Anda di halaman 1dari 24

BAB II

TINJAUAN PUSTAKA

2.1 Perawatan Kehamilan


Perawatankehamilanmerupakanpelayanankesehatanolehtenagakesehatan
untukibuselamamasakehamilannyadilaksanakansesuaidenganstandarpelayanan
antenatalyangditetapkan DepkesRI2010
Perawatan kehamilan merupakan suatu program berkesinambungan selama
kehamilanpersalinankelahirandannifasyangterdiriatasedukasiscriningdeteksi
dini pencegahan pengobatan rehabilitasi yang bertujuan untuk memberikan rasa
aman dan nyaman sehingga ibu mampu merawat bayi dengan baik Sosroatmodjo
2010

2.1.1 Tujuan Perawatan Kehamilan
Menurut Mansjoer 2005 tujuan perawatan kehamilan adalah memantau
kemajuan kehamilan untuk memastikan kesehatan ibu dan tumbuh kembang bayi;
meningkatkandanmempertahankankesehatanfisik mentaldansosialibudanbayi;
mengenalisecaradiniadanyaketidaknormalanataukompliksiyang mungkinterjadi
selamahamiltermasukriwayatpenyakitsecaraumum




8

Universitas Sumatera Utara

2.1.2 Asuhan Keperawatan pada Ibu Hamil


2.1.2.1 Tujuan Asuhan Keperawatan


Tujuanasuhankeperawatanpadaibuhamiladalahsebagaiberikut:
a Menentukandiagnosiskehamilandankunjunganulang
b Memonitorsecaraakuratdancermattentangkemajuankehamilan
c Penyuluhan ibu dan keluarga untuk meningkatkan kesehatan dan
kesejahteraanibudanjaninselamakehamilan
d Membantumenurunkankeluhanketidaknyamanan
e Mengidentifikasikankomplikasi


2.1.2.2 Diagnosis Keperawatan ibu pada masa kehamilan


1 TrimesterIkemungkinandiagnosisyangditemukan
a Kecemasan
b Nyeri
c Gangguannutrisi
d Perubahanpolaseksual
2 TrimesterIIkemungkinandiagnosisyangditemukan
a Gangguanrasanyaman:nyeri
b Gangguangambarandiri
c Perubahanproseskeluarga
d Kecemasan
e Perubahanpolaseksual
3 TrimesterIIIkemungkinandiagnosisyangditemukan

Universitas Sumatera Utara

Nyeri Perubahan pola napas tidak efektif Perubahan pola tidur Intoleransi
aktivitasPerubahanpolaseksual
2.1.2.3 Implementasi Keperawatan
ImplementasiKeperawatanpadaTrimesterIyaitupenyuluhantentangnutrisi
aktivitaskebiasaantidurhubunganseksualdanpemakaianobatJadwalkunjungan
sejakkonsepsisampaidengan28minggukehamilansetiap4minggu2936minggu
kehamilansetiap2atas3minggu37minggukehamilansampailahirsetiap1minggu
Informasitandabahayakehamilansepertiperdarahanpervaginandengantandaatau
tanpa nyeri sakit kepala yang berlebihan gangguan penglihatan nyeri abdomen
sertademam
2.1.3. Faktor-faktor yang mempengaruhi perawatan kehamilan
1 Pengalamandengankehamilansebelumnya
2 Harapanbudayadanpersonal
3 Kesehatansebelumhamildankesiapanbiofisikuntukmelahirkananak
4 Statussosialekonomi
5 Usiaibudanstatusberpasanganatautidakberpasangan
6 Tingkatpendidikan
7 Tersedianyasumbersumber
2.1.4. Abortus Spontan
2.1.4.1 Pengertian abortus spontan
Abortus spontan adalah yang terjadi secara alamiah tanpa intervensi luar
buatan untuk mengakhiri kehamilan Wiknjosastro 2005 Sebagai batasan ialah

Universitas Sumatera Utara

kehamilan kurang dari 20 minggu atau berat janin kurang dari 500 gram
Prawirohardjo2009
2.1.4.2 Etiologi
Abortus spontan dapat disebabkan oleh penyebab alamiah yang tidak dapat
diidentifikasiataudarifaktorjanindanplasentasertafaktoribu
1 FaktorJanin
a Perkembanganembriologikyangdefektif
b Kesalahanimplantasiovum
c Penolakanovumolehendoemtrium
d Abnormalitaskromoson
2 FaktorPlasenta
a Pelepasanprematurplasenta
b Implantasiplasentatidaknormal
c Fungsiplasentatidaknormal
3 FaktorIbu
a Infeksi
b Malnutrisiberat
c Abnormalitassistemreproduksi misalnyaserviksinkompeten
d Trauma
e Mengkonsumsiobatobatan




Universitas Sumatera Utara

2.1.4.3 Klasifikasi
1 Abortus iminens adalah peristiwa terjadinya perdarahan dari uterus pada
kehamilan sebelum 20 minggu saat hasil konsepsi masih dalam uterus
tanpaadanyadilatasiserviks
2 Abortus insipiens adalah peristiwa perdarahan uterus pada kehamilan
sebelum20minggudenganadanyadilatasiserviksuterusyangmeningkat
tetapihasilkonsepsimasihdalamuterus
3 Abortus inkompletus adalah pengeluaran hasil konsepsi pada kehamilan
sebelum 20 minggu dengan masih adanya sisa yang tertinggal dalam
uterus
4 Abortus kompletus adalah abortus yang hasil konsepsinya sudah
dikeluarkan
5 Missed abortionadalahkematianjaninberusiasebelum20minggutetapi
janinmatiitutidakdikeluarkanselama8mingguataulebih
2.1.4.4 Manifestasi Klinis
Diduga abortus apabila seorang wanita dalam masa reproduksi mengeluh
tentang perdarahan pervaginam setelah mengalami haid yang terlambat juga sering
terdapatrasamulasdankeluhannyeripadaperutbagianbawah Mitayani2009
2.1.4.5 Tanda bahaya kehamilan
Tanda bahayakehamilan merupakan suatukondisi yangdialamiolehwanita
hamildimanawanitadenganbeberapamasalahtersebutbisaterancamkehamilannya
dan persalinan yang berbahaya Burns dkk 2000  Selama kehamilan seorang ibu
mengalami perubahan fisik yang menyebabkan ketidaknyamanan yang normal dan

Universitas Sumatera Utara

merupakanbagiandariperubahanyangterjadipadatubuhibuselamakehamilannya
Diperlukan kunjungan ke tenaga kesehatan agar ibu mendapat banyak informasi
tentang kondisi normal ibu hamil ataupun ketidaknyamanan yang merupakan tanda
bahaya dalam kehamilan Bahaya kehamilan dapat terdeteksi jika ibu sering
memeriksakankehamilannyaKarenapadasetiapkunjunganantenatalakandiperiksa
kondisi ibu dan janin untuk mengenali tanda bahaya dalam kehamilan tiap
trimesternyaTandabahayadalamkehamilanjikatidakterdeteksiakanmenyebabkan
kematianpadajanindanibu
2.2. Tindakan Perawatan Kehamilan
Menurut Bloom yang dijabarkan oleh Notoadmodjo 2007 Sikap adalah
kecendrunganuntukbertindak PraktikSikapbelumtentuterwujuddalamtindakan
sebabuntukterwujudnyatindakanperlufaktorlainyaitusaranadanprasarana
Tindakan merupakan perbuatan nyata atau aktivitas hasil dari pengaruh
faktor internal dan eksternal individu yang didukung dengan kondisi yang
memungkinkan tampilnya tindakan secara nyata Pengukuran tindakan dapat
dilakukan secara langsung maupun tidak langsung Secara langsung pengukuran
tindakandilakukandenganpengamatandansecaratidaklangsungdilakukandengan
wawancara
Praktekatautindakanmempunyaibeberapatingkatanantaralain;
1 Persepsi yaitu mengenal dan memilih berbagai objek sehubungan dengan
tindakanyangakandiambil;
2 Responsterpimpinyaknimelakukansesuatusesuaidenganurutanyangbenar

Universitas Sumatera Utara

3 Mekanismeyaituapabilaseseorangtelahdapatmelakukansesuatudenganbenar
secaraotomatisatausesuatuitusudahmerupakankebiasaan
4 Adopsi merupakanpraktekatautindakanyangsudahberkembangdenganbaik
Artinya tindakan tersebut sudah dimodifikasinya tanpa mengurangi kebenaran
daritindakantersebut Notoatmodjo2003
Tindakan perawatan kehamilan merupakan perbuatan yang dilakukan untuk
merawatkehamilanmencakuppemeriksaankehamilandanperawatandiriselama
kehamilan  diharapkan dapat  memelihara kesehatan ibu dan janinnya sehingga
meningkatkankesehatanibuhamildanmengurangikomplikasipadakehamilan
2.2.1 Pemeriksaan Kehamilan dalam Antenatal Care (ANC)
Menurut Prawiroharjo 2002 Pemeriksaan kehamilan adalah pengawasan
terhadap ibu hamil dengan mempersiapkan sebaikbaiknya fisik mental ibu dalam
kehamilan persalinan dan post partum sehingga selalu dalam keadaan sehat dan
normal olehkarena itu pelayanan/ asuhanpemeriksaankehamilan merupakancara
penting untuk memonitoring dan mendukung kesehatan ibu hamil normal dan
mendeteksi

sedini

mungkin

bila

ada

kelainan

pada

ibu

hamil            

Saifudinetal2002
Pelayanan antenatal merupakan pelayanan terhadap individu yang bersifat
preventifcareuntukmencegahterjadinyamasalahyangkurangbaikbagiibumaupun
janin Pelayanan antenatal merupakan upaya kesehatan perorangan yang
memperhatikan kualitas pelayanan medis yang diberikan Agar dapat melalui
persalinandengansehatdanamandiperlukankesiapanfisikmentalibusehinggaibu

Universitas Sumatera Utara

dalamkeadaanstatuskesehatanyangoptimalsangat berpengaruhbagipertumbuhan
janinyangdikandungnya
Pemeriksaan kehamilan sebaiknya dilakukan sedini mungkin segera setelah
seorangwanitamerasadirinyahamilDalampemeriksaanantenatalselainkuantitas 
jumlahkunjunganperludiperhatikanpulakualitaspemeriksaannya
Antenatalcaremerupakansalahsatuasuhanyangdiberikanuntukibuhamil
sebelum melahirkan dengan cara memeriksakan kepada dokter bidan atau
puskesmas yang mengoptimalkan kesehatan mental dan fisik ibu hamil hingga
mampumenghadapipersalinannifaspersiapanmenyusuidankembalinyakesehatan
reproduksisecarawajar Manuaba2001
Setiap ibu hamil mengalami risiko komplikasi yang dapat mengancam
jiwanyaOlehkarenaitusetiapwanitahamilperlusedikitnyaempatkalikunjungan
selama periode antenatal Setiap kunjungan ibu akan mendapatkan informasi yang
berkaitan dengan kehamilannya terutama tentang tanda bahaya kehamilan tiap
trimester yang dapat mengancam keselamatan baik ibu maupun janinnya
Pusdisnakes2002
2.2.1.1 Tujuan asuhan pemeriksaan kehamilan
Memantau kemajuan kehamilan untuk memastikan kesehatan ibu dan
tumbuh kembang janin Mengenali secara dini adanya ketidaknormalan atau
komplikasi yang mungkin terjadiselama kehamilan Mempersiapkan ibu agar masa
nifas berjalan normal dan pemberian ASI ekslusif Mempersiapkan peran ibu dan
keluargadalammenerimakelahiranbayiagardapattumbuhdanberkembangsecara
normal Saifuddinetal2002

Universitas Sumatera Utara

2.2.1.2 Asuhan yang diberikan kepada pemeriksaan kehamilan


Pemeriksaankehamilanberdasarkanstandarpelayanan7Tyaitu:
a

Timbangberatbadan

b

Ukurtekanandarah

c

Ukurtinggivundusuteri

d

PemberianimunisasiTTlengkap

e

Pemberiantabletbesiselamakehamilan

f

Testerhadappenyakitmenularseksual

g

Temuwicara
Wahyuningsih2009

2.2.1.3 Kunjungan pemeriksaan kehamilan


Kunjunganibuhamiladalahkontakantaraibuhamildanpetugaskesehatan
yangmemberipelayananantenataluntukmendapatkanpemeriksaankehamilan
Setiap ibu hamil resiko komplikasi yang bisa mengancam jiwanya Oleh
karenaitusetiapwanitahamilmemerlukansedikitnyaempatkalikunjunganselama
periodeantenatal
Satu kali kunjungan selama trimester pertama sebelum 14 minggu Satu
kali kunjungan selama trimester kedua antara minggu 1428 Dua kali kunjungan
selamatrimesterketiga antaraminggu2836minggudansesudahmingguke36
Pada setiap kunjungan antenatal tersebut perlu didapatkan informasi yang
sangatpentingyaitu:



Universitas Sumatera Utara

1 Kunjungantrimesterpertama
Mendeteksi masalah yang dapat ditangani sebelum membahayakan jiwadan
melakukantindakanpencegahananemiakekuranganzat besidanmendorong
perilaku yang sehat gizi kebersihan istirahat olahraga seks dan
sebagainya
2 Kunjungantrimesterkedua
Informasi yangpentingpadatrimester keduasamadengantrimesterpertama
hanya ditambah kewaspadaan khusus mengenai preeklamsia tanya ibu
tentang gejalagejala preeklamsia pantau tekanan darah evaluasi edema
periksauntukmengetahuiproteinuria
3 Kunjungantrimesterketiga
Samasepertipadatrimesterkeduahanyaditambahdenganpalpasiabdominal
untukmengetahuiapakahadakehamilanganda Saifuddinetal2006

2.2.1.4 Dampak dari pemeriksaan kehamilan (antenatal care)
Tujuanutamaasuhanantenataladalahuntukmemfasilitasihasilyangsehat
danpositifbagiibumaupunbayinyadengancaramembinahubungansalingpercaya
dengan ibu mendeteksi komplikasi yang dapat mengancam jiwa mempersiapkan
kelahiran dan memberikan pendidikan Sehingga bila ANC tidak dilakukan
sebagaimanamestinyamakaakanmengakibatkandampak:
1 Ibu hamil akan kurang mendapat informasi tentang cara perawatan kehamilan
yangbenar
2 Tidakterdeteksinyatandabahayakehamilansecaradini

Universitas Sumatera Utara

3 Tidakterdeteksinyaanemiakehamilanyangdapatmenyebabkanperdarahansaat
persalinan
4 Tidak terdeteksinya penyakit penyerta dan komplikasi selama kehamilan serta 
penyakit karena genetik seperti diabetes hipertensi atau cacat kongenital
Sehinggabilatidakditanganiataubilatidakdilakukanscreeningsejakawalakan
mengakibatkan komplikasi pada saat hamil atau pada saat persalinan yang akan
mengarahkepadakematianbaikibumaupunjanin Pusdiknakes2002

2.2.2 Tindakan Perawatan Diri Selama Kehamilan


2.2.2.1 Pengertian perawatan diri
Perawatan diri didefenisikan sebagai cara perawatan diri manusia untuk
memeliharakesehatandirimereka Potter2005
2.2.2.2 Tujuan perawatan diri selama hamil
Programperawatanprakonsepsiyangkomperhensifberpotensimembantuwanita
yanginginhamildengancaramengurangirisikomendoronggayahidupsehatdan
meningkatkan  kesiapan  menerima  kehamilan Asuhan prenatal dimulai segera
setelahdiperkirakanterjadikehamilanPerawataninidapatdilakukandalambeberapa
hari setelah terlambat menstruasi terutama bagi mereka yang menginginkan
kehamilannya dan  terapi bagi semua wanita secara umum sebaiknya jangan lebih
darisaatterlambatmenstruasikeduakaliTujuanutamatindakaniniadalah:

Menentukanstatuskesehatanibudanjanin

Menentukanusiagestasijanin

Memulairencanauntukmelanjutkanperawatanobstetrik Bobak2005

Universitas Sumatera Utara

2.2.2.3 Jenis-jenis perawatan diri selama kehamilan


a. Nutrisi pada Wanita Hamil
Kebutuhan gizi ibu hamil meningkat 15 dibandingkan dengan kebutuhan
wanita normal Peningkatan gizi ini dibutuhkan untuk pertumbuhan ibu dan janin
Makanandikonsumsiibuhamil40digunakanuntukpertumbuhanjanindansisanya
60digunakanuntukpertumbuhanibunyaSecaranormalkenaikanberatbadanibu
hamil1113kg
Asupanmakananyangdikonsumsiibuhamilbergunauntuk:
1 Pertumbuhandanperkembanganjanin
2 Menggantiselseltubuhyangrusak
3 Sumbertenaga
Hal penting yang harus diperhatikan ibu hamil adalah makanan yang
dikonsumsiterdiridarisusunan menu yang seimbang yaitu menu yang mengandung
unsurunsursumbertenagapembangunanpengaturandanpelindung
1 SumberTenaga Sumberenergi
Ibuhamilmembutuhkantambahanenergisebesar 300kaloriper harisekitar
15 lebih banyak dari normalnya yaitu 2500 s/d 3000 kalori dalam sehari
Sumberenergidapatdiperolehdarikarbohidratdanlemak
2 SumberPembangunan
Sumberzatpembangunandapatdiperolehdariproteinyangdianjurkansekitar
800 gram/ hari Dari jumlah tersebut sekitar 70 dipakai untuk kebutuhan
janindankandungan


Universitas Sumatera Utara

3 SumberPengaturdanPelindung
Sumber zat pengatur dan pelindung dapat diperoleh dari air vitamin dan
mineral sumber ini dibutuhkan untuk melindungi tubuh dari serangan
penyakitdanmengaturkelancaranprosesmetabolismetubuh
Kehamilan merupakan masa kehidupan yang penting Pada masa itu wanita
hamilharusmempersiapkandirisebaikbaiknyauntukmenyambutkelahiranbayinya
Ibu sehat akan melahirkan bayi yang sehat Salah satu faktor yang berpengaruh
terhadap kesehatannya ialah nutrisi pada wanita hamil tersebut Ibu hamil yang
mengalamikekurangannutrisiselamakehamilan mempunyairesiko kesakitanyang
lebih besar terutama pada trimester III kehamilan dibandingkan dengan ibu hamil
normalAkhirnyamerekamempunyairesikoyanglebihbesaruntukmelahirkanbayi
BBLR prematur kematian saat persalinan pendarahan pasca persalinan yang sulit
karenalemahdanmudahmengalamigangguankesehatan Riskesdas2007
Kehamilan menyebabkan meningkatnya metabolisme energi karena itu
kebutuhan energi dan zat gizi lainnya seperti: kalori protein mineral kalsium
yodium magnesium tembaga selenium kromium mangan kalium natrium
fluoride vitaminasamfolatvitamin Bcomplexzat besi Fekalsium asamfolat
akan meningkat selama kehamilan Peningkatan energi dan zat gizi tersebut
diperlukan untuk pertumbuhan dan perkembangan janin bertambah besarnya organ
kandungan perubahan komposisidan metabolisme tubuh ibu Sehingga kekurangan
zat gizi tertentu yang diperlukan saat hamil dapat menyebabkan janin tumbuh tidak
sempurna Status nutrisi dipengaruhi oleh banyak faktor sepertikurang pendidikan
kemiskinan lingkungan yang buruk kebiasaan makan dan kondisi kesehatan yang

Universitas Sumatera Utara

buruk ibu harus memenuhipanduan makanan yang mengandung zatzat gizidalam


jenis dan jumlah seimbang yaitu karbohidrat protein lemak vitamin mineral
kalsiumfosforzatbesidanairDibawahiniakandijelaskankebutuhanNutrisiuntuk
ibuhamil:
Tabel 1. Asupan makanan harian yang dianjurkan National Research Council
untuk Wanita sebelum hamil dan wanita hamil.
ZatGizi
Kilokalori
Protein g
Vitamin larut dalam lemah
A g
D g
E mg
K g
Vitamin larut-air
C mg
Folat g
Niasin mg
Riboflafin mg
Tiamin mg
PirodiksinB6 mg
KobalaminB12 g
MINERAL
Kalsium mg
Iodium g
Besi mgbesifero
Magnesium mg
Seng mg

TidakHamil
2200
55

800
10
8
55

60
180
15
13
11
16
20
1200
1200
150
15
280
12

Hamil
2500
60

800
10
10
65

70
400
17
16
15
22
22
1200
1200
175
30
320
15


Menurut Sarwono 2007 Pengaruh gizi kurang pada wanita hamil akan
menimbulkan masalah baik pada ibu maupun pada janin yaitu pada ibu akan
menyebabkan persalinan sulit dan lama prematur pendarahan setelah persalinan
serta persalinan dengan operasi cendrung meningkat Menurut Budianto 2009
pengaruhakibat kuranggizipada ibuhamilakanberdampakpadapertumbuhandan
perkembangan janin dan dapat menimbulkan keguguran abortus bayi lahir mati

Universitas Sumatera Utara

KJDKcacatbawaananemiapadabayiBBLRasfiksiaintrapartum Prawirohardjo
2008danCunningham2005
Ibu hamil memerlukan lebih banyak karbohidrat dan protein untuk
menyediakan nutrisi bagi pertumbuhan bayi sehingga penting sekali untuk selalu
mengkonsumsi makanansehat sejakawalkehamilantrimesterpertamadimanaakan
mengalamipeningkatanberatbadanyangsignifikan kuranglebihhingga12pon/6
kgsehinggaharusmakanmakananbergizidenganteratur
Yang harus dihindari adalah berhatihati dalam memilih makanan karena
sekarang banyak makanan yang terkontaminasi oleh bakteri penyebab penyakit
seperti;salmonellaadalahbakteripenyebab sakit panas sakit perut dandiare serius
yang ditemukan dalam telur dan ayam Bakteri itu dapat menyebabkan keguguran
ataukecacatankelahiran Stoppard2006

b. Aktifitas dan Istirahat




Secara umum wanita hamil tidak harus membatasi olahraga asalkan tidak

mengalamikelelahanatauberisiko cederabagidiriataupunbagijaninnyaOlahraga
dankebugarantubuhselama kehamilanpantas mendapat perhatiankhusus Sewaktu
tubuh wanita hamil bertambah besar dan berat badan akan bertambah olahraga
teraturmembantumempertahankankesehatandankenyamanan
Menurut Penny 2007 olahraga yang melenturkan memperkuat otototot
yang paling berpengaruh saat kehamilan termasuk otot dasar panggul perut dan
punggungbagianbawahOlahragajugamembantumempertahankanpernapasanyang
baik peredaran darah dan postur Olahraga pralahir dan kebugaran fisik membantu

Universitas Sumatera Utara

menghilangkanbeberapaketidaknyamanandalamkehamilanmembantumenyiapkan
tubuh untuk persalinan dan meningkatkan kesejahteraan emosional Melakukan
gerakan tubuh ringan misalnya berjalan kaki terutama pada pagi hari  Jangan
melakukan pekerjaan rumah tangga yang berat  dan  hindarkan  kerja  fisik  yang 
dapat menimbulkan kelelahan yang berlebihan biasanya diakibatkan oleh tinggi
tingkathormonkolestrol Prawirohardjo2008
Ibu  hamil  harus  mempertimbangkan  pola  istirahat  dan  tidur  yang
mendukung kesehatan sendiri maupun kesehatan bayinya Kebiasaan tidur larut
malamdankegiatankegiatanmalamhariharusdipertimbangkandankalaumungkin
dikurangihinggaseminimalmungkinTidurmalam8jam/istirahat/tidursiang1
jam
Wanita hamil dianjurkan untuk merencanakan istirahat yang teratur seiring
kemajuan kehamilannya Jadwal istirahat dan tidur perlu diperhatikan dengan baik
karenaistirahatyangteraturdapatmeningkatkankesehatanjasmanidanrohaniuntuk
kepentingan perkembangan dan pertumbuhan janin Tidur pada malam hari selama
kurang lebihdelapanjamdan istirahat dalamkeadaanrilekspadasianghariselama
satujamPadasaathamilwanitadapattidurdanberistirahatdenganberbagaiposisi
yangterpentingadalahdapatmemberikanrasanyaman RahmadanDewi2008
Kapan seorang wanita yang hamil harus berhenti bekerja diluar rumah sangat
bergantung pada jenis pekerjaan bahaya apa yang mengancam dalam lingkungan
pekerjaan dan seberapa besar energi fisik serta mental yang diperlukan dalam
melaksanakanpekerjaanitu Ferrer1999

Universitas Sumatera Utara

Halhal yang perlu diperhatikan dalam pekerjaan atau aktivitas yang


meningkatkan stress berdiri lama sepanjang hari mengangkat sesuatu yang berat
paparan terhadap suhu atau kelembaban yang ekstrimtinggi atau rendah pekerjaan
denganpaparanradiasi
Wanita harus berhatihatidalam membuat rencana perjalanan yang cenderung
lama atau melelahkan duduk diam untuk waktu yang lama dapat menimbulkan
ketidaknyamanan dan mengakibatkan gangguan sirkulasi serta edema tungkai
Bepergian juga dapat menimbulkan masalah lain Biasanya perjalanan jauh akan
meletihkan dan asupan makanan serta minuman cenderung berbeda dengan biasa
dialamiKonstipasiataudiareseringterjadidalamperjalanandanjugadenganberada
ditempat lain terdapat ketidakpastian dalam memperoleh pelayanan medis yang
memuaskan Ferrer1999

c. Kebiasaan Merokok
Kebiasaan merokok dapat mempengaruhi pertumbuhan dan perkembangan
janinyangmengakibatkankemungkinanbesarcacatbawaandanterjadinyaabortus
Kebiasaanmerokokmerupakansalahsatupenyebabberbagaigangguanpada
janin Diantaranya peningkatan resiko keguguran pada trimester awal pendarahan
trimester akhir gangguan pertumbuhan janin sampai kecacatan jadi selain itu ibu
tidak boleh merokok ibu pun tidak boleh merokok Ibu pun tidak boleh menjadi
perokok pasif karena dampaknya sama saja Merokok merupakan salah satu isu
pentingsangatbagisdicermatisaat kehamilankarenaefek yang munculdiakibatkan
merokokadalahkelahiranBBLRpersalinanpretermkematianperinatal

Universitas Sumatera Utara

Merokok selain mempunyai efek membahayakan janin juga membahayakan


ibu berkaitan dengan penyakitpenyakit yang muncul sebagai akibat merokok
misalnyapenyakitparujantunghipertensikankerparudansebagainya

d. Aktifitas Seksual
Masalah hubungan seksual merupakan kebutuhan biologis yang tidak dapat
ditawar tetapi perlu diperhitungkan bagi mereka yang hamil Kehamilan bukan
merupakan halangan untuk melakukan hubungan seksual Pada hamil muda
hubunganseksualsedapat mungkindihindari bilaterdapat keguguranberulangatau
mengancamkehamilandengantandainfeksidanpendarahan
Beberapahasilpenelitiandalamaktivitasseksualpadaibuhamilmerupakanhal
yangtidaktepatTerdapatperubahanyangcukupjelasmengenaikenyamananseksual
selamahamilmungkinterjadipeningkatanataupenurunanlibidoBeberapapendapat
mengenai hubungan seksual selama hamil didasari pada beberapa konsep bahwa
dalam cairan sperma terkandung prostaglandin sehingga merangsang munculnya
kontraksi Kusmiyati2008

2.3 Hubungan Pengetahuan dan Sikap dengan Tindakan Perawatan Kehamilan
2.3.1 Pengertian Pengetahuan
MenurutNotoadmodjo 2007Pengetahuanadalahhasildaritahudanini
terjadi setelah orang melakukan penginderaan terhadap suatu objek tertentu
Penginderaan terjadi melalui panca indera manusia yakni indera penglihatan
pendengaranpenciumanrasadanraba

Universitas Sumatera Utara

Sebagian besar pengetahuan manusia diperoleh melalui mata dan telinga


Pengalaman dan penelitian terbukti bahwa perilaku yang didasari oleh pengetahuan
akan lebih langgeng daripada perilaku yang tidak didasari dengan pengetahuan 
Penelitian Rogers  1974 mengungkapkan bahwa sebelum orang mengadopsi
perilaku baru berperilaku baru didalam diri orang tersebut terjadi proses yang
berurutanyakni:
1 Awareness Kesadaran dimana orang tersebut menyadari dalam arti
mengetahuiterlebihdahuluterhadapstimulus objek
2 Interest Merasa tertarik terhadap stimulus atau objek tersebut disini sikap
sudahmulaitimbul
3 Evaluation Menimbangnimbang terhadap baik dan tidaknya stimulus
tersebutbagidirinyahaliniberartisikaprespondensudahlebihbaiklagi
4 Trial dimana subjek mulai mencoba melakukan sesuatu sesuai dengan apa
yangdikehendakiolehstimulus
5 Adoptiondimanasubjekberperilakubarusesuaidenganpengetahuan
kesadarandansikapnyaterhadapstimulus
Namun demikian dari penelitian selanjutnya Rogers menyimpulkan bahwa
perubahan perilaku tidak selalu melewati tahaptahap tersebut diatas Apabila
penerimaan perilaku baru atau adopsi perilaku melalui proses seperti ini dimana
disadariolehpengetahuan kesadarandansikap yangpositif makaperilakutersebut
akan bersifat langgeng long lasting Sebaliknya apabila perilaku initidak didasari
olehpengetahuandankesadaranakantidakberlangsunglama


Universitas Sumatera Utara

2.3.1.1 Faktor-faktor yang mempengaruhi pengetahuan


1. Pendidikan
Pendidikanadalahsuatuprosesbelajar yangberartidalampendidikanituterjadi
prosespertumbuhanperkembanganatauperubahankearahyanglebihdewasalebih
baikdanlebihmatangpadadiriindividukelompokataumasyarakat
     Pendidikan

mempengaruhi pengetahuan seseorang Hal ini dipengaruhi oleh
semakintingginyapendidikanseseorangmakasemakinbanyakilmudanpengetahuan
yang diperolehnya sesuai dengan jenjang yang dijalaninya Adapun kriteria jenjang
pendidikan antara lain TK SD SMP SMA Perguruan Tinggi Pendidikan yang
tinggi dapat mempengaruhi seseorang untuk bisa mengetahui memahami dan
melakukanapayangdiperolehnya Notoatmodjo2007
2. Umur
      Umur

adalah sebuah konsep yang masih abstrak bahkan cenderung
menimbulkanvariasidalampengukurannyaUmuradalahlamanyaseseoranghidup

dihitung dari tahun lahirnya sampai dengan ulang tahunnya yang terakhir 

Zaluchu2005
3. Pekerjaan
       Pekerjaanadalahjeniskegiatanyangdilakukansuamidanistriyangmenjadi
sumbernafkahkeluargaUntukmemenuhikebutuhandemikelangsunganhidupperlu
bekerjabukansajahanyaayahyangbertanggungjawabuntukmencarinafkahtetapi
banyakibuyangbekerjadiluarrumahuntukmenambahpenghasilan KamusBahasa
Indonesia

Universitas Sumatera Utara

Pekerjaanadalahsesuatuyangdilakukanuntukmencarinafkahuntukmemenuhi
kebutuhan hidupnya Menurut Hurlock orang dewasa yang sarjana biasanya lebih
merasa puas dengan pekerjaannya daripada mereka yang berijazah SMP maka
pekerjaan seseorang dapat mempengaruhi tingkat pengetahuannya tergantung dari
tingkatpendidikanyangdiperolehsebelumnya

2.3.1.2. Pengetahuan dengan tindakan perawatan kehamilan
Pengetahuan merupakan hasil dari tahu dan ini terjadi setelah orang
melakukan penginderaan terhadap suatu objek tertentu Melalui pengetahuan
manusiadapat melakukanperubahanperubahankualitatifindividu sehinggatingkah
lakunyaberkembang
Pengetahuan atau kognitif merupakan domain yang sangat penting dalam
membentuk tindakan seseorang overt behavior Karena dari pengalaman dan
penelitianternyataperilakuyangdidasariolehpengetahuanakanlebihlanggengdari
padaperilakuyangtidakdidasariolehpengetahuan


Didasari pengetahuan yang positif maka seorang ibu hamil akan melakukan

kegiatan yang positif  berdasarkan pengetahuan yang dia dapati untuk melakukan
perawatankehamilandanpentingnyamelakukanpemeriksaankunjungankehamilan
danperawatandiriselamakehamilan





Universitas Sumatera Utara

2.3.2 Sikap
2.3.2.1 Pengertian sikap
Menurut Notoadmodjo 2007 Sikap adalah merupakan reaksi atau respon
seseorangyangmasihtertutupterhadapsuatustimulusatauobjekManifestasisikap
tidak dapat langsung dilihat tetapi hanya dapat ditafsirkan terlebih dahulu dari
perilakuyangtertutupSikapsecara nyatamenunjukkankonotasiadanyakesesuaian
reaksiterhadapstimulustertentu
SikapmempunyaitigakomponenpokoksepertiyangdikemukakanAllport
dalamNotoatmodjo 2003menjelaskanbahwasikapitumempunyaitigakomponen
pokokyaitu: 
a Kepercayaan keyakinanidedankonsepterhadapsuatuobjek
b Kehidupanemosionalatauevaluasiterhadapsuatuobjek
c Kecenderunganuntukbertindak tend to behave
Ketiga komponen ini secara bersamasama membentuk sikap yang utuh
total attitude Pengetahuan berpikir keyakinan dan emosi memegang peranan
pentingdalampenentuansikapyangutuh
Sikapterdiridariberbagaitingkatanyakni Notoatmodjo2003:
a Menerima receiving) artinya bahwa orang subjek danmemperhatikan
stimulusyangdiberikanolehobjek
b Merespon responding) yaitu memberikan jawaban apabila ditanya
mengerjakandanmenyelesaikantugasyangdiberikanolehobjek

Universitas Sumatera Utara

c Menghargai valuing mengajak orang lain untuk mengerjakan atau


mendiskusikan suatu masalah adalah suatu indikasi sikap tingkat tiga
kecenderunganuntukbertindak
d Bertanggungjawab responsible)yaituyangbertanggungjaawabatassegala
sesuatuyangtelahdipilihnyadengansegalaresikoadalahmerupakansikap
yangpalingtinggi
2.3.2.2 Sikap dengan tindakan perawatan kehamilan
Secara umum sikap adalah sebagai kecendrungan untuk berespon secara
positifdannegatifterhadapobjekatausituasitertentuSikapitumerupakankesediaan
diri seseorang individu melaksanakan suatu tindakan tertentu Sikap ibu hamil
merupakan pendapat atau penilaian seseorang terhadap tindakan perawatan
kehamilan dengan pentingnya melakukan pemeriksaan kunjungan kehamilan Sikap
sering diperoleh dari pengalaman sendiri atau orang lain yang paling dekat Sikap
membuat seseorang setuju mendekat tidak setuju menjauhi suatu hal tetapi ada
kalanyasikappositifterhadapnilainilaikesehatantidakterlaluterwujuddalamsuatu
tindakannyata
Beberapacontohbentuksikapibuhamilmengenaitanggapanatausikapibu
terhadappentingnyapemeriksaankehamilanbagiibuakanmembentukperilakuyang
positif mengenai perilaku pemeriksaan antenatal dan perawatan diri selama
kehamilan Sikap ibu hamil yang positif tentang tanda bahaya akan membentuk
perilaku yang positif untuk mencegah terjadinya bahaya dalam kehamilan dan
persalinan Wahyuningsih2009


Universitas Sumatera Utara

2.4 Kerangka Konsep


Berdasarkan tujuan penelitian tinjauan pustaka maka kerangka konsep
penelitiaaniniadalah:

VariabelIndependentVariabelDependent



Pengetahuan



Sikap

TindakanPerawatan
Kehamilan



Gambar 2.4 Kerangka Konsep

2.5 Hipotesa Penelitian


Ada hubunganpengetahuandansikapIbuHamil yang mengalamiAbortus
spontandenganTindakanPerawatanKehamilandiKlinikBersalinBidanNerliDesa
SampeRayaKecamatanBahorokKabupatenLangkatTahun2013

Universitas Sumatera Utara