chinese tui Na, akupresur, ralfing), serta terapi
kegiatan manipulasi fisika nonkonvensional seperti hidroterapi,
dan atau gerakan distermi, terapi, cahaya dan warna, colonic,
anggotatubuh.
pernafasan ;ubang hidung secara bergantian
(alternatenostrilbreathing).
Terapi

energi Sentuhan terpeutik, sentuhan penyembuhan,


(energytherapies)
penyembuhan natural, shen, reiki, huna, qigong
Sistem pengobatan externaldanmagnet
yang menggunakan
medan energi halus
didalamdansekitar
tubuh

ProgramRehabilitasi
Untukmemulaiprogramrehabilitasipadapenderitalansia,sebagaitenagaprofessional
harusmengetahuikondisilansiasaatitu,baikpenyakityangmenyertaimaupunkemampuan
fungsionalyangmampudilakukan.salahsatunyadikemukakanolehKatz,DKKyangtelah
menetapkanFungsionalAssessmentInstrumentuntukmenggolongkankemandianmerawat
diripadalansiadenganberbagaimacampenyakit,misalfrakturcollumfemoris,infark
cerebri,arthritis,paraplegia,keganasan,dll.adapunaktivitasyangdinilaiadalahBathing,
Dressing,Toileting,Transfering,ContinencedanFeeding.
1.ProgramFisioterapi
Dalampenangananterapilatihanuntuklansiadimulaidariaktivitasfisikyangpaling
ringankemudianbertahaphinggamaksimalyangbisadicapaiolehindividutersebut,
misalnya:
a.Aktivitasditepattidur
Positioning,alihbaring,latihanpasif&aktiflingkupgeraksendi
b.Mobilisasi
Latihanbangunsendiri,duduk,transferdaritempattidurkekursi,berdiri,jalan
Melakukanaktivitaskehidupanseharihari:mandi,makan,berpakaian,dll
2.ProgramOkupasiterapi
Latihanditujukanuntukmendukungaktivitaskehidupanseharihari,dengan
memberikanlatihandalambentukaktivitas,permainan,ataulangsungpadaaktiviatsyang
diinginkan.MisalnyalatihanjongkokberdiridiWCyangdipunyaiadalahharusjongkok,
namunbilatidakmemungkinkanmakadibuatmodifikasi.
3.ProgramOrtotikprostetik
Biladiperlukanalatbantudalammendukungaktivitaspadalansiamakaseorang
ortotisprostetisakanmembuatalatpenopang,ataualatpenggantibagiantubuhyang
memerlukansesuaidengankondisipenderita.Danuntuklansiahaliniperlupertimbangan
lebihkhusus,misalnyapembuatanalatdiusahakandaribahanyangringan,modelalatyang
lebihsederhanasehinggamudahdipakai,dll.
4.ProgramTerapiWicara
Programinikadangkadangtidakselaluditujukanuntuklatihanwicarasaja,tetapiperlu
diperlukanuntukmemberilatihanpadapenderitadengangangguanfungsimenelanapabila
ditemukanadanyakelemahanpadaototototsekitartenggorokan.Haliniseringterjadipada
penderitastroke,dimanaterjadikelumpuhansarafvagus,saraflidah,dll
5.ProgramSosialMedik
Petugassosialmedikmemerlukandatapribadimaupunkeluargayangtinggalbersama
lansia,melihatbagaimanastruktur/kondisidirumahnyayangberkaitandenganaktivitasyang
dibutuhkanpenderita,tingkatsosialekonomi.Halinisangatpentingsebagaimasukanuntuk
mendukungprogramlainyangahrusdilaksanakan,misalnyaseoranglansiayangtinggal
dirumahnyabanyaktrap/anaktangga,bagaimanabisadibuatlandaiataupindahkamaryang
datardanbiasadekatdengankamarmandi,dll
6.ProgramPsikologi

Dalammenghadapilansiaseringkaliharusmemperhatikankeadaanemosionalnya,
yangmempunyaiciriciriyangkhaspadalansia,misalnyaapakahseorangyangtipeagresif,
ataukonstruktif,dll.Jugauntukmemberikanmotivasiagarlansiamaumelakukanlatihan,
mauberkomunikasi,sosialisasidansebgainya.Halinidiperlukanpuladalampelaksanaan
programlainsehinggahasilnyabisalebihbaik.

BAB3
PEMBAHASAN
3.1.Gangguansistemmuskuloskeletaldanintegumen:osteoporosis
3.1.1Pengertian
Osteoporosisadalahkelainandimanaterjadipenurunanmassatulangtotal.Terdapat
perubahanpergantiantulanghomeostasisnormal,kecepatanresorpsitulanglebihbesardari
kecepatanpembentukantulang,pengakibatkanpenurunanmasatulangtotal.Tulangsecara
progresifmenjadiporus,rapuhdanmudahpatah;tulangmenjadimudahfrakturdenganstres
yangtidakakanmenimbulkanpengaruhpadatulangnormal(Brunner&Suddarth,2000).
Osteoporosisadalahgangguanmetabolismetulangsehinggamasatulangberkurang.
Resorpsiterjadilebihcepatdaripadaformasitulang,sehinggatulangmenjaditipis
(Pusdiknakes,1995).Jadiosteoporosisadalahkelainanataugangguanyangterjadikarena
penurunanmasatulangtotal.
3.1.2Etiologi
Faktorfaktoryangmempengaruhipenguranganmassatulangpadausialanjut:
a.DeterminanMassaTulang
1)Faktorgenetik
Perbedaangenetikmempunyaipengaruhterhadapderajatkepadatantulang.Beberapaorang
mempunyaitulangyangcukupbesardanyanglainkecil.Sebagaicontoh,orangkulithitam
padaumumnyamempunyaistrukturtulanglebihkuat/beratdaripaciabangsaKaukasia.Jacii
seseorangyangmempunyaitulangkuat(terutamakulitHitamAmerika),relatifimun
terhadapfrakturkarenaosteoporosis
2)Faktormekanis
Bebanmekanisberpengaruhterhadapmassatulangdisampingfaktorgenetk.Bertambahnya
bebanakanmenambahmassatulangdanberkurangnyabebanakanmengakibatkan
berkurangnyamassatulang.Denganperkataanlaindapatdisebutkanbahwaadahubungan
langsungdannyataantaramassaototdanmassatulang.Keduahaltersebutmenunjukkan
responsterhadapkerjamekanikBebanmekanikyangberatakanmengakibatkanmassaotot
besardanjugamassatulangyangbesar.Sebagaicontohadalahpemaintenisataupengayuh
becak,akandijumpaiadanyahipertrofibaikpadaototmaupuntulangnyaterutamapada
lenganatautungkainya;sebaliknyaatrofibaikpadaototmaupuntulangnyaakandijumpai
padapasienyangharusistrahatditempattidurdalamwaktuyanglama,poliomielitisatau
padapenerbanganluarangkasa.Walaupundemikianbelumdiketahuidenganpastiberapa
besarbebanmekanisyangdiperlukandanberapalamauntukmeningkatkanmassatulangdi
sampihgfaktorgenetik
3)Faktormakanandanhormon
Padaseseorangdenganpertumbuhanhormondengannutrisiyangcukup(proteindan
mineral),pertumbuhantulangakanmencapaimaksimalsesuaidenganpengaruhgenetikyang
bersangkutan.Pemberianmakananyangberlebih(misainyakalsium)diataskebutuhan
maksimalselamamasapertumbuhan,disangsikandapatmenghasilkanmassatulangyang
melebihikemampuanpertumbuhantulangyangbersangkutansesuaidengankemampuan
genetiknya.
b.DeterminanPenurunanMassaTulang

1)Faktorgenetik
Faktorgenetikberpengaruhterhadaprisikoterjadinyafraktur.Padaseseorangdengantulang
yangkecilakanlebihmudahmendapatrisikofrakturdaripadaseseorangdengantulangyang
besar.Sampaisaatinitidakadaukuranuniversalyangdapatdipakaisebagaiukurantulang
normal.Setiapindividumempunyaiketentuannormalsesuaidengansitatgenetiknyaserta
bebanmekanisdenbesarbadannya.Apabilaindividudengantulangyangbesar,kemudian
terjadiprosespenurunanmassatulang(osteoporosis)sehubungandenganlanjutnyausia,
makaindividutersebutrelatifmasihmempunyaitulangtobihbanyakdaripadaindividuyang
mempunyaitulangkecilpadausiayangsama
2)Faktormekanis
Dilainpihak,faktormekanismungkinmerupakanfaktoryangterpentingdalarnproses
penurunanmassatulangschubungandenganlanjutnyausia.Walaupundemikiantelah
terbuktibahwaadainteraksipantingantarafaktormekanisdenganfaktornutrisihormonal.
Padaumumnyaaktivitasfisisakanmenurundenganbertambahnyausia;dankarenamassa
tulangmerupakanfungsibebanmekanis,massatulangtersebutpastiakanmenurundengan
bertambahnyausia.
3)Kalsium
Faktormakananternyatamemegangperananpentingdalamprosespenurunanmassatulang
sehubungandenganbertambahnyaLisia,terutamapadawanitapostmenopause.Kalsium,
merupakannutrisiyangsangatpenting.Wanitawanitapadamasaperimenopause,dengan
masukankalsiumnyarendahdanabsorbsinyatidakbak,akanmengakibatkankeseimbangan
kalsiumnyamenjadinegatif,sedangmerekayangmasukankalsiumnyabaikdanabsorbsinya
jugabaik,menunjukkankeseimbangankalsiumpositif.Darikeadaaninijelas,bahwapada
wanitamasamenopauseadahubunganyangeratantaramasukankalsiumdengan
keseimbangankalsiumdalamtubuhnya.Padawanitadalammasamenopausekeseimbangan
kalsiumnyaakantergangguakibatmasukansertaabsorbsinyakurangsertaeksresimelalui
urinyangbertambah.Hasilakhirkekurangan/kehilanganestrogenpadamasamenopause
adalahpergeserankeseimbangankalsiumyangnegatif,sejumiah25mgkalsiumsehari.
4)Protein
Proteinjugamerupakanfaktoryangpentingdalammempengaruhipenurunanmassatulang.
Makananyangkayaproteinakanmengakibatkanekskresiasamaminoyangmengandung
sulfatmelaluiurin,haliniakanmeningkatkanekskresikalsium.
5)Padaumumnyaproteintidakdimakansecaratersendiri,tetapibersamamakananlain.
Apabilamakanantersebutmengandungfosfor,makafosfortersebutakanmengurangi
ekskresikalsiummelaluiurin.Sayangnyafosfortersebutakanmengubahpengeluaran
kalsiummelaluitinja.Hasilakhirdarimakananyangmengandungproteinberlebihanakan
mengakibatkankecenderunganuntukterjadikeseimbangankalsiumyangnegatif
6)Estrogen.
Berkurangnya/hilangnyaestrogendaridalamtubuhakanmengakibatkanterjadinyagangguan
keseimbangankalsium.Halinidisebabkanolehkarenamenurunnyaeflsiensiabsorbsi
kalsiumdarimakanandanjugamenurunnyakonservasikalsiumdiginjal.
7)Rokokdankopi
Merokokdanminumkopidalamjumlahbanyakcenderungakanmengakibatkanpenurunan
massatulang,lebihlebihbiladisertaimasukankalsiumyangrendah.Mekanismepengaruh
merokokterhadappenurunanmassatulangtidakdiketahui,akantetapikafeindapat
memperbanyakekskresikalsiummelaluiurinmaupuntinja.
8)Alkohol

Alkoholismeakhirakhirinimerupakanmasalahyangseringditemukan.Individudengan
alkoholismemempunyaikecenderunganmasukankalsiumrendah,disertaidenganekskresi
lewaturinyangmeningkat.Mekanismeyangjelasbelumdiketahuidenganpasti.
3.1.3ManifestasiKlinik
Gejalayangpalingseringdanpalingmencemaskanpadaosteoporosisadalah:
Nyeridenganatautanpafrakturyangnyata.
Nyeritimbulmendadak
Sakithebatdanterlokalisasipadavertebraygterserang
Nyeriberkurangpadasaatistirahatditempattidur
Nyeriringanpadasaatbanguntidurdandanakanbertambaholehkarenamelakukan
aktivitas
Deformitasvertebrathorakalis
Penurunantinggibadan
3.1.4PenatalaksanaanMedis
Adapunpenatalaksanaanpadakliendenganosteoporososismeliputi:
a.Pengobatan
Meningkatkanpembentukantulang,obatobatanygdapatmeningkatkanpembentukantulan
adalahNafluoridadansteroidanabolik
Menghambatresobsitulang,obatobatanyangdapatmengahambatresorbsitulangadalah
kalsium,kalsitonin,estrogendandifosfonat
b.Pencegahan
Pencegahansebaiknyadilakukanpadausiapertumbuhan/dewasamuda,halinibertujuan:
1)MencapaimassatulangdewasaProseskonsolidasi)yangoptimal
2)Mengaturmakanandanlifestyleygmenjadiseseorangtetapbugarseperti:
Dietmengandungtinggikalsium(1000mg/hari)
Latihanteratursetiaphari
Hindari:
Makanantinggiprotein
Minumanberalkohol
Merokok
Minumkopi
Teknikterapikomplementer
a.MencegahOsteoporosis
Osteoporosisadalahsuatusindromapenurunandensitastulang(matrixdanmineral
berkurang),terapirasiomatrikdanmineraltetapnormal.Osteoporosisterjadikarena
ketidakseimbanganantararesorpsitulangdanpembentukantulang.Densitasmineraltulang
berkurangsehinggatulangmenjadikeroposdanmudahpatahwalaupundengantrauma
minimal.

Contohlatihanyangharusdihindari:
1.SitUp
2.Menyentuhjarikakipadaposisiberdiri
3.Dudukdenganpunggungmembungkuk

4.Mengangkatbebandenganayunanpunggung
b.MenjagaKebugaranJasmani
Kebugaranjasmaniadalahsuatuaspekfisikdarikebugaranmenyeluruh.Kebugaranjasmani
padalansiaadalahkebugaranyangberhubungandengankesehatanyaitukebugaranjantung
parudanperedarandarahsertakekuatanototdankelenturansendi.
c.MengangkatdanMengangkut
Melihatberbagaiperubahankarenapenuaan,caramengangkatdangmengakutyang
efektif,efisien,danamanmerupakankebutuhanbagilansia.Untukmenunjangprinsipkinetic
dalammengangkatdanmengangkutdapatdilakukanhalhalsebagaiberikut:
1)Peganganharustepat,kerjastatislocaldihindari
2)Pegangan/tanganberadasedekatmungkindengantubuh
3)Punggungharuslurus
4)Dagu(kepala)diusahakansegerakeposisitegak
5)Kakidiusahakansedemikianrupasehinggakeseimbangannyakuat
6)Menfaatkanberatbadansebagaigayatarik/dorong
7)Bebanberadasedekatmungkindengangarisverticalyangmelaluipusatgravitasitubuh.
d.Perlindungansendi
Usahaperlindungansendidapatdilakukandenganmenghindaripemakaiansendisecara
berlebihan,menghindaritrauma,mengurangipembebanan,berusahamenggunakansendi
yanglebihkuatataulebihbesar,danistirahatsejenakdiselaselaaktivitas.
e.KonservasiEnergi
Konservasienergyadalahsuatucaramelakukanaktivitasdenganenergyyangrelative
minimal,namundapatmemperolehhasilaktivitasyangbaik.Teknikkonservasienergydapat
dicapaiapabiladalamsetiapaktivitasmemperhatikanhalhalberikut:
1)Rencanakanaktivitasyangakandilakukansehinggatidakadagerakankejutyangakan
meningkatkanstreesfisikatauemosional.
2)Aturlingkunganaktivitassedemikianrupasehinggapadawaktumelaksanakanaktivitas,
energydapatdigunakansecraefisien
3)Jikamungkin,aktivitasdilakukandalamposisiduduk
4)Janganmenjinjingataumengangkatbarangjikadapatdidorongataudigeser.
5)Gunakanalataktivitasyangrelatiferingan
6)Lakukanaktivitasdengancarayangsamakarenaakanmembuatlebihefisien.
7)Dalamsetiapaktivitas,harusseringdiselingiistirahat.Salahsatupedomanadalahsepuluh
menitistirahatuntuksetiapsatujambekerja.
8)Bagiaktivitasmenjadibeberapabagiankemudiankerjakanpadawaktuyangberbeda.
f.PeningkatanKekuatanOtot
Peningkatankekuatanototpadalansialebihditujukanagarmampumelakukangerak
fungsionaltanpaadanyahambatan.Dalamlatihanini,jenislatihanyangdianjurkanadalah
latihanisotonic,denganmempertimbangkanhalhalsebagaiberikut:
1)Tentukankemampuanototmaksimal
2)Latihanpada60%80%kemampuanototmaksimal
3)Ukurulangsetiapminggu

4)3Xserilatihan,tiapseri810ulangan
5)Istirahat12menitdiantaraseri
6)Lakukan3Xseminggu,minselama8minggu
3.2.Gangguanpersepsisensori:demensia
3.2.1.Pengertian
DalamDuranddanBarlow(2006)demensiaadalahonsetgradualfungsiotakyang
melibatkankehilanganingatan,ketidakmampuanmengenaliberbagaiobjekatauwajah,dan
kesulitandalammerencanakandanpenalaranabstrak.Keadaaniniberhubungandengan
frustasidankehilangansemangat.MenurutWHOdalamClinicalDeskriptionsand
DiagnosticGuidelinesforMentalandBehaviouralDisordersdanInternationalClassification
ofDiseases(10thRevision)(ICD10)(2008)demensiamemilikiciriciriyangharusada
diantaranya:
1.Kemundurankemampuanintelektualterutamamemoriyangsampaimengangguaktivitas
aktivitaskesehariansehinggamenjadikanpenderitasulitbahkantidakmungkinuntukhidup
secaramandiri.
2.Mengalamikemundurandalamberfikir,merencanakandanmengorganisasikanhalhaldari
harikehari.
3.Awalnya,mengalamikesulitanmenyebutkannamanamabenda,orientasiwaktu,tempat.
4.Kemunduranpengontrolanemosi,motivasi,perubahandalamperilakusosialyangtampak
dalamkelabilanemosi,ketidakmampuanmelakukanritualkeseharian,apatis(tidakpeduli)
terhadapperilakusosialsepertimakan,berpakaiandaninteraksidenganoranglain.
Adabermacammacamjenisdemensia,menurutDurlanddanBarlow(2006)adalima
golongandemensiaberdasarkanetiologinyayangtelahdidefinisikanyaitu:(1)demensiatipe
Alzheimer,(2)demensiavaskular,(3)demensialarenakondisimedisumum,(4)demensia
menetapyangdiinduksiolehsubstansitertentu,dan(5)demensiakarenaetiologi
ganda/multiple,(6)demensiayangtaktergolongkan.
DemensiaAlzheimeradalahdemensiayangpalingbanyakterjadidandicirikanoleh
kemunduranintelektualyangprogresif.Faktorrisikoutamaadalahusiayanglanjut,
keturunandantraumakepala.
Demensiavaskuler(multiinfrak)adalahdemensiakeduayangbanyakterjdaisetelah
demensiaAlzheimer.Demensiavaskulerseringkalidicirikanolehadanyatandadangejala
tertentusepertikemunduranyangbertahap(stepwise),riwayatsrokeatauhipertensi,bukti
adanyaaterosklerosis,gejalaneurologisfokal,danemosistabil.
3.2.2.Etiologi
1.Penyebabsecarabiologis
a.Adanyapenumpukanproteinyanglengketyangdisebutanyloidplauquesyangberakumulasi
diotakpadapenderitademensia.Plakamiloidjugaditemukanpadalansiayangtidak
memilikigejalagejalademensia,tetapijugadalamjumlahyangjauhlebihsedikit(Bourgeois
dkkdalamDuranddanBarlow,2006)
b.Didalamotakditemukanjaringanabnormal(disebutplaksenilisdanserabutsarafyang
semrawut)danproteinabnormal,yangbisaterlihatpadaotopsi.DemensiasosokLewysangat
menyerupaipenyakitAlzheimer,tetapimemilikiperbedaandalamperubahanmikroskopik
yangterjadididalamotak.

c.Penyebabyanglaindaridemensiaadalahseranganstrokeyangberturutturut.Stroketunggal
ukurannyakecildanmenyebabkankelemahanyangringanataukelemahanyangtimbul
secaraperlahan.Strokekecilinisecarabertahapmenyebabkankerusakanjaringanotak,
daerahotakyangmengalamikerusakanakibattersumbatnyaalirandarahdisebutinfark.
Demensiayangberasaldaristrokekecildisebutdemensiamultiinfark.Sebagianbesar
penderitanyamemilikitekanandarahtinggiataukencingmanis,yangkeduanya
menyebabkankerusakanpembuluhdarahdiotak.
d.Demensiajugabisaterjadisetelahseseorangmengalamicederaotakataucardiacarrest.
Penyebablaindaridemensiaadalahpenyakitparkinson,penyakitpick,AIDS,penyakitparu,
ginjal,gangguandarah,gangguannurtrisi,keracunanmetabolism,diabetes.
e.Penyebabbiologisdemensiatidakdiketahuipenyebabnyahanyasajamasalahkerusakan
cortex(jaringanotak).Penelitianotopsimengungkapkanbahwalebihdarisetengahpenderita
yangmeninggalkarenademensiasenilemengalamipenyakitAlzheimerjenisini.Pada
kebanyakanpenderita,besarkasarotakpadasaatotopsijauhlebihrendahyangventrikeldan
sulkusjauhlebihbesardibandingkanyangnormalyangseukuranusiatersebut.Demielinasi
danpeningkatankandunganairpadajaringanotakditemukanberdekatandenganventrikel
lateraldandalambeberapadaerahlaindibagiandalamhemifsferserebrumpadpenderita
manula.
f.FaktorgenetikyangberhubungandenganapoproteinE4(ApoE4),alela(4)kromosom19
padapenderitaAlzheimerfamilial/sporadic.Mutasi21,1,14awalpenyakit.Penyebablainnya
yaituneorotransmiterlainyangberkurang(defisit)yaitunonadrenergicpresinaptik,
serotonin,somatostatin,corticotrophin,releasingfaktor,glutamate,dll.
2.Penyebabsecarapsikologis
Penderitayangmengalamidepresimemilikirisikoduakalilebihbesarmengalami
demensia.HalinidiperkuatdarihasilpenelitianolehEpidemiologicalPathwaysFollowUp
Studyyangdilakukanselamalimatahunpasienyangsudahdidiagnosismenderitademensia
dikeluarkandaripenelitianini.
Selamaperiodelimatahun36dari445,atau7.9persendaripasiendiabetesdengan
depresiberatdidiagnosisdengandemensia.Diantara3.382pasiendengandiabetessaja,163
atau4,8persenmengembangkangejalademensia.Parapenelitimenemukanhasilbahwa
depresiberatdengandiabetesmengalamipeningkatan2.7kalilipatuntukmengalami
demensia,dibandingdenganpasiendiabetestanpamengalamidepresiberat.
Depresimeningkatkanrisikodemensia,karenakelainanbiologisafektifini
berhubungandenganpenyakit,termasuktingginyakadarhormonstreskortisol,ataumasalah
sistemsarafotonomyangdapatmempengaruhijantung,pembekuandarah.Selainitufaktor
faktorlainyangmeningkatkanrisikodemensiakarenaperilakuumumdalamkondisiseperti
merokok,makanberlebihan,kurangolahraga,dankesulitandalammengikutirejimen
pengobatandanperawatan.
3.Penyebabsecarasosial
Gayahidupseseorangmungkinmelibatkankontakdenganfaktorfaktoryangdapat
menyebabkandemensia,misalnyapenyalahansubstansiyangdapatmengakibatkan
demensia.Gayahidupsepertidiet,olahraga,danstresmempengaruhipenyakit
kardiovaskulerdandapatmembantumenentukansiapasajayangakanmengalamidemensia
vaskuler.Gayahidupyangsehatsepertidiet,olahragadankontrolterhadapmakanandapat
meminimalisirkemungkinanterjadinyastrokedantekanandarahtinggiyangmenyebabkan

demensiavaskuler.Sedangkangayahidupyangtidaksehatsepertistres,tidakmengontrol
makanan,jarangberolahragadapatmeningkatkanrisikoterkenastrokedantekanandarah
tinggiyangmenyebabkandemensiavaskuler.
Faktorfaktorkulturaljugadapatmemengaruhiseseorangmengalamidemensia.
Sebagaicontoh,hipertensidanstrokemenonjoldikalanganorangorangAfrikaAmerikadan
orangorangAsiaAmerikatertentu(CruickshankdanBeeversdalamDuranddanBarlow,
2006),yangmenjelaskanmengapademensiavaskularlebihseringdialamiolehkelompokini.
HaliniterjadiakibatgayahidupyangkurangsehatsepertidikalanganorangorangAfrika
Amerikayangseringmengkonsumsialkoholdanmakananmakanancepatsajidan
berpengawetyangmeningkatkanrisikoterkenahieprtensidanstrokeyangmenyebabkan
demensiavarskuler(delaMonte,etalldalamDuranddanBarlow,2006).
3.2.3.ManifestasiKlinis
GejalagejalaklinisdemensiamenurutYatim(2003)meliputi:
a.Hilangataumenurunnyadayaingatsertapenurunanintelektual.
b.Kadangkadanggejalainibegituringanhinggaluputdariperhatianpemeriksabahkandokter
ahliyangberpengalamansekalipun.
c.Penderitakurangperhatianterhadapsesuatuyangmerupakankejadiansehariharidantidak
mampuberfikirjernihataskejadianyangdihadapiseharihari,kuranginisiatif,sertamudah
tersinggung.
d.Kurangperhatiandalamberfikir.
e.Emosiyangmudahberubahubahterlihatdarimudahnyagembira,tertawaterbahakbahak
lalutibatibasedihberuraiairmatahanyakarenasedikitpengaruhlain.
f.Munculreflekssebagaitandaregresi(kemundurankualitasfungsiseperti:refleksmengisap,
rrefleksmemegang,danrefleksglabella).
g.Banyakperubahanperilakudiakibatkanolehpenyakitsyaraf,makaterlihatdalambentuklain
yangdikaburkanolehgejalapenyakitsyaraf.
Padagejalaklinisusialanjuttelihatdaripenurunanperkembanganpemahamanyangterlihat
sebagaiberikut:
1.Penurunandayaingat.
2.Salahsatugangguanpengamatan:
a.Aphasia(kuranglancarberbahasa).
b.Apraxia(tidakadakemauan).
c.Agnosia(kurangmampumerasakanrangsanganbau,penciumandanrasa).
3.Penurunanpengamatantimbulsecarabertahapdanterusmenurusdariwaktukewaktu
sehinggamenggangukerjadanhubunganmasyarakat.
3.2.4.PenatalaksanaanMedis
Hasildariconsensusepidemiologidiatasmenyatakanbahwaprosentaseuntuk
prevalensiorangyangmengalamidemensiasemakinmeningkatsetiaptahunnya,sehingga
perludiupayakantindakantindakanpromotif,preventifmaupunkuratif.Baikbagimereka
tanpamasalahmaupunyangsudahbermasalahsesuaidenganyangsudahdibahasdiatas.
Penangananyangbisadilakukan:
a.Farmakologis(denganobat):haliniperlupemeriksaandanpertimbangansecaraindividual.
b.NonFarmakologis(tanpaobat):halinibisadilakukanolehsemuawargaseniortanpaada
pertimbanganbaiksebagaiupayapromotif,prefentifmaupunkuratif.

Penanganansecarafarmakologisyangdilakukan(Yatim,2003)diantaranya:
a.Mengobatipenyakitpenyakityangmemperberatkejadiandemensia.
b.Mengobatigejalagejagangguanjiwayangmungkinmenyertaidemensia.
c.Mengatasimasalahpenyimpanganperilakudenganobatobatpenenang(tranzquillizerdan
hypnotic)sertamemberikanobatobatanantikejangbilaperlu.
d.Intervensilainyaitudenganantipsykotics,Anxiiolitycs,Selegiline,Antimanicdrugs,
Acetlcholinesteraseinhibit(Gaskel,2007)
KonseppenangananNonfarmakologisbisamenggunakanrekreasiterapeutik.
Konsepinibermanfaatuntukmeningkatkandanmempertahankankebutuhan
psikososialwargaseniorsertabertujuanmeningkatkandanmempertahankankepercayaan
diri,motivasi,mobilitastantangan,interaksisosialdankebugaranmental.
Aktivitasaktivitasyangmemilikidampakterapeutik(Kusumoputro&Sidiarto,2006)
diantaranya:
a.Reminisensi
b.Orientasirealitas
c.Stimulasikognitif
d.Stimulasisensorik
e.Stimulasifisik(berupagerakdanlatihanotak,GLO)
Pelaksanaanprogramdilakukandenganjumlahpesertayangtidakterlampaubanyak,
dipimpinseorangkoordinatoryangmemahamikonsepini.Pesertaharusdalamkelompok
kebersamaan.
Aktivitasreminisensidilakukandenganberbincangbincangmengenaimasalahyang
lampau,mengingatkembalimasalampaunyadenganmemoriepisodik(materitentangwaktu
dantempatkejadian).Denganmengaktifkanmemoriepisodikyangnaratif,imajinatifdan
emosionalakanmeningkatkandayaingatkembali.Bersamaandenganaktivitastersebutjuga
dilakukanaktivitasorientasinyatadenganmengingatkanlokasi,waktudanperangorang
orangdimasalampau.
Sebagaiaktivitasrekreasiterapeutikinijugadilakukanstimulasikognitifdisebutjuga
memorytraining,memoryretrainingataucognitiverehabilitation.Aktivitasiniperlu
ditambahdenganaktivitasfisiksepertisenamataupunmenurutseleramasingmasing.Halini
bertujuanuntukmeningkatkankerjajantungdanparuuntukmengalirkandarahyangpenuh
oksigenkebagianbagiantubuhterutamaotakselainitujugamemilikitujuanrenovasisel
tubuh.Berbagaihalyangdisebutkantadijugamenguntungkanbagikondisiklinis
prademensiasepertimildcognitiveimpairment,MCIdanvascularcognitiveimpairment,VCI
sertakondisiklinisdemensiavaskulerdanAlzeimer.
Dalamjurnalyangmenilitimelaluiefekdariterapimusikterhadaplansiapenderita
demensia(Wall,&Duffy,2010).Dalamjurnaltersebutdijelaskanmelaluikebiasaan
mendengarkanmusicwalaupunsecarasingkatakansangatbermanfaatuntukmelatihingatan
paralansiapenderitanya.Tingkatkegelisahannyapunakanmenurun,termasukperilaku
agresifverbalmaupunnonverbalnya.
Terapilaindenganpendekatanpsikososialadalah:
1.Caregiver:mengoptimalkankemampuanyangmasihada
2.Mengurangiperilakusulit
3.Menjagakeselamatannya
4.Memperbaikikualitashidup
5.Mengurangistresterhadapcaregiver

6.Memberikepuasaankepadacaregiver
Terapilifereview
Lifereviewterapiadalahsuatufenomenayangluassebagaigambaranpengalamankejadian,
dimanadidalamnyaseseorangakanmelihatsecarcepattentangtotalitasriwayatkehidupan.
Teoriterapilifereview
Terapitersebutakanmembawaseseoranguntukbisamenjadilebihakrabpadarealita
kehidupan.Terapiinimembantuseseoranguntukmengaktifkaningatkanjangkapanjang
dimanaakanterjadimekanismerecalltentangkejadianpadakehidupanmasalaluhingga
sekarang.Denganinilansiaakanlebihmengenalsiapadirinyadandapatmempertimbangkan
kualitashidupmenjadilebihbaikdibandingkansebelumnya.
Manfaatlivereviewterapi
1.Menurunkandepresi
2.Meningkatkankepercayaandiri
3.Meningkatkankemampuanindividuuntukberaktivitasseharihari
4.Meningkatkankepuasanhidup
Indikasilivereviewterapi
MenurutJones(2008),livereviewterapimerupakanpenangananyangdirekomendasikan
untuklansiayangmengalamidefisitkognitifdengan:
1.Depresi
2.Penyakitdemensiaalzheimer
3.Perawatansaatmenjelangajal
4.Perawatanterminaldanpaliatif
Kontraindikasilivereviewterapi
1.Bahwalivereviewterapidapatlebihmenimbulkanefekmenyakitidibandingkanefek
membantupadalansiayangmemilikiperistiwaperistiwahidupnegatif.Beberapalansia
mungkinakanmenolakmelakukanlivereviewterapi,bukankarenamerekatidakmau,
melainkankarenaakanmenjadidepresiketikalansiamelakukannyakarenaperasaan
kehilanganyangmerekaalami(Colins,2006)
2.Lansiadengangangguanmemoryjangkapanjangdimanaakanmenjadikesulitanuntuk
melakukanmengingatkejadianmasalalu.
Tekniklivereviewterapi
Teknikinidilakukandengancaramelibatkanorangyangdicintaikarenaakan
mempermudahproseskomunikasi..Perawatberusahamengkomunikasikanriwayatmasa
lalumelaluibukumemoryyangdijelaskansebagaiberikut:
1.Menggunakanalbumfotodenganukuranhalamanyangbesarsebagaimediauntuk
meletakkansemuagambarataudokumendalamberbagaiukuran.Jikalansiamengalami
gangguanpenglihatan,makasebisamungkingunakanukurangambaryanglebihbesaragar
terlihatlebihjelas.
a.Mengumpulkanalbumfotodariberbagaikehidupanmasalalulansiamulaidarikecil,
dewasahinggamenua
b.Lansiamampumenyebutkansatupersatusituasifotoyangditampilkan

c.Lansiamenjelaskansituasiyangadapadafoto,sepertisiapasajayangadadidalamfoto,
dimanatempatnya,kapanterjadinya,sertaapayangdilakukanatausituasiyangterjadipada
saatmengambilfototersebut.
2.Menjelaskantentangnamabagianbagiandaritingkatankehidupanyangpernahdijalani
seperti:
a.Keluargainti(informasikelahiran,kehidupan,dankematianmengenaiayah,ibu,kakek,
nenek)
b.Tahunawal(kelahirandarianakyangpalingmudah)
c.Riwayatpekerjaan(tugasanak,riwayatpekrjaandanpensiun)
d.Bersikapramahdanperkawinan
e.Riwayatpasangan
f.Pernikahananak
g.Keluargadanteman
h.Rekreasi,hobi,ketertarikan,danliburan
i.Memperingatiharikeagamaan
3.Membuatnarasipadamasingmasingkehidupanyangpernahdijalanlansia.Saatmembuat
narasidapatdidampingiolehyangdisayangiagarlebihmudahdikomunikasikan
3.3.Gangguankonsepdiri:depresi
3.3.1.Pengertian
Adabeberapadefinisidepresimenurutparaahli,marikitasimak:
MenurutRicePL(1992),depresiadalahgangguanmood,kondisiemosionalberkepanjangan
yangmewarnaiseluruhprosesmental(berpikir,berperasaandanberperilaku)seseorang.Pada
umumnyamoodyangsecaradominanmunculadalahperasaantidakberdayadankehilangan
harapan.
MenurutKusumanto(1981)depresiadalahsuatuperasaankesedihanyangpsikopatologis,
yangdisertaiperasaansedih,kehilanganminatdankegembiraan,berkurangnyaenergiyang
menujukepadameningkatnyakeadaanmudahlelahyangsangatnyatasesudahbekerja
sedikitsaja,danberkurangnyaaktivitas.Depresidapatmerupakansuatugejala,atau
kumpulangejala(sindroma).
MenurutKartono(2002)depresiadalahkemuramanhati(kepedihan,kesenduan,keburaman
perasaan)yangpatologissifatnya.Biasanyatimbuloleh;rasainferior,sakithatiyangdalam,
penyalahandirisendiridantraumapsikis.Jikadepresiitupsikotissifatnya,makaia
disebutmelankholi.
Berdasarkanbeberapapendapatdiatasdapatditarikkesimpulanbahwadepresiadalah
gangguanmood,kondisiemosionalberkepanjanganyangmewarnaiseluruhprosesmental
(berpikir,berperasaandanberperilaku)seseorang,munculperasaantidakberdayadan
kehilanganharapanyangdisertaiperasaansedih,kehilanganminatdankegembiraan,
berkurangnyaenergiyangmenujukepadameningkatnyakeadaanmudahlelahyangsangat
nyatadanberkurangnyaaktivitas.
3.3.2.Etiologi
Beberapaahlijugamemberikanpenjelasanmengenaipenyebabdepresi.Menurut
KaplandalamTarigan(2003)Faktorfaktoryangdihubungkandenganpenyebabdapatdibagi
atas:faktorbiologi,faktorgenetikdanfaktorpsikososial.Dimanaketigafaktortersebutjuga
dapatsalingmempengaruhisatudenganyanglainnya

1.FaktorBiologi
Dalampenelitianbiopsikologi,norepinefrindanserotoninmerupakandua
neurotransmitteryangpalingberperandalampatofisiologigangguanmood.Beberapapeneliti
jugamenemukanbahwagangguanmoodmelibatkanpatologikdansistemlimbiksserta
gangliabasalisdanhypothalamus.
2.FaktorGenetik
Datagenetikmenyatakanbahwafaktoryangsignifikandalamperkembangangangguan
moodadalahgenetik.Padapenelitiananakkembarterhadapgangguandepresiberat,pada
anakkembarmonozigotadalah50%,sedangkandizigot1025%.
3.FaktorPsikososial
Mungkinfaktorinilahyangbanyakditelitiolehahlipsikologi.Faktorpsikososialyang
memyebabkanterjadinyadepresiantaralain;
a.Peristiwakehidupandanstresslingkungan:suatupengamatanklinikmenyatakanbahwa
peristiwaataukejadiandalamkehidupanyangpenuhketeganganseringmendahuluiepisode
gangguanmood.
b.FaktorkepribadianPremorbid:Tidakadasatukepribadianataubentukkepribadianyang
khusussebagaipredisposisiterhadapdepresi.Semuaorangdengancirikepribadianmanapun
dapatmengalamidepresi,walaupuntipetipekepribadiansepertioraldependen,obsesi
kompulsif,histerikmempunyairisikoyangbesarmengalamidepresidibandingkandengan
lainnya.
c.FaktorPsikoanalitikdanPsikodinamik:Freudmenyatakansuatuhubunganantara
kehilanganobjekdanmelankoli.Iamenyatakanbahwakemarahanpasiendepresidiarahkan
kepadadirisendirikarenamengidentifikasikanterhadapobjekyanghilang.Freudpercaya
bahwaintrojeksimerupakansuatucaraegountukmelepaskandiriterhadapobjekyang
hilang.depresisebagaisuatuefekyangdapatmelakukansesuatuterhadapagresiyang
diarahkankedalamdirinya.Apabilapasiendepresimenyadaribahwamerekatidakhidup
sesuaidenganyangdicitacitakannya,akanmengakibatkanmerekaputusasa.
d.Ketidakberdayaanyangdipelajari:Didalampercobaan,dimanabinatangsecaraberulang
ulangdihadapkandengankejutanlistrikyangtidakdapatdihindarinya,binatangtersebut
akhirnyamenyerahdantidakmencobasamasekaliuntukmenghindarikejutanselanjutnya.
Merekabelajarbahwamerekatidakberdaya.
e.TeoriKognitif:BeckmenunjukkanperhatiangangguankognitifpadadepresiAsikalH.S.
dalamTarigan(2003)Diamengidentifikasikan3polakognitifutamapadadepresiyang
disebutsebagaitriadkognitif,yaitu:a)Pandangannegatifterhadapmasadepan,b)
Pandangannegatifterhadapdirisendiri,individumenganggapdirinyatakmampu,bodoh,
pemalas,tidakberharga,c)Pandangannegatifterhadappengalamanhidup.Meyer
berpendapatbahwadepresiadalahreaksiseseorangterhadappengalamanhidup.
f.Penyebabdepresiadalahfaktorbiologi,faktorgenetikdanfaktorpsikososial.Dimanaketiga
faktortersebutjugadapatsalingmempengaruhisatudenganyanglainnya.
3.3.3.ManifestasiKlinis
Individuyangterkenadepresipadaumumnyamenunjukkangejalapsikis,gejalafisik&
sosialyangkhas.Beberapaorangmemperlihatkangejalayangminim,beberapaorang
lainnyalebihbanyak.Tinggirendahnyagejalabervariasipadaindividudanjugabervariasi
dariwaktukewaktu.Berikutinibeberapagejaladaridepresi:
Terusmenerusmerasasedih,cemas,atausuasanahatiyangkosong
Perasaanputusasadanpesimis.

Perasaanbersalah,tidakberdayadantidakberharga.
Kehilanganminatataukesenangandalamhobidankegiatanyangpernahdinikmati.
Penurunanenergidanmudahkelelahan.
Kesuultanberkonsentrasi,mengingat,ataumembuatkeputusan.
Insomnia,pagihariterbangun,atautidurberlebihan.
Nafsumakanberkurangbahkansangatberlebihan.Penurunanberatbadanbahkan
penambahanberatbadansecaradrastis.
Selaluberpikirkematianataubunuhdiri,percobaanbunuhdiri
Gelisahdanmudahtersinggung
Terusmenerusmengalamigejalafisikyangtidakresponterhadappengobatan,sepertisakit
kepala,gangguanpencernaan,dansakitkronis
Padaumumnyagejaladepresiantaralainmurung,sedihberkepanjangan,sensitif,
mudahmarahdantersinggung,hilangnyarasapercayadiri,hilangnyakonsentrasidan
menurunnyadayatahan.
3.3.4.PenatalaksanaanMedis
a.TerapiMedis
ObatAntiDepresangolonganserotoninSelektifReuptakeInhibitor(SSRI)danSerotonin
NorephinephrineReuptakeInhibitor(SNRI)
Benzodiazepine(obatpenenang)
Alphrazolam,Lorazepam,(anticemas)
b.TerapiKomplementer
Terapirekreasi
Pengertian
Terapirekreasiadalahkegiatanpenyegarankembalitubuhdanpikirandankegiatanyang
menggembirakanhatisepertihiburanataupiknik.Rekreasidapatmeningkatkandayakreasi
manusiadalammencapaikesinambunganantarabekerjadanberistirahat.
Terapirekreasipadalansiaadalahaktivitasyangdilakukanpadawaktusenggang
bertujuanuntukmembentuksertameningkatkankembalikesegaranfisik,mental,pikirandan
dayarekreasi(individualmaupunkelompok)yanghilangakibataktivitasrutinseharihari
dengancaramencarikesenangan,hiburan,dankesibukanyangberbeda.Rekreasidapat
memberikankepuasansertakegembiraanyangditujukanbagikepuasanlahirdanbatinlansia.
Teoriterapirekreasi
Terapirekreasiyangdiberikankepadalansiaakanmemengaruhikondisifisikdanpsikis
lansia.Secarafisikterapirekreasimampumembantulansiadalammengembalikanatau
memperbaikikondisifisikyangsudahlamajarangdigerakkanakibathospitalisasiyanglama.
Secarapsikisterapirekreasiakanmempengaruhipsikislansiasepertimembantu
menyegarkanotakdanpikiran,membuatperasaanmenjaditenang,senang,sertanyaman.
Dandemikian,lansiatidakakanmerasacemas,stressmaupundepresi.
Tujuanterapirekreasi
1.Menciptakandanmembinahubunganmanusia.
2.Mempertahankannilainilaibudaya.
3.Menimbulkankesenangandankepuasankarenadapatmemenuhirasaingintahu.
4.Memulihkankesehatanjasmanidanrohani.

Indikasiterapirekreasi
1.Lansiayangbarukeluardarirumahsakitsetelahperawatanselamalebihdari2minggu.
2.Lansiayangsedangmengalamicemas,stress,maupundepresi.
3.Lansiayangmempunyaipenyakitkronis.
Kontraindikasiterapirekreasi
1.Lansiayangkondisinyaharustirahbaringtotalmsalnyasrokeataupascaoperasitumorotak.
2.Lansiayangmengalamidemensia,ganguanjiwa,danketergantungantotal.
Teknikterapirekreasi
Persiapan
Persiapanalat:
1.Tidakmembutuhknaalatkhususuntukjenisrekreasiyangtujuannyajalanjalan.
2.Untukrekreasiyangbersifatolahragadibutuhkanalatolahragayangakandilakukan,
misalnyaperalatangolfjikaolahragayangdilakukanadalahgolf.
3.Untukrekreasiyangbersifatpermainan,perludipersiapkanalatpermainansepertipermainan
catur.
4.Bagilansiayangaktivitassetiapharinyamembutuhkankacamata,tongkat,kursiroda,
maupunalatbantujalanyanglain,keluargaperlumempersiapkan.
Persiapanlingkungan:
1.Tidakadapersiapankhususuntuklingkungan,hanyatergantungdaritingkatrekreasimana
yangakandikunjungi.
2.Hindarilokasiyangakanmenimbulkanresikociderabagilansiasepertitangga,gunungatau
tempatyangtinggijanganmeninggalkanlansiasendirianditepitangga,kolamrenangatau
laut.
3.Hindaritempatyangterlaluramaikarenaakanmembuatpusinglansia.
4.Hindaritempatyangpanas,ajakketempatyangsuasananyasejuk.Terutamapadalansiayang
memilikiganguuanpernafasan.
Persiapanklien:
1.Pastikankliendalamkondisiyangsehat
2.Janganmengajaklansiapergirekreasidenganpaksaansebabdapatmempengaruhifungsi
darirekreasidanlansiatidakakanmenikmatipiknik.
3.Pastikanalatyangbiasadigunakanlansiaselaludibawa.
Prosedur
1.Memilihjenisrekreasiyangdiinginkanlansia.
2.Memilihtujuanrekreasiyangakandikunjungi.
3.Mempersiapakankebutuhanyangakandiperlukanlansia.
4.Janganlupamelihatkondisilansiasebelum,selamaperjalanan,saatditempattujuan,dan
setelahrekreasi.
Kriteriaevaluasi
1.Tanyakanapakahlansiamerasasenangdanpuasdenganrekreasiyangdilakukan.
2.Pastikanbahwalansiatidakmerasacemas,stress,maupundepresisetelahperjalanrekreasi
tersebut.
3.Pantaukondisilansiasepertikondisifisiksepertilemah.
4.Pastikanlansiatidaklupauntukmenkonsumsiobatobatanapabilasedangsakit.
5.Evaluasiapakahtempatrekreasiyangdikinjungitadibisadijadikantempatberkunjungrutin
ataujustrutidakcocokdikunjungilagi.

3.4.Gangguansistempencernaan:gastritis
3.4.1Pengertian
Gastritisataulebihdikenalsebagaimaghberasaldaribahasayunaniyaitugastro,yang
berartiperut/lambungdanitisyangberartiinflamasi/peradangan.Gastritisbukanmerupakan
penyakittunggal,tetapiterbentukdaribeberapakondisiyangkesemuanyaitumengakibatkan
peradanganpadalambung.Biasanya,peradangantersebutmerupakanakibatdariinfeksioleh
bakteriyangsamadenganbakteriyangdapatmengakibatkanborokdilambungyaitu
Helicobacterpylori.Tetapifactorfactorlainsepertitraumafisikdanpemakaiansecara
terusmenerusbeberapaobatpenghilangsakitdapatjugamenyebabkangastritis.Secara
sederhanadefinisigastritisadalahprosesinflamasipadamukosadansubmukosalambung.
Gastritismerupakangangguankesehatanyangpalingseringdijumpaidiklinik,karena
diagnosisnyaseringhanyaberdasarkangejalaklinisbukanpemeriksaanhistopatologi.
DefinisiGastritismenurutparaahliadalah:
Gastritisadalahsuatuperadanganmukosalambungyangdapatbersifatakut,kronik,difus
ataulokal.SylviaA.Price(1995)
Gastritisadalahsuatuiritasiatauinfeksiyangmenjadikandindingmerah,bengkak,berdarah
danberparut.Dr.RobertB.Cooper(1996).
Gastritisadalahinflamasidarimukosalambung.ArifMansjoer(1999).
Gastritisadalahinflamasidarilambungterutamapadamukosagaster.SujonoHadi(1999).
Gastritisadalahperadanganlokalataupenyebaranpadamukosalambungdanberkembang
dipenuhibakteri.CharleneJ(2001).
KlasifikasiGastritis
Gastritismenurutjenisnyaterbagimenjadi2,yaitu(DavidOvedorf2002):
1.Gastritisakut
Disebabkanolehmencernaasamataualkalikuatyangdapatmenyebabkanmukosa
menjadigangrenatauperforasi.Gastritisakutdibagimenjadiduagarisbesaryaitu:
GastritisEksogenakut(biasanyadisebabkanolehfaktorfaktordariluar,sepertibahan
kimiamisal:lisol,alkohol,merokok,kafeinlada,steroid,mekanisiritasibakterial,obat
analgetik,antiinflamasiterutamaaspirin(aspirinyangdosisrendahsudahdapat
menyebabkanerosimukosalambung)).
GastritisEndogenakut(adalahgastritisyangdisebabkanolehkelainanbadan).
2.GastritisKronik
Inflamasilambungyanglamadapatdisebabkanolehulkusbenignaataumalignadari
lambung,atauolehbakteriHelicobacterpylory(H.Pylory).Gastritiskronikdikelompokkan
lagidalam2tipeyaitutipeAdantipeB.DikatakangastritiskroniktipeAjikamampu
menghasilkanimunsendiri.Tipeinidikaitkandenganatropidarikelenjarlambungdan
penurunanmukosa.Penurunanpadasekresigastrikmempengaruhiproduksiantibodi.
Anemiapernisiosaberkembangpadaprosesini.GastritiskroniktipeBlebihlazim.Tipeini
dikaitkandenganinfeksihelicobacterpyloriyangmenimbulkanulkuspadadindinglambung.
3.4.2Etiologi
1.InfeksikumanHelicobacterpylori(bakteriyangtumbuhdidalamselpenghasillendirdi
lapisanlambung).

Tidakadabakterilainnyayangdalamkeadaannormaltumbuhdidalamlambungyang
bersifatasam,tetapijikalambungtidakmenghasilkanasam,berbagaibakteribisatumbuhdi
lambung.Bakteriinibisamenyebabkangastritismenetapataugastritissementara.
2.Penggunaanantibiotik
Penggunaanantibiotikuntukinfeksiparudicurigaimempengaruhipenularankumandi
komunitaskarenaantibiotikatersebutmampumengeradikasiinfeksiHelicobacterpylori
walaupunpresentasekeberhasilannyarendah.
3.Gangguanfungsisistemimun
Sistemimunyangdimilikiolehseseorangakandapatmenjadipemacureaksi
imunologisterhadapinfeksivirusataujamur.Terdapatbeberapajenisvirusyangdapat
menginfeksimukosalambungmisalnyaentericrotavirusdancalicivirus.Autoimmune
atrophicgastritisterjadiketikasistemkekebalantubuhmenyerangselselsehatyangberada
dalamdindinglambung.Halinimengakibatkanperadangandansecarabertahapmenipiskan
dindinglambung,menghancurkankelenjarkelenjarpenghasilasamlambungdanmenganggu
produksifaktorintrinsic(yaitusebuahzatyangmembantutubuhmengabsorbsivitaminB
12).KekuranganB12,akhirnya,dapatmengakibatkanperniciousanemia,sebuahkonsisi
seriusyangjikatidakdirawatdapatmempengaruhiseluruhsistemdalamtubuh.Autoimmune
atrophicgastritisterjaditerutamapadaorangtua.
4.PenggunaanObatanalgesikantiinflamasinonsteroid
Obatanalgesikantiinflamasinonsteroid(AINS)sepertiaspirin,ibuprofendannaproxen
dapatmenyebabkanperadanganpadalambungdengancaramengurangiprostaglandinyang
bertugasmelindungidindinglambung.Jikapemakaianobatobattersebuthanyasesekali
makakemungkinanterjadinyamasalahlambungakankecil.Tapijikapemakaiannya
dilakukansecaraterusmenerusataupemakaianyangberlebihandapatmengakibatkan
gastritis.
5.Penggunaanalkoholsecaraberlebihan
Alkoholdapatmengiritasidanmengikismukosapadadindinglambungdanmembuatdinding
lambunglebihrentanterhadapasamlambungwalaupunpadakondisinormal.
6.Penggunaankokain
Kokaindapatmerusaklambungdanmenyebabkanpendarahandangastritis.
7.Stressfisik
Stressfisikakibatpembedahanbesar,lukatrauma,lukabakaratauinfeksiberatdapat
menyebabkangastritisdanjugaboroksertapendarahanpadalambung.
8.Radiasiandkemoterapi
Perawatanterhadapkankersepertikemoterapidanradiasidapatmengakibatkanperadangan
padadindinglambungyangselanjutnyadapatberkembangmenjadigastritisdanpepticulcer.
Ketikatubuhterkenasejumlahkecilradiasi,kerusakanyangterjadibiasanyasementara,tapi
dalamdosisbesarakanmengakibatkankerusakantersebutmenjadipermanendandapat
mengikisdindinglambungsertamerusakkelenjarkelenjarpenghasilasamlambung.
3.4.3ManifestasiKlinis
a.Dapatterjadiulserasisuperfisialdanmengarahpadahemoragi
b.Beberapapasienmenunjukanasimptomatik
c.Dapatterjadikolikdandiarejikamakanyangmengiritasitidakdimuntahkantetapimalah
mencapiusus
d.Perdarahansalurancernaberupahematemesisdanmelena.

e.Pasienbiasanyapulihkembalisekitarsehari,meskipunafsumakanmungkinhilangselama
23hari
f.Nyeridisekitaruluhati
g.Mual
h.Muntah
i.Kembung
j.Anorexia
3.4.4PenatalaksanaanMedis
ObatyangdipergunakanuntukgastritisadalahObatyangmengandungbahanbahan
yangefektifmenetralkanasamdilambungdantidakdiserapkedalamtubuhsehinggacukup
amandigunakan(sesuaianjuranpakaitentunya).Semakinbanyakkadarantasidadidalam
obatmaagmakasemakinbanyakasamyangdapatdinetralkansehinggalebihefektif
mengatasigejalasakitgastritisdenganbaik.
Pengobatangastritistergantungpadapenyebabnya.Gastritisakutakibatkonsumsi
alkoholdankopiberlebihan,obatobatNSAIDdankebiasaanmerokokdapatsembuhdengan
menghentikankonsumsibahantersebut.GastritiskronisakibatinfeksibakteriH.pyloridapat
diobatidenganterapieradikasiH.pylori.Terapieradikasiiniterdiridaripemberian2macam
antibiotikdan1macampenghambatproduksiasamlambung,yaituPPI(protonpump
inhibitor).
Untukmengurangigejalairitasidindinglambungolehasamlambung,penderita
gastritislazimdiberiobatyangmenetralkanataumengurangiasamlambung,misalnya(Mayo
Clinic,2007):
1.Antasid:Obatbebasyangdapatberbentukcairanatautabletdanmerupakanobatyang
umumdipakaiuntukmengatasigastritisringan.Antasidamenetralkanasamlambung
sehinggacepatmengobatigejalaantaralainpromag,mylanta,dll.
2.Penghambatasam(acidblocker):Jikaantasidtidakcukupuntukmengobatigejala,dokter
biasanyameresepkanobatpenghambatasamantaralainsimetidin,ranitidin,ataufamotidin.
3.Protonpumpinhibitor(penghambatpompaproton):Obatinibekerjamengurangiasam
lambungdengancaramenghambatpompakecildalamselpenghasilasam.Jenisobatyang
tergolongdalamkelompokiniadalahomeprazole,lanzoprazole,esomeparazol,rabeprazole,
dll.UntukmengatasiinfeksibakteriH.pylori,biasanyadigunakanobatdarigolongan
penghambatpompaproton,dikombinasikandenganantibiotika.
Terapirelaksasinafasdalam
Menurutbrunner&suddart(2002),relaksasinafasadalahpernafasanabdomendengan
frekuensilambatatauperlahan,beriramadannyamanyangdilakukandenganmemejamkan
mata.
Teoriterapirelaksasinafasdalam
Teknikrelaksasimeliputiberbagaimetodeuntukperlambatanbawahtubuhdanpikiran.
Meditasi,relaksasiototprogresif,latihanpernafasan,petunjukgambarmerupakanteknik
relaksasiyangseringdigunakandalampengaturanklinisklienuntukmembantureaksistres
danmengaturkesejahteraansecarakeseluruhan.
Distraksiataupengalihanperhatianakanmenstimulasikontroldesenden,yaitusuatu
sistemserabutyangbarasaldaridalamotakbagianbawahdanbagiantengahdanberakhir
padaserabutinterneuralinhibitordalamkornudorsalisdarimedullaspinalis,yang
mengakibatkanberkurangnyastimulasinyeriyangditransmisikankeotak(smeltzher,2002)

Manfaatterapirelaksasinafasdalam
1.Lansiamendapatkanperasaanyangnyamandantenang
2.Menguranginyeri
3.Lansiatidakmengalamistress
4.Melemaskanototuntukmenurunkanketegangandankejenuhanyangbiasanyamenyertai
nyeri
5.Mengurangikecemasanyangmemburukpersepsinyeri
6.Relaksasinafasdalammempunyaiefekdistraksiataupengalihanperhatian.
Indikasiterapirelaksasinafasdalam
1.Lansiayangmengalaminyeriakuttingkatringansampaidengansedangakibatpenyakit
yangkooperatif
2.Lansiadengannyerikronis(nyeripunggung)
3.Nyeripascaoperasi
4.Lansiayangmengalamistress
Kontraindikasiterapirelaksasinafasdalam
Terapirelaksasinafasdalamtidakdiberikanpadaklienyangmengalamisesaknafas
TeknikTerapirelaksasinafasdalam
Menurutearnest(1989),teknikterapirelaksasinafasdalamdijabarkansebagaiberikut:
1.Klienmenariknafasdalamdanmengisiparudenganudara,dalamtigahitungan(hirup,dua,
tiga)
2.Udaradihembuskanperlahanlahansambilmembiarkantubuhmenjadirelaksdannyaman.
Lakukanpengitunganbersamaklien(hembuskan,dua,tiga)
3.Klienbernafasbeberapakalidenganiramanormal
4.Ulangikegiatanmenariknafasdalamdanmenghembuskannya.Biarkanhanyakakidan
telapakkakiyangrelaks.Perawatmemintaklienmengonsentrasikanpikiranpadakakinya
yangterasaringandanhangat.
5.Klienmengulangilangringandanhangat.
6.Klienmengulangilangkahkeempatdanmengonsentrasikanpikiranpadalengan,perut,
punggungdankelompokototyanglain.
7.Setelahseluruhtubuhklienmerasarelaks,anjurkanuntukbernafassecaraperlahanlahan.
Bilanyeribertambahhebat,kliendapatbernafassecaradangkahkeempatdan
mengonsentrasikanpikiranpadalengan,perut,punggungdankelompokototyanglain.
8.Setelahseluruhtubuhklienmerasarelaks,anjurkanuntukbernafassecaraperlahanlahan.
Bilanyeribertambahhebat,kliendapatbernafassecaradangkaldancepat.
Kriteriaevaluasi
1.Catatskalanyeriyangdirasakankliensesudahtindakan
2.Catatekspresikliensesudahtindakan
3.Catattandatandavitalklien.

BAB4
PENUTUP
4.1Kesimpulan
Terapimedisadalahmeningkatkankesehatandankualitashiduppasien.Optimalisasi
terapimedisharusaman,efektif,pemilihanterapisecarabijakdanpelayanankesehatan
secaraakuratsertaadanyakesepakatanantarapasiendanpemberipelayananberdasarkan
informasiterkini.
Terapikomplementermerupakanterapiholistisatauterapinonbiomedis.Hasil
penelitiantentangpsikoneuroimunologimengungkapkanbahwaprosesinteraktifpada
manusiadengantubuh,pikiran,daninteraksisosialmempengaruhikesejahteraanseseorang.
NCCAM.Menetapkanbahwaterapikomplementersecaragarisbesardidasarkansebagai
kategoriterapipikiranpenghubungtubuh(mindbodyterapies)sementaraterapibiomedis
lebihbanyakmempengaruhiseluruhtubuhdanberfokuspadadampakterapiterhadap
pengibatan.
4.2Saran
Denganadanyamakalahyangkamibuatinitentangterapimedikdanterapi
komlementerdiharapkanpembacaatautemantemansejawatdapatmemperolehmanfaatdari
makalahyangkamibuat.Jikaadapengembanganyangbermanfaatmohonuntukdilayangkan
padapenulismakalahinikarenamasukandaripembacaataubapak/ibudosensangat
mendukungdemikesempurnaanmakalahyangkamibuat.

DAFTARPUSTAKA
Kusumanto,R.,Iskandar,Y.,1981.Depresi,SuatuproblemaDiagnosadanTerapipadapraktek
umum.Jakarta:YayasanDharmaGraha
Kartono,Kartini.2002.PatologiSosial3,GangguangangguanKejiwaan.Jakarta:RajawaliPers.
Martono,HadidanKrisPranarka.2010.BukuAjarBoedhiDarmojoGeriatri(IlmuKesehatan
UsiaLanjut).EdisiIV.Jakarta:BalaiPenerbitFKUI
Mubarak,WahidIqbal.2009.IlmuKeperawatanKomunitasKonsepdanAplikasi.Jakarta:
SalembaMedika
Maryam,R.Siti.2008.MengenalUsiaLanjutdanPerawatannya.Jakarta:SalembaMedika
Maslim,Rusdi.2001.PanduanPraktisPenggunaanKlinisObatPsikotropik.Jakarta:BagianIlmu
KedokteranJiwaFKUnikaAtmajaya.
Pudjiastuti,SriSurinidanBudiUtomo.2003.FisioterapiPadaLansia.Jakarta:EGC
Setyoadi,Kushariyadi.2011.TerapiModalitaskeperawatanpadaklienpsikogeriatik.Jakarta:
Salembamedika
Stockslager,JaimeL.2007.BukuSakuAsuhanKeparawatanGeriatrik.EdisiII.Jakarta:EGC
Tarigan,C.,Julita2003.PerbedaanDepresiPadaPasienDispepsiaFungsionaldanDispepsia
Organik.Diaksesdalamhttp://www.usu.go.id.
Watson,Roger.2003.PerawatanPadaLansia.Jakarta:EGC