Anda di halaman 1dari 73

MAKALAH

TAMBANG TERBUKA
Tahapan Penambangan Batubara

Disusun Oleh :
PREDDY YOHANES KRISTIANTO

DBD 112 047

PUPUT

DBD 112 048

RANDY FEBRIANTO

DBD 112 051

RENI WULANDARI

DBD 112 052

SETIAWAN

DBD 112 055

HERVINDA IKA. N.P

DBD 112 070

ANDREST AGRISTO

DBD 112 183

BOBBY

DBD 112

KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN


UNIVERSITAS PALANGKA RAYA
FAKULTAS TEKNIK
JURUSAN TEKNIK PERTAMBANGAN
2015

KATA PENGANTAR
Puji Tuhan kami panjatkan puja dan puji syukur atas kehadirat Tuhan
Yang Maha Esa, yang telah melimpahkan berkat-Nya kepada kami, sehingga kami
dapat menyelesaikan makalah Tambang Terbuka ini dengan topik Tahapan
Penambangan Batubara.
Adapun

makalah

Tambang

Terbuka

ini

dengan

topik

Tahapan

Penambangan Batubara. ini telah kami usahakan semaksimal mungkin dan


tentunya dengan bantuan teman -teman, sehingga dapat memperlancar pembuatan
makalah ini. Untuk itu kami tidak lupa menyampaikan banyak terima kasih
kepada semua pihak yang telah membantu kami dalam pembuatan makalah ini.
Namun tidak lepas dari semua itu, kami menyadari sepenuhnya bahwa ada
kekurangan baik dari segi penyusun bahasanya maupun segi lainnya. Oleh karena
itu dengan lapang dada dan tangan terbuka kami membuka selebar-lebarnya bagi
pembaca yang ingin memberi saran dan kritik kepada kami sehingga kami dapat
memperbaiki makalah ini.
Akhirnya penyusun mengharapkan semoga dari makalah ini dapat diambil
hikmah dan manfaatnya sehingga dapat memberikan inspirasi terhadap pembaca.

Palangkaraya, 02 April 2015

Penyusun

DAFTAR ISI
HALAMAN JUDUL.........................................................................................
KATA PENGANTAR........................................................................................
DAFTAR ISI......................................................................................................
DAFTAR GAMBAR.........................................................................................

i
ii
iii
iv

BAB I

1
1
1
2
3
3

BAB II

PENDAHULUAN.............................................................................
1.1 Latar Belakang.............................................................................
1.2 Tujuan Penulisan.........................................................................
1.3 Rumusan Masalah.......................................................................
1.4 Manfaat Penulisan.......................................................................
1.5 Metode Penulisan........................................................................

PEMBAHASAN................................................................................
2.1 Tahapan-tahapan Kegiatan Penyelidikan Umum
(Prospecting)...............................................................................
2.2 Tahapan Kegiatan Eksplorasi (Exploration)................................
2.2.1..........................................................................................Met
ode Eksplorasi....................................................................
2.2.2..........................................................................................Sur
vey Tinjau...........................................................................
2.2.3..........................................................................................Pros
peksi...................................................................................
2.2.4..........................................................................................Eks
plorasi Pendahuluan...........................................................
2.2.5..........................................................................................Tah
ap Eksplorasi Detail...........................................................
2.2.6..........................................................................................Keg
iatan Lapangan (Eksplorasi)...............................................
2.3 Study Kelayakan..........................................................................
2.4 Perencanaan Tambang.................................................................
2.4.1..........................................................................................Perh
itungan Cadangan Bijih......................................................
2.4.2..........................................................................................Pert
imbangan Dasar Perencanaan Tambang.............................
2.4.3..........................................................................................Das
ar Pemilihan Sistem Penambangan....................................
2.4.4..........................................................................................Ran
cangan Teknis Penambangan.............................................

2.5 Penambangan Batubara...............................................................


2.5.1..........................................................................................Met
ode Penambangan Batubara...............................................
2.5.2..........................................................................................Met
ode Penambangan Secara Tambang Dalam.......................
2.5.3..........................................................................................Met
ode Penambangan Secara Tambang Terbuka.....................
2.5.4..........................................................................................Tek
nik PenambanganLapisan Batubara Tipis..........................
2.6 Tahap Pengolahan Batubara........................................................
2.6.1..........................................................................................Pros
es Pencucian Batubara.......................................................
2.6.2..........................................................................................Mac
am-macam Alat Pencucian Batubara.................................
2.7 Tahap Pemasaran.........................................................................
2.8 Tahapan Pasca Tambang..............................................................
BAB III PENUTUP ..........................................................................................
3.1 Kesimpulan..................................................................................
3.2 Saran............................................................................................
DAFTAR PUSTAKA

DAFTAR GAMBAR
Gambar 2.1
Gambar 2.2

Penyelidikan Umum....................................................................
Bentuk-bentuk dulang atau lenggang dan Serpihan mineral
pada kelokan sungai....................................................................
Gambar 2.3 Macam bentuk penampang sumur uji..........................................
Gambar 2.4 Bentuk penampang parit uji.........................................................
Gambar 2.5 Arah penggalian parit uji.............................................................
Gambar 2.6 Eksplorasi....................................................................................
Gambar 2.7 Sumur Uji (Test Pit).....................................................................
Gambar 2.8 Parit Uji (Trenching)....................................................................
Gambar 2.9 Pemboran.....................................................................................
Gambar 2.10 Studi Kelayakan...........................................................................

BAB I
PENDAHULUAN
1.1 Latar Belakang
Tambang terbuka merupakan satu dari dua sistem penambangan yang
dikenal, yaitu Tambang Terbuka dan Tambang Bawah Tanah, dimana segala
kegiatan atau aktivitas penambangan dilakukan di atas atau relatif dekat
permukaan bumi dan tempat kerja berhubungan langsung dengan dunia luar.
Pertambangan adalah sebagian atau seluruh tahapan kegiatan dalam
rangka penelitian, pengelolaan dan pengusahaan mineral atau batubara yang
rneliputi penyelidikan umum, eksplorasi, studi kelayakan, konstruksi,
penambangan, pengolahan dan pemurnian, pengangkutan dan penjualan,
serta kegiatan pascatambang. Kegiatan dalam usaha pertambangan meliputi
tugas tugas yang dilakukan untuk mencari, mengambil bahan galian dari
dalam kulit bumi, kemudian mengolah sampai bisa bermanfaat bagi
manusia. Secara garis besar tahapan tahapan kegiatan dalam usaha
pertambangan dijelaskan dalam gambar di bawah. Setiap melakukan tahap
tahap kegiatan usaha pertambangan, pengusaha harus memiliki surat
keputusan pemberian Kuasa Pertambangan (KP) atau Surat Izin
Penambangan Daerah (SIPD) yang sesuai dengan tahap kegiatan yang
dilakukan.
Kegiatan ini merupakan langkah awal usaha pertambangan yang
ditujukan untuk mencari endapan-endapan metal atau endapan-endapan
mineral komersil batubara atau non metal. Penyelidikan umum terbatas pada
mineral yang spesifik (tipe mineral tertentu) atau pada area tertentu (negara
atau wilayah) yang memiliki geologic anomaly (keganjilan geologi) yang
mencerminkan adanya karakteristik dari sebuah endapan bahan galian.
Eksplorasi pengertian suatu bentuk kegiatan penggalian informasi atau
kumpulan data-data yang dilakukan dengan tujuan untuk mengumpulkan
beberapa data maupun informasi-informasi yang nantinya akan diteliti atau
di informasikan kepada pihak-pihak lain yang membutuhkanya.

Penambangan batubara terbuka menyebabkan pembukaan lahan yang


luas dan pemindahan lapisan batuan penutup (overburden) dalam jumlah
yang besar.
Kegiatan

pembangunan

seringkali

menyebabkan

kerusakan

lingkungan, sehingga menyebabkan penurunan mutu lingkungan, berupa


kerusakan ekosistem yang selanjutnya mengancam dan membahayakan
kelangsungan hidup manusia itu sendiri. Masalah utama yang timbul pada
wilayah bekas tambang adalah perubahan lingkungan. Perubahan kimiawi
terutama berdampak terhadap air tanah dan air permukaan, berlanjut secara
fisik perubahan morfologi dan topografi lahan. Lebih jauh lagi adalah
perubahan iklim mikro yang disebabkan perubahan kecepatan angin,
gangguan habitat biologi berupa flora dan fauna, serta penurunan
produktivitas tanah dengan akibat menjadi tandus atau gundul.
Bentuk permukaan wilayah bekas tambang pada umumnya tidak
teratur dan sebagian besar dapat berupa morfologi terjal. Pada saat
reklamasi, lereng yang terlalu terjal dibentuk menjadi teras-teras yang
disesuaikan dengan kelerengan yang ada, terutama untuk menjaga
keamanan lereng tersebut. Berkaitan dengan potensi bahan galian tertinggal
yang belum dimanfaatkan, diperlukan perhatian mengingat hal tersebut
berpotensi untuk ditambang oleh masyarakat atau ditangani agar tidak
menurun nilai ekonominya.
Untuk itu diperlukan adanya suatu kegiatan sebagai upaya pelestarian
lingkungan agar tidak terjadi kerusakan lebih lanjut. Upaya tersebut dapat
ditempuh dengan cara merehabilitasi ekosistem yang rusak. Dengan
rehabilitasi tersebut diharapkan akan mampu memperbaiki ekosistem yang
rusak sehingga dapat pulih, mendekati atau bahkan lebih baik dibandingkan
kondisi semula. Dan salah satu cara yang dapat dilakuakan adalah dengan
melakukan reklamasi lahan.
Batubara adalah termasuk salah satu bahan bakar fosil. Pengertian
umumnya adalah batuan sedimen yang dapat terbakar, terbentuk dari
endapan organik, utamanya adalah sisa-sisa tumbuhan dan terbentuk melalui

proses pembatubaraan. Unsur-unsur utamanya terdiri dari karbon, hidrogen


dan oksigen. Batubara juga adalah batuan organik yang memiliki sifat-sifat
fisika dan kimia yang kompleks yang dapat ditemui dalam berbagai bentuk.
Analisa unsur memberikan rumus formula empiris seperti : C137H97O9NS
untuk bituminus dan C240H90O4NS untuk antrasit.
Pembentukan batubara dimulai sejak Carboniferous Period (Periode
Pembentukan Karbon atau Batu Bara) dikenal sebagai zaman batu bara
pertama-yang berlangsung antara 360 juta sampai 290 juta tahun yang lalu.
Mutu dari setiap endapan batu bara ditentukan oleh suhu dan tekanan serta
lama waktu pembentukan, yang disebut sebagai maturitas organik. Proses
awalnya gambut berubah menjadi lignite (batu bara muda) atau brown coal
(batu bara coklat) Ini adalah batu bara dengan jenis maturitas organik
rendah. Dibandingkan dengan batu bara jenis lainnya, batu bara muda agak
lembut dan warnanya bervariasi dari hitam pekat sampai coklat-kecoklatan.
1.2 Tujuan Penulisan
Untuk mengetahui tahapan-tahapan penambangan batubara yang
meliputi : Penyelidikan Umum, Eksplorasi, Study Kelayakan, Perencanaan
Tambang, Proses Penambangan, Pengolahan, Pemasaran serta Pasca
Tambang.

1.3 Rumusan Masalah


Dari latar belakang di atas terdapat beberapa unsur masalah yang akan
dibahas. Diantaranya yaitu:
1. Apa saja tahapan-tahapan kegiatan penyelidikan umum (Prospecting) ?
2. Apa saja tahapan eksplorasi (Exploration) ?
3. Apa saja tahapan kegiatan study kelayakan ?
4. Apa saja kegiatan perencanaan tambang ?
5. Bagaimana proses penambangan batubara ?
6. Bagaimana proses pengolahan batubara ?
7. Apa saja kegiatan pemasaran batubara ?
8. Apa saja kegiatan dari pasca tambang ?
1.4 Manfaat penulisan
Manfaat penulisan makalah tentang tahapan penambangan batubara
yang meliputi : Penyelidikan Umum, Eksplorasi, Study Kelayakan,
Perencanaan Tambang, Proses Penambangan, Pengolahan, Pemasaran serta
Pasca Tambang, khususnya bagi penulis dan umumnya bagi rekan-rekan
supaya dapat mengenal dan memahami bagaimana tahapan penambangan
batubara, khususnya di Kalimantan Tengah.
1.5 Metode penulisan
Penulisan makalah ini diambil dari internet/buku yang diringkas atau
dirangkum menjadi sebuah makalah.

BAB II
PEMBAHASAN

2.1 Tahapan-tahapan Kegiatan Penyelidikan Umum (Prospecting)


Kegiatan ini merupakan langkah awal usaha pertambangan yang
ditujukan untuk mencari endapanendapan mineral komersil maupun
batubara. Penyelidikan umum terbatas pada mineral yang spesifik (tipe
mineral tertentu) atau pada area tertentu (negara atau wilayah) yang
memiliki geologic anomaly (keganjilan geologi) yang mencerminkan
adanya karakteristik dari sebuah endapan bahan galian. Mineral mineral
berharga ini berada dibawah permukaan bumi oleh karena itu diperlukan
cara-cara tertentu untuk menemukannya. Metode pencariannya terbagi
menjadi dua yaitu metode langsung dan tidak langsung.

Gambar 2.1
Penyelidikan umum
Untuk metode langsung biasanya terbatas pada cadangan permukaan
(singkapan ditemukan). Berdasarkan dari penglihatan atau pengamatan
langsung, singkapan cadangan atau dari pecahan-pecahan lepas yang
mengalami pelapukan dari singkapan tersebut. Pada metode langsung
biasanya dilakukan studi geologi beberapa data tambahan dari foto udara
maupun peta topograpi daerah tersebut. Untuk metode tidak langsung yang
mana bahan galiannya tersebunyi biasanya digunakan berupa metode
geofisika. suatu metode yang mendeteksi kejanggalan-kejanggalan yang

disebabkan adanya cadangan mineral dibawah permukaan bumi. Metode


ini biasanya menggunakan analisa gravitasi, seismik magnetik, elektrik,
elektromagnetik dan ukuran radiometrik.
Secara umum, prosedur penyelidikan umum mengikuti langkah
langkah berikut ini :
1. Mencari laporan dan literatur teknik yang sudah dipublikasikan.
2. Mempelajari peta geologi dan peta permukaan yang ada.
3. Mempelajari foto udara dan foto satelit.
4. Menyiapkan peta foto geologi dari informasiinformasi yang ada dan
data foto udara tertentu.
5. Melakukan survei geofisik dari udara pada area yang diselidiki.
6. Membangun pusat operasi (base of operation), mengontrol pemetaan,
dan mengatur pembagian daerah yang diselidiki.
7. Melakukan survei awal mengenai geologi tanah, geofisik, dan
geokimia.
8. Mengumpulkan dan menganalisis data yang didapat.
Prospeksi merupakan kegiatan penyelidikan, pencarian, atau
penemuan endapan-endapan mineral berharga. Atau dengan kata lain
kegiatan ini bertujuan untuk menemukan keberadaan atau indikasi adanya
bahan galian yang akan dapat atau memberikan harapan untuk diselidiki
lebih lanjut. Jika pada tahap prospeksi ini tidak ditemukan adanya
cadangan bahan galian yang berprospek untuk diteruskan sampai ke
tahapan eksplorasi, maka kegiatan ini harus dihentikan. Apabila tetap
diteruskan akan menghabiskan dana secara sia-sia. Sering juga tahapan
prospeksi ini dilewatkan karena dianggap sudah ditemukan adanya
indikasi atau tanda-tanda keberadaan bahan galian yang sudah langsung
bisa dieksplorasi.
Metoda prospeksi antara lain tracing float dan pemetaan geologi dan
bahan galian. metode tracing float ini digunakan terutama pada anak
sungai, yang lebih mudah dilakukan pada musim kemarau. Metode ini
dilakukan untuk mencari atau menemukan float bahan galian yang
diinginkan, yang berasal dari lapukan zone mineralisasi yang melewati
lereng bukit atau terpotong anak sungai dan terhanyutkan oleh aliran
sungai. Dengan melakukan tracing float dari arah hilir ke hulu sungai,

maka bisa diharapkan untuk menemukan adanya zone mineralisasi yang


tersingkap pada arah hulu sungai. Pada metode ini litologi setempat
sebagian besar sudah diketahui.
Kedua, metode pemetaan geologi dan bahan galian. Metode ini
dilakukan apabila litologi setempat pada umumnya tidak diketahui, atau
diperlukan data yang rinci lagi.
Metode Penyelidikan Umum Atau Prospeksi
1) Penelusuran Tebing-Tebing Di Tepi Sungai Dan Lereng-Lereng Bukit
Kegiatan ini berusaha untuk menemukan singkapan (outcrop)
yang bisa memberi petunjuk keberadaan suatu endapan bahan galian.
Bila ditemukan singkapan yang menarik dan menunjukkan tandatanda adanya mineralisasi, maka letak dan kedudukan itu diukur dan
dipetakan. Juga diambil contoh batuannya (rock samples) secara
sistematis untuk diselidiki di laboratorium agar dapat diketahui data
apa yang tersimpan di dalam contoh batuan itu.
2) Penelusuran Jejak Serpihan Mineral (Tracing Float)
Metode untuk menemukan letak sumber serpihan mineral
(mineral cuts = float) yang umumnya berupa urat bijih (vein) endapan
primer di tempat-tempat yang elevasinya tinggi. Caranya adalah
dengan mencari serpihan atau potongan mineral-mineral berharga
(emas, intan, kasiterit, dll) yang keras, tidak mudah larut dalam asam
maupun basa lemah dan memiliki berat jenis yang tinggi dimulai dari
kelokan di hilir sungai.
Pada kelokan sungai sebelah dalam (lihat Gambar 2.2.b.)
diambil beberapa genggam endapan pasir lalu dicuci dengan dulang
atau lenggang (pan/batea/horn ; lihat Gambar 2.2.a.). Bila dari dalam
dulang itu ditemukan serpihan mineral berharga, maka pendulangan di
kelokan sungai diteruskan ke hulu sungai (lihat titik-titik A1, A2 dan
A3 pada Gambar 2.2.b.) sampai serpihan mineral berharga itu tak
ditemukan lagi.
Selanjutnya pencarian serpihan itu dilakukan ke kiri-kanan
tepian sungai dengan cara mendulang tumpukan pasir yang ada di

tepian sungai tersebut. Pekerjaan ini diteruskan ke lereng-lereng bukit


disertai dengan penggalian sumur uji dan parit uji sampai serpihan itu
menghilang dan sumber serpihan yang berupa endapan primer itu
ditemukan. Tetapi mungkin juga sumber serpihan mineral berharga itu
tidak ditemukan.

Gambar 2.2
(a) Bentuk-bentuk dulang atau lenggang dan (b) Serpihan mineral
pada kelokan sungai
Float adalah fragmen-fragmen atau pecahan-pecahan (potonganpotongan) dari badan bijih yang lapuk dan tererosi. Akibat adanya
gaya gravitasi dan aliran air, maka float ini ditransport ke tempattempat yang lebih rendah (ke arah hilir). Pada umumnya, float ini
banyak terdapat pada aliran sungai-sungai.
Tracing (penjejakan

perunutan) float ini

pada

dasarnya

merupakan kegiatan pengamatan pada pecahan-pecahan (potonganpotongan) batuan seukuran kerakal s/d boulder yang terdapat pada
sungai-sungai, dengan asumsi bahwa jika terdapat pecahan-pecahan
yang mengandung mineralisasi, maka sumbernya adalah pada suatu
tempat di bagian hulu dari sungai tersebut. Dengan berjalan ke arah
hulu, maka diharapkan dapat ditemukan asal dari pecahan (float)
tersebut.
Intensitas, ukuran, dan bentuk butiran float yang mengandung
mineralisasi (termineralisasi) dapat digunakan sebagai indikator untuk
menduga jarak floatterhadap sumbernya. Selain itu sifat dan
karakteristik sungai seperti kuat arus, banjir, atau limpasan juga dapat

menjadi faktor pendukung. Selain dengan tracing float, dapat juga


dilakukan tracing dengan

pendulangan

tracing

with

panning).

Pada tracing float, material yang menjadi panduan berukuran kasar


(besar), sedangkan dengan menggunakan dulang ditujukan untuk
material-material yang berukuran halus (pasir s/d kerikil). Secara
konseptual tracing dengan pendulangan ini mirip dengan tracing float.
Informasi-informasi yang perlu diperhatikan adalah :
Peta jaringan sungai.
Titik-titik (lokasi) pengambilan float.
Titik-titik informasi dimana float termineralisasi

tidak

termineralisasi.
Titik-titik informasi kuantitas dan kualitas float.
Lokasi dimana float mulai hilang.
Pada lokasi dimana float mulai hilang, dapat diinterpretasikan

bahwa zona sumber float telah terlewati, sehingga konsentrasi


penelitian selanjutnya dapat dilakukan pada daerah dimana float
tersebut mulai hilang. Secara teoritis, pada daerah dimana
float tersebut hilang dapat dilakukan penelitian lanjutan dengan
menggunakan uji paritan (trenching) dan uji sumuran (test pitting).

3) Penyelidikan Dengan Sumur Uji (Test Pit)


Untuk memperoleh bukti mengenai keberadaan suatu endapan
bahan galian di bawah tanah dan mengambil contoh batuan (rock
samples)-nya

biasanya

digali

sumur

uji

(test

pit)

dengan

mempergunakan peralatan sederhana seperti cangkul, linggis, sekop,


pengki. Bentuk penampang sumur uji bisa empat persegi panjang,
bujur sangkar, bulat atau bulat telur (ellip) yang kurang sempurna
(lihat Gambar 2.3). Tetapi bentuk penampang yang paling sering
dibuat adalah empat persegi panjang; ukurannya berkisar antara 75 x

100 m sampai 150 x 200 m. Sedangkan kedalamannya tergantung dari


kedalaman endapan bahan galiannya atau batuan dasar (bedrock)nya
dan kemantapan (kestabilan) dinding sumur uji. Bila tanpa penyangga
kedalaman sumur uji itu berkisar antara 4 - 5 m.
Agar dapat diperoleh gambaran yang representatif mengenai
bentuk dan letak endapan bahan secara garis besar, maka digali
beberapa sumur uji dengan pola yang teratur seperti empat persegi
panjang atau bujur sangkar (pada sudut-sudut pola tersebut digali
sumur uji) dengan jarak-jarak yang teratur pula (100 - 500 m), kecuali
bila keadaan lapangan atau topografinya tidak memungkinkan.
Dengan ukuran, kedalaman dan jarak sumur uji yang terbatas
tersebut, maka volume tanah yang digali juga terbatas dan luas
wilayah yang rusak juga sempit.

Gambar 2. 3
Macam bentuk penampang sumur uji
Test pit (sumur uji) merupakan salah satu cara dalam pencarian
endapan atau pemastian kemenerusan lapisan dalam arah vertikal.
Pembuatan sumur uji ini dilakukan jika dibutuhkan kedalaman yang
lebih (> 2,5 m). Pada umumnya suatu deretan (series) sumur uji dibuat
searah jurus, sehingga pola endapan dapat dikorelasikan dalam arah
vertikal dan horisontal. Sumur uji ini umum dilakukan pada eksplorasi
endapan-endapan yang berhubungan dengan pelapukan dan endapanendapan berlapis. Pada endapan berlapis, pembuatan sumur uji
ditujukan untuk mendapatkan kemenerusan lapisan dalam arah
kemiringan, variasi litologi atap dan lantai, ketebalan lapisan, dan
karakteristik variasi endapan secara vertikal, serta dapat digunakan
sebagai lokasi sampling. Biasanya sumur uji dibuat dengan kedalaman

sampai menembus keseluruhan lapisan endapan yang dicari, misalnya


batubara dan mineralisasi berupa urat (vein).
Pada endapan yang berhubungan dengan pelapukan (lateritik
atau residual), pembuatan sumur uji ditujukan untuk mendapatkan
batas-batas zona lapisan (zona tanah, zona residual, zona lateritik),
ketebalan masing-masing zona, variasi vertikal masing-masing zona,
serta pada deretan sumur uji dapat dilakukan pemodelan bentuk
endapan. Pada umumnya, sumur uji dibuat dengan besar lubang
bukaan 35 m dengan kedalaman bervariasi sesuai dengan tujuan
pembuatan sumur uji. Pada endapan lateritik atau residual, kedalaman
sumur ujidapat mencapai 30 m atau sampai menembus batuan dasar.
Dalam pembuatan sumur uji tersebut perlu diperhatikan hal-hal
sebagai berikut :
Ketebalan horizon B (zona laterit/residual),
Ketinggian muka airtanah,
Kemungkinan munculnya gas-gas berbahaya (CO2, H2S),
Kekuatan dinding lubang, dan
Kekerasan batuan dasar.
4) Penyelidikan Dengan Parit Uji (Trench)
Pada dasarnya maksud dan tujuannya sama dengan penyelidikan
yang mempergunakan sumur uji. Demikian pula cara penggaliannya.
Yang berbeda adalah bentuknya ; parit uji digali memanjang di
permukaan bumi dengan bentuk penampang trapesium (lihat Gambar
2.4) dan kedalamannya 2-3 m, sedang panjangnya tergantung dari
lebar atau tebal singkapan endapan bahan galian yang sedang dicari
dan jumlah (volume) contoh batuan (samples) yang ingin diperoleh.
Berbeda dengan sumur uji, bila jumlah parit uji yang dibuat banyak
dan daerahnya mudah dijangkau oleh peralatan mekanis, maka
penggalian parit uji dapat dilakukan dengandragline atau hydraulic
excavator (back hoe).

Gambar 2.4
Bentuk penampang parit uji
Untuk menemukan urat bijih yang tersembunyi di bawah
material penutup sebaiknya digali dua atau lebih parit uji yang saling
tegak lurus arahnya agar kemungkinan untuk menemukan urat bijih
itu lebih besar. Bila kebetulan kedua parit uji itu dapat menemukan
singkapan urat bijihnya, maka jurusnya (strike) dapat segera
ditentukan. Selanjutnya untuk menentukan bentuk dan ukuran urat
bijih yang lebih tepat dibuat parit-parit uji yang saling sejajar dan
tegak lurus terhadap jurus urat bijihnya (lihat Gambar 2.5).

Gambar 2.5
Arah penggalian parit uji
Trenching (pembuatan paritan) merupakan salah satu cara dalam
observasi singkapan atau dalam pencarian sumber (badan) bijih /
endapan. Pada pengamatan (observasi) singkapan, paritan uji dila
kukan dengan cara menggali tanah penutup dengan arah relatif tegak
lurus bidang perlapisan (terutama pada endapan berlapis). Informasi
yang diperoleh antara lain ; jurus bidang perlapisan, kemiringan
lapisan, ketebalan lapisan, karakteristik perlapisan (ada split atau
sisipan), serta dapat sebagai lokasi sampling. Sedangkan pada

pencarian sumber (badan) bijih, parit uji dibuat berupa series dengan
arah paritan relatif tegak lurus terhadap jurus zona badan bijih,
sehingga batas zona bijih tersebut dapat diketahui. Informasi yang
dapat diperoleh antara lain ; adanya zona alterasi, zona mineralisasi,
arah relatif (umum) jurus dan kemiringan, serta dapat sebagai lokasi
sampling. Dengan mengkorelasikan series paritan uji tersebut
diharapkan zona bijih/minerasisasi/badan endapan dapat diketahui.
Pembuatan trenching (paritan) ini dilakukan dengan kondisi
umum sebagai berikut :
Terbatas pada overburden yang tipis,
Kedalaman penggalian umumnya 22,5 m (dapat dengan tenaga

manusia atau dengan menggunakan eksavator/back hoe),


Pada kondisi lereng (miring) dapat dibuat mulai dari bagian yang
rendah,

sehingga

dapat

terjadi

mekanisme

self

drainage (pengeringan langsung).


5) Metode Geofisika (Geophysical Prospecting)
Metode geofisika dipakai sebagai alat untuk menemukan adanya
perbedaan (anomali) yang disebabkan oleh adanya endapan bahan
galian yang tersembunyi di bawah permukaan bumi. Pada umumnya
endapan bahan galian yang tersembunyi di bawah permukaan bumi itu
memiliki satu atau lebih sifat-sifat fisik yang berbeda dari sifat fisik
batuan di sekelilingnya, sehingga perbedaannya itu dapat dicatat
(diukur) dengan peralatan geofisika. Metode geofisika ini memang
mahal dan hasilnya tidak selalu teliti dan meyakinkan, karena
tergantung dari kepiawaian dalam melakukan interpretasi terhadap
anomali dan data geologi yang diperoleh. Walaupun demikian metode
ini bisa sangat membantu dalam mengarahkan kegiatan eksplorasi di
kemudian hari.
6) Metode Geokimia (Geochemistry Prospecting)
Metode geokimia dipergunakan untuk merekam perubahanperubahan komposisi kimia yang sangat kecil, yaitu dalam ukuran part
per million (ppm), pada contoh air permukaan (air sungai), air tanah,

lumpur yang mengendap di dasar sungai, tanah dan bagian-bagian dari


tanaman (pepohonan) seperti pucuk daun, kulit pohon dan akar yang
disebabkan karena di dekatnya ada endapan bahan galian atau endapan
bijih (ore body). Pada dasarnya semua endapan bahan galian pada saat
terbentuk akan merembeskan sebagian kecil unsur kimia atau logam
yang dikandungnya ke lapisan batuan di sekelilingnya. Rembesan
unsur kimia atau logam inilah yang ditelusuri dengan metode
geokimia. Oleh sebab itu prospeksi geokimia biasanya dilakukan di
sepanjang aliran sungai dan daerah aliran sungai (DAS) serta di
daratan.
Prospeksi geokimia hanya mampu membantu melengkapi data
dan informasi untuk mengarahkan di daerah mana prospeksi geofisika
harus dilakukan. Tetapi prospeksi geokimia sangat bermanfaat untuk
penyelidikan di daerah yang bila diselidiki dengan geofisika tidak
efektif, terutama untuk pengamatan awal di daerah terpencil yang
luas. Setiap contoh air, tanah dan komponen tumbuh-tumbuhan yang
diambil dengan teliti dan sistematis dari daerah yang sedang diteliti,
kemudian harus dianalisis secara kimiawi dengan reagen yang khas
dan hanya peka untuk unsur kimia atau logam tertentu (a.l. Cu, Pb,
Zn, Ni dan Mo) walaupun kadar unsur kimia atau logam itu sangat
rendah. Hasil analisis kimia khusus itu dipetakan untuk dipelajari
adanya anomali geokimia yang antara lain disebut halos. Prospeksi
geokimia biasanya berlangsung tidak terlalu lama (0,5-1,0 tahun),
sedangkan jumlah contoh (sample) yang diambil dari setiap tempat tak
banyak (1-2 kg).
2.2 Tahapan Kegiatan Eksplorasi (Exploration)
Menurut KBBI (Kamus Besar Bahasa Indonesia)
Eksplorasi adalah Penjelajahan lapangan

dengan

tujuan

memperoleh pengetahuan lebih banyak tentang keadaan, terutama


sumber-sumber alam yang terdapat di tempat itu, penyelidikan,
penjajakan.

Menurut situs Wikipedia berbahasa Inodenisia (id.wikipedia.org)


Eksplorasi adalah tindakan atau mencari atau melakukan
perjalanan dengan tujuan menemukan sesuatu; misalnya daerah yang
tak dikenal, termasuk antariksa (penjelajahan angkasa), minyak bumi
(explorasi minyak bumi), gas alam, batubara, mineral, gua, air, ataupun

informasi.
Menurut Standar Nasional Indonesia (SNI)
Eksplorasi adalah kegiatan penyelidikan geologi yang dilakukan
untuk mengidentifikasi,menetukan lokasi, ukuran, bentuk, letak,
sebaran, kuantitas dan kualitas suatu endapan bahan galian untuk
kemudian dapat dilakukan analisis/kajian kemungkinan dilakukanya
penambangan.

Eksplorasi merupakan kegiatan yang dilakukan setelah prospeksi


atau setelah endapan suatu bahan galian ditemukan yang bertujuan untuk
mendapatkan kepastian tentang endapan bahan galian yang meliputi
bentuk, ukuran, letak kedudukan, kualitas (kadar) endapan bahan galian
serta karakteristik fisik dari endapan bahan galian tersebut.
Selain untuk mendapatkan data penyebaran dan ketebalan bahan
galian, dalam kegiatan ini juga dilakukan pengambilan contoh bahan
galian dan tanah penutup. Tahap ekplorasi ini juga sangat berperan pada
tahan reklamasi nanti, melalui eksplorasi ini kita dapat mengetahui dan
mengenali seluruh komponen ekosistem yang ada sebelumnya.
Tujuan dilakukannya eksplorasi adalah untuk mengetahui sumber
daya cebakan mineral secara rinci, yaitu unutk mengetahui,menemukan,
mengidentifikasi dan menentukan gambaran geologi dam pemineralaran
berdasarkan ukuran, bentuk, sebaran, kuantitaas dan kualitas suatu
endapan mineral unruk kemudian dapat dilakukan pengembangan secara
ekonomis.

Gambar 2.6 Eksplorasi

2.2.1

Metode eksplorasi
Setelah diketahui terdapatnya bahan galian di suatu daerah dalam
kegiatan prospeksi, yang mempunyai prospek untuk dilakukan kegiatan
selanjutnya, maka dilakukanlah eksplorasi dengan metode atau cara antara
lain sebagai berikut:
a. Untuk mengetahui penyebaran secara lateral dan vertical dapat
dilakukan dengan cara membuat parit uji, sumur uji, pembuatan adit
dam pemboran inti.
b. Untuk mengetahui kualitas bahan galian, diambil contoh bahan galian
yang berasal dari titik percontohan dan dianalisis di laboratorium.
c. Pada beberapa jenis bahan galian juga dapat dilakukan beberapa
penyelidikan geofisik seperti seismic, SP, IP dan resistivity.
d. Setelah titik percontohan yang dibuat dianggap cukup memadai untuk
mengetahui penyebaran lateral dan vertical bahan galian, maka dibuat
peta penyebaran cadangan bahan galian dan dilakukan perhitungan
cadangan bahan galian.
e. Selain dari itu, juga kadang-kadang diperlukan analisis contoh batuan
yang berada di lapisan atas atau bawah bahan galian untuk mengetahui
sifat-sifat fisik dan keteknikannya.

2.2.2

Survey Tinjau

Survey tinjau merupakan tahap eksplorasi batubara yang paling awal


dengan tujuan untuk mengidentifikasi daerah-daerah yang mengandung
endapan batubara yang prospek untuk diselidiki lebih lanjut. Kegiatan
yang dilakukan pada tahap ini meliputi studi geologi regional, interpretasi
potret udara, geofisika, dan peninjauan lapangan pendahuluan. Sebelum
dilakukan kegiatan survey tinjau, perlu dilakukan:
a. Studi Literatur
Dalam tahap ini, sebelum memilih lokasi-lokasi eksplorasi
dilakukan studi terhadap data dan peta-peta yang sudah ada (dari surveisurvei terdahulu), catatan-catatan lama, laporan-laporan temuan dll, lalu
dipilih daerah yang akan disurvei. Setelah pemilihan lokasi ditentukan
langkah berikutnya, studi faktor-faktor geologi regional dan provinsi
metalografi dari peta geologi regional sangat penting untuk memilih
daerah eksplorasi, karena pembentukan endapan bahan galian
dipengaruhi dan tergantung pada proses-proses geologi yang pernah
terjadi, dan tanda-tandanya dapat dilihat di lapangan.
b. Survei Dan Pemetaan
Jika peta dasar (peta topografi) dari daerah eksplorasi sudah
tersedia, maka survei dan pemetaan singkapan (outcrop) atau gejala
geologi lainnya sudah dapat dimulai (peta topografi skala 1 : 50.000
atau 1 : 25.000). Tetapi jika belum ada, maka perlu dilakukan pemetaan
topografi lebih dahulu. Kalau di daerah tersebut sudah ada peta geologi,
maka hal ini sangat menguntungkan, karena survei bisa langsung
ditujukan untuk mencari tanda-tanda endapan yang dicari (singkapan),
melengkapi peta geologi dan mengambil contoh dari singkapansingkapan yang penting.
Selain singkapan-singkapan batuan pembawa bahan galian atau
batubara (sasaran langsung), yang perlu juga diperhatikan adalah
perubahan/batas batuan, orientasi lapisan batuan sedimen (jurus dan
kemiringan), orientasi sesar dan tanda-tanda lainnya. Hal-hal penting
tersebut harus diplot pada peta dasar dengan bantuan alat-alat seperti

kompas geologi, inklinometer, altimeter, serta tanda-tanda alami seperti


bukit, lembah, belokan sungai, jalan, kampung, dll. Dengan demikian
peta geologi dapat dilengkapi atau dibuat baru (peta singkapan).
Tanda-tanda yang sudah diplot pada peta tersebut kemudian
digabungkan dan dibuat penampang tegak atau model penyebarannya
(model geologi). Dengan model geologi hepatitik tersebut kemudian
dirancang pengambilan contoh dengan cara acak, pembuatan sumur uji
(test pit), pembuatan paritan (trenching), dan jika diperlukan dilakukan
pemboran. Lokasi-lokasi tersebut kemudian harus diplot dengan tepat di
peta (dengan bantuan alat ukur, teodolit, BTM, dll.).
Dari kegiatan ini akan dihasilkan model geologi, model
penyebaran endapan, gambaran mengenai cadangan geologi, kadar
awal, dll. dipakai untuk menetapkan apakah daerah survei yang
bersangkutan memberikan harapan baik (prospek) atau tidak. Kalau
daerah tersebut mempunyai prospek yang baik maka dapat diteruskan
dengan tahap eksplorasi selanjutnya.
2.2.3

Prospeksi
Pada tahap ini, dilakukan pemilihan lokasi daerah yang mengandung
endapan batubara yang potensial untuk dikembangkan dengan tujuan
untuk mengidentifikasi sebaran dan potensi endapan batubara yang akan
menjadi target eksplorasi selanjutnya. Pemboran uji pada tahap ini
bertujuan untuk mempelajari stratigrafi regional atau litologi, khususnya di
daerah yang mempunyai indikasi adanya endapan batubara. Jarak antar
titik bor berkisar dari 1000 sampai 3000 meter. Pada tahap ini peta yang
dipakai mulai dari 1:50.000 sampai 1:25.000.

2.2.4

Eksplorasi Pendahuluan
Tujuan dari kegiatan ini adalah untuk memperoleh gambaran awal
tentang endapan batubara yang meliputi jarak titik pengamatan, ketebalan,
kemiringan lapisan, bentuk, korelasi lapisan, sebaran, struktur geologi dan
sedimen, kuantitas dan kualitasnya. Jarak antar titik bor berkisar 500

1000 meter, skala peta yang digunakan mulai dari 1: 25.000 sampai
1:10.000. Sesuai dengan Keputusan Direktur Jendral Pertambangan Umum
No. 661.K/201/DDJP/1996 tentang Pemberian Kuasa Pertambangan,
Laporan Kuasa Pertambangan Penyelidikan Umum perlu dilampiri dengan
beberapa peta:

Peta lokasi/situasi,
Peta geologi lintasan dan singkapan (skala 1:25.000),
Peta kegiatan penyelidikan umum, termasuk lokasi sumur uji, parit uji,

pengambilan contoh batubara (skala 1:10.000),


Peta anomali geofisika, bila dilakukan (skala 1:10.000),
Peta penyebaran endapan batubara dan daerah prospek (skala 1:10.000),
Peta wilayah rencana peningkatan Kuasa Pertambangan,
Penampang sumur uji,
Penampang parit uji,
Penampang lubang bor
Dari kegiatan ini akan dihasilkan model geologi, model penyebaran

endapan, gambaran mengenai cadangan geologi, kadar awal, dll. dipakai


untuk menetapkan apakah daerah survei yang bersangkutan memberikan
harapan baik (prospek) atau tidak. Kalau daerah tersebut mempunyai
prospek yang baik maka dapat diteruskan dengan tahap eksplorasi
selanjutnya.
2.2.5

Tahap Eksplorasi Detail


Setelah tahapan eksplorasi pendahuluan diketahui bahwa cadangan
yang ada mempunyai prospek yang baik, maka diteruskan dengan tahap
eksplorasi detail (White, 1997). Kegiatan utama dalam tahap ini adalah
sampling dengan jarak yang lebih dekat (jarak antar titik bor 200 meter),
yaitu dengan memperbanyak sumur uji atau lubang bor untuk
mendapatkan data yang lebih teliti mengenai penyebaran dan ketebalan
cadangan (volume cadangan), penyebaran kadar/kualitas secara mendatar
maupun tegak.
Dari sampling yang rapat tersebut dihasilkan cadangan terhitung
dengan klasifikasi terukur, dengan kesalahan yang kecil (<20%). Sebelum
dilakukan kegiatan ini, dilakukan terlebih dahulu studi kelayakan dan

amdal, geoteknik, serta geohidrologi. Skala peta yang digunakan adalah


1:2.000 sampai 1:500. Pengetahuan atau data yang lebih akurat mengenai
kedalaman, ketebalan, kemiringan, dan penyebaran cadangan secara 3Dimensi (panjang-lebar-tebal) serta data mengenai kekuatan batuan
sampling, kondisi air tanah, dan penyebaran struktur (kalau ada) akan
sangat memudahkan perencanaan kemajuan tambang, lebar/ukuran bahwa
bukaan

atau

kemiringan

lereng

tambang.

Juga

penting

untuk

merencanakan produksi bulanan/tahunan dan pemilihan peralatan tambang


maupun prioritas bantu lainnya. Sesuai dengan Keputusan Direktur Jendral
Pertambangan Umum No. 661.K/201/DDJP/1996 tentang Pemberian
Kuasa Pertambangan, Laporan Kuasa Pertambangan Eksplorasi perlu
dilampiri dengan beberapa peta:
Peta lokasi/situasi
Peta topografi (skala 1:500 sampai 1:2.000)
Peta kegiatan eksplorasi, meliputi lokasi singkapan batubara, sumur
uji, parit uji, pemboran, dan pengambilan contoh batubara (skala
1:2.000 sampai 1:10.000) Peta geologi daerah (skala 1:500 sampai
1:2.000)
Peta penyebaran endapan batubara (skala 1:500 sampai 1:2.000)
Peta perhitungan 2 dimensi batubara (skala 1:500 sampai 1:2.000)
Peta penyebaran kualitas, antara lain nilai kalori, kandungan abu, dan
kandungan sulphur (skala 1:500 sampai 1:2.000)
Peta isopach tanah penutup (skala 1:500 sampai 1:2.000)
Peta isopach ketebalan lapisan batubara (skala 1:500 sampai 1:2.000)
Peta kontur struktur (skala 1:500 sampai 1:2.000)
Penampang geologi
Penampang bor
Penampang/sketsa singkapan batubara
Penampang perhitungan cadangan batubara
Fotokopi hasil analisis contoh batubara dari laboratorium
Peta wilayah rencana peningkatan dan atau penciutan Kuasa
Pertambangan
Dari uraian tentang tahapan kegiatan eksplorasi diatas, dapat
disimpulkan bahwa kegiatan penyelidikan lapangan bertujuan untuk
mendapatkan data tentang sifat fisik-mekanik batuan, struktur geologi dan
kondisi air tanah sampai dengan kedalaman rencana penambangan. Secara

spesifik harus dibuat laporan struktur geologi meliputi litologi, geometri


dan kemiringan dari formasi lapisan batubara, geometri dan komposisi
struktur major seperti patahan, serta domain dan orientasi dari bidangbidang diskontinuitas. Demikian juga dengan data geoteknik terutama sifat
fisik dan mekanik dari overburden, interburden, lapisan batubara dan
batuan alas. Gambaran tentang data level air tanah, permeabilitas dan
aliran air tanah artesis yang diperoleh pada waktu kegiatan pengeboran dan
pemasangan piezometer perlu juga dibuat dalam laporan tertulis.
2.2.6

Kegiatan Lapangan ( Eksplorasi)


1. Pembuatan Sumur Uji ( Test Pit )
Sumur Uji (Test Pit) adalah salah satu usaha untuk memperoleh
ketebalan secara absolut. Teknis pembuatan test pit ini adalah dengan
membuat lubang penggalian (sumuran) secara vertikal dan memotong
tegak lurus strike atau searah dipping, berdimensi panjang x lebar = 1 m
x 1 m, sedangkan kedalaman disesuaikan dengan kebutuhan di
lapangan.

Gambar 2.7 Sumur Uji (Test Pit)


2. Parit Uji (Trenching)
Parit Uji (Trenching) adalah salah satu metode lain untuk
memperoleh ketebalan secara absolut. Teknis pembuatan trenching ini
tidak jauh berbeda dengan pembuatan test pit yaitu dengan cara
membuat paritan sepanjang/searah dengan down dip singkapan batubara

(secara horizontal), berdimensi lebar 50 cm dengan kedalaman parit


tergantung dari posisi kontak antara lapisan penutup (soil) dengan
batubara, sedangkan panjang paritan disesuaikan dengan kebutuhan di
lapangan.

Gambar 2.8 Parit Uji (Trenching)


3. Pemboran
Kegiatan pemboran dimaksudkan untuk melacak secara spesifik
mengenai penyebaran batubara baik ke arah down strike maupun down
dip dari masing-masing singkapan yang telah ditemukan. Hasil data
pemboran diharapkan dapat mengetahui mengenai bentukan batubara
bawah permukaan (coal modellling sub-surface) sehingga dapat
diketahui sumberdaya (resources) batubara yang ada.

Gambar 2.9 Pemboran

Proses pemboran dilakukan dengan 2 unit mesin bor jenis


portable yang sangat populer yakni Tone dan Bell. Dua cara
pemboran yang dilakukan selama pelaksanaan program ini adalah
pemboran putar (Rotary Drilling) lubang terbuka (Open Hole Drilling)
dan pemboran inti pemboran dengan bor besar di lokasi penyelidikan
akan dilakukan pemboran dengan sistem Touch Coring (TC) dengan
total kedalam 800 meter dengan rincian 612,16 meter dilakukan dengan
pemboran Open Hole dan 187,84 meter dengan pemboran Coring.
2.3 Study Kelayakan
Merupakan tahapan akhir dari rentetan penyelidikan awal yang
dilakukan sebelumnya sebagai penentu apakah kegiatan penambangan
endapan bahan galian tersebut layak dilakukan atau tidak. Dasar
pertimbangan yang digunakan meliputi pertimbangan teknis dan ekonomis
dengan teknologi yang ada pada saat ini, dan dengan memperhatikan
keselamatan kerja serta kelestarian lingkungan hidup. Bila tidak atau
belum layak maka data tersebut diarsipkan. Sebelum kegiatan perencanaan
dan perancangan tambang diperlukan kegiatan study kelayakan yang
menyajikan beberapa informasi yaitu :
1. Pendahuluan, ringkasan, pengertian-pengertian.
2. Umum : lokasi, iklim, topografi sejarah, kepemilikan, status lahan,
transportasi, dan lain-lain.
3. Permasalahan lingkungan : kondisi kini, baku, permasalahan yang
perlu dilindungi, reklamasi lahan, study khusus, perizinan.
4. Faktor geologi : keberadaan endapan, genesa, struktur, mineralogi dan
petrografi.
5. Cadangan bahan galian : prosedur eksplorasi, penemuan bahan galian,
6.
7.
8.
9.

perhitungan jumlah cadangan, dan kadar rata-rata.


Perencanaan tambang : development, dan eksploitasi.
Pengolahan : fasilitas ditempat yang diperlukan.
Bangunan dipermukaan : lokasi dan perencanaan konstruksi
Fasilitas pendukung : listrik, pengadaan air, jalan masuk, lokasi tanah

buangan, perumahan, dan lain-lain.


10. Karyawan : tenaga kerja dan staff.

11. Pemasaran : survey ekonomi terhadap permintaan dan penawaran,


harga kontrak jangka panjang, lahan pengganti, dan lain-lain.
12. Biaya : perkiraan biaya development dan biaya eksploitasi baik
langsung tidak langsung dan biaya keseluruhan, biaya pengolahan,
transportasi, peleburan, dan lain-lain.
13. Evaluasi ekonomi : evaluasi cadangan, klarifikasi cadangan dan
sumber daya alam.
14. Proyeksi keuntungan : perhitungan keuntungan minimal (margin)
yang didasarkan pada kisaran COG dan harga

Gambar 2.10 Studi Kelayakan


Studi kelayakan selain merupakan salah satu kewajiban normatif
yang harus dipenuhi dan prasyarat untuk memperoleh IUP Operasi
Produksi. Sesungguhnya apabila dipahami secara benar, studi kelayakan
merupakan dokumen penting yang berguna bagi berbagai pihak,
khususnya bagi pelaku usaha, pemerintah, dan investor atau perbankan.
Dengan demikian, dokumen studi kelayakan bukan hanya seonggok
tumpukan kertas yang di dalamnya memuat konsep, perhitungan angkaangka dan gambar-gambar semata, tetapi merupakan dokumen yang sangat
berguna bagi manajemen dalam mengambil keputusan strategik apakah
rencana tambang tersebut layak untuk dilanjutkan atau tidak. Ruang
lingkup dalam penyusunan studi kelayakan meliputi beberapa aspek yaitu
aspek teknis, K3, lingkungan, ekonomi, sosial, pasca tambang, dan aspek
lainnya.
Hal-Hal yang perlu diperhatikan dalam pembuatan studi kelayakan

Kajian keadaan bahan galian/ cadangan

kajian geoteknik

kajuan geohidrologi

kajian penambangan

kajian pengolahan/pemurnian

kajian pengangkutan

kajian K3

kajian lingkungan hidup

kajian pengembangan masyrakat

kajian pasca tambang

kajian ekonomi
Hal lain yang harus dipahami adalah, studi kelayakan bukan hanya

mengkaji secara teknis, atau membuat prediksi/ proyeksi ekonomis, juga


mengkaji aspek nonteknis lainnya, seperti aspek sosial, budaya, hukum,
dan lingkungan. Studi kelayakan selain berguna dalam mengambil
keputusan jadi atau tidaknya rencana usaha penambangan itu dijalankan,
juga berguna pada saat kegiatan itu jadi dilaksanakan, yaitu:
1. Dokumen studi kelayakan berfungsi sebagai acuan pelaksanaan
kegiatan, baik acuan kerja di lapangan, maupun acuan bagi staf
manajemen di dalam kantor;
2. Berfungsi sebagai alat kontrol dan pengendalian berjalannya pekerjaan;
3. Sebagai landasan evaluasi kegiatan dalam mengukur prestasi pekerjaan,
sehingga apabila ditemukan kendala teknis ataupun nonteknis, dapat
segera ditanggulangi atau dicarikan jalan keluarnya;
4. Bagi pemerintah, dokumen studi kelayakan, merupakan pedoman dalam
melakukan pengawasan, baik yang menyangkut kontrol realisasi
produksi,

kontrol

keselamatan

dan

kesehatan

kerja,

kontrol

pengendalian aspek lingkungan, dan lain-lain.


Adapun aspek-aspek yang menjadi kajian dalam studi kelayakan adalah:

Aspek kajian teknis


1. Kajian hasil eksplorasi, berkaitan dengan aspek geologi, topografi,
sumur uji, parit uji, pemboran, kualitas endapan, dan jumlah
cadangan;
2. Hasil kajian data-data eksplorasi tersebut, sebagai data teknis dalam
menentukan pilihan sistem penambangan, apakah tambang terbuka,
tambang bawah tanah, atau campuran. Dalam perencanaan sistem
penambangan dilakukan juga kajian aspek teknis lainnya, meliputi:
Kajian geoteknik dan hidrologi;
Kajian pemilihan jenis dan kapasitas slat produksi;
Proyeksi produksi tambang dan umur tambang;
Jadwal penambangan, berkaitan dengan sistem shift kerja;
Tata letak sarana utama dan sarana penunjang;
Penyediaan infrastukturtambang, meliputi pembuatan kantor,
perumahan, jalan, dan lain-lain,
3. Kajian pemilihan sistem pengolahan bahan galian.
Aspek kajian nonteknis
1. Kajian

peraturan

perundang-undangan

yang

terkait

aspek

ketenagakerjaan, aturan K3, sistem perpajakan dan retribusi, aturan


administrasi pelaporan kegiatan tambang, dan lain-lain;
2. Kajian aspek sosial budaya dan adat istiadat masyarakat setempat,
meliputi kajian aspek hukum adat yang berlaku, pola perilaku dan
kebiasaan masyarakat setempat.

Kajian pasar
Berkaitan dengan supply and demand, dapat dianalisis dari
karakteristik pasar, potensi, dan pesaing pasar (melalui analisis
terhadap kebutuhan pasar dan supply yang telah berjalan, maupun

dari analisis substitusi produk). Selain itu hal yang paling penting
adalah karakteristik dan standarisasi produk di pasaran.
Kajian kelayakan ekonomis
Perhitungan tentang kelayakan ekonomis, berupa estimasiestimasi dengan mempergunakan beberapa metode pendekatan.
Secara umum, metode pendekatan dimaksud biasanya melalui
analisis Net Present Value (NPV), Benefit Cos Ratio (BCR),
Profitability Index (PI), Internal Rate of Return (IRR), dan Payback
Period.
Kajian kelayakan lingkungan, berbentuk AMDAL dan UKLUPL.
Kajian lingkungan untuk industri pertambangan merupakan
kegiatan yang wajib AMDAL, karena baik dari sisi intensitas,
ruang lingkup kegiatan, maupun dari sisi operasional dan
pengolahan bahan galian merupakan kegiatan-kegiatan yang dapat
menimbulkan dampak serius terhadap lingkungan.
Mencermati uraian di atas, memberikan gambaran bahwa
studi kelayakan pertambangan merupakan studi yang cukup
kompleks, oleh karena itu harus dilakukan secara cermat dan
integratif dari setiap aspek yang berhubungan langsung dengan
kegiatan penambangan. Karena kegiatan penambangan adalah
salah satu kegiatan yang mempunyai sensitivitas sangat tinggi,
terutama yang berkaitan dengan masalah aspek sosial budaya
masyarakat setempat. Walaupun pada umumnya kegiatan tambang
berada di tengah hutan, tetapi untuk beberapa tahun terakhir ini,
boleh dikatakan bahwa kegiatan usaha tambang relatif berdekatan
dengan pemukiman penduduk, sehingga sering bersinggungan
dengan kepentingan masyarakat setempat.
2.4 Perencanaan Tambang
Perencanaan

adalah

penentuan

persyaratan

dalan

mencapai

sasaran,kegiatan serta urutan teknik pelaksanaan berbagai macam kegiatan


untuk mencapai suatu tujuan dan sasaran yang diinginkan. Pada dasarnya
perencanaan dibagi atas 2 bagian utama, yaitu:

1. Perencanaan strategis yang mengscu kepada sasaran secara menyeluruh,


strategi pencapaiannya serta penentuan cara, waktu, dan biaya.
2. Perencanaan operasional, menyangkut teknik pengerjaan

dan

penggunaan sumber daya untuk mencapai sasaran.


Dari dasar perencanaan tersebut diatas, dapat disimpulkan bahwa
suatu perencanaan akan berjalan dengan menggunakan dua pertimbangan
yaitu

pertimbangan

ekonomis

dan

pertimbangan

teknis.

Untuk

merealisasikan perencanaan tersebut dibutuhkan suatu program-program


kegiatan yang sistematis berupa rancangan kegiatan yang dalam
perencanaan penambangan disebut rancangan teknis penambangan
Rancangan teknis ini sangat dibutuhkan karena merupakan landasan dasar
atau konsep dasar dalam pembukaan suatu tambang khususnya tambang
bijih nikel.
2.4.1

Perhitungan Cadangan Bijih


Salah satu tahapan dalam melakukan perencanan tambang adalah
melakukan perhitungan cadangan. Untuk setiap blok atau lubang dalam
bijih harus dihitung kualitas dan kuantitasnya dengan baik. Dengan
menggunakan data hasil perhitungan cadangan maka rencana produksi
dapat dibuat. Untuk mengetahui cadangan bijih nikel di Tanjung Buli
dihitung dengan menggunakan metode area of influence. Data bor yang
dijadikan acuan perhitungan adalah data loging bor spasi 50 meter x 50
meter,dengan data elevasi terbaru. Untuk menghitung volume cadangan
maka didapat dengan mengalikan antara luas blok dengan ketebalan yang
mengandung bijih pada data log bor tersebut. Volume = luas x tebal
Sedangkan menghitung tonnage cadangan diperoleh dari hasil kali volume
blok dengan density insitu. Tonnage = Volume x Density.

2.4.2

Pertimbangan Dasar Perencanaan Tambang


Dalam suatu perencanaan tambang, khususnya tambang bijih nikel
terdapat dua pertimbangan dasar yang perlu diperhatikan, yaitu:

1. Pertimbangan Ekonomis ini menyangkut anggaran. Data untuk


pertimbangan ekonomis dalam melakukan perencanaan tambang
batubara,yaitu:
a. Nilai (value) dari endapan per ton batubara
b. Ongkos produksi, yaitu ongkos yang

diperlukan

sampai

mendapatkan produk berupa bijih nikel diluar ongkos stripping.


c. Ongkosstripping of overburdendengan terlebih dahulu
mengetahui stripping rationya.
d. Keuntungan yang diharapkan dengan mengetahui Economic
Stripping Ratio.
e. Kondisi pasar 3.3.2 Pertimbangan Teknis Yang termasuk dalam
data untuk pertimbangan teknis adalah:
a) Menentukan Ultimate Pit Slope (UPS) Ultimate pit slope
adalah kemiringan umum pada akhir operasi penambangan yang
tidak menyebabkan kelongsoran atau jenjang masih dalam
keadaan stabil. Untuk menentukan UPS ada beberapa hal yang

harus diperhatikan yaitu:


Stripping ratio yang diperbolehkan
Sifat fisik dan mekanik batuan
Struktur Geologi
Jumlah air dalam di dalam batuan
b) Ukuran dan batas maksimum dari kedalaman tambang pada
akhir operasi.
c) Dimensi jenjang/bench Cara-cara pebongkaran atau penggalian
mempengaruhi ukuran jenjang. Dimensi jenjang juga sangat
tergantung pada produksi yang diinginkan dan alat-alat yang
digunakan. Dimensi jenjang harus mampu menjamin kelancaran
aktivitas alat mekanis dan faktor keamanan. Dimensi jenjang ini
meliputi tinggi, lebar, dan panjang jenjang.
d) Pemilihan sistem penirisan yang tergantung kondisi air tanah
dan curah hujan daerah penambangan.
e) Kondisi geometrik jalan Kondisi geometrik jalan terdiri dari
beberapa parameter antara lain lebar jalan, kemiringan jalan,
jumlah lajur, jari-jari belokan, superelevasi, cross slope, dan
jarak terdekat yang dapat dilalui oleh alat angkut.
f) Pemilihan peralatan mekanis yang meliputi:

Pemilihan alat dengan jumlah dan type yang sesuai.


Koordinasi kerja alat-alat yang digunakan.
g) Kondisi geografi dan geologi
Topografi Topografi suatu daerah sangat berpengaruh
terhadap sistem penambanganyang digunakan. Dari faktor
topografi ini, dapat ditentukan cara penggalian, tempat
penimbunan overburden, penentuan jenis alat, jalur-jalur
jalan yang dipergunakan, dan sistem penirisan tambang.
Struktur geologi Struktur geologi ini terdiri atas lipatan,
patahan, rekahan, perlapisan dan gerakan-gerakan tektonis.
Penyebaran batuan
Kondisi air tanah terutama bila disertai oleh stratifikasi dan
rekahan. Adanya air dalam massa ini akan menimbulkan
tegangan air pori.

2.4.3

Dasar Pemilihan Sistem Penambangan


Dengan perkembangan teknologi, sistem penambangan dibagi dalam
tiga sistem penambangan yaitu:

Tambang terbuka yaitu sistem

penambangan yang seluruh kegiatan penambangannya berhubungan


langsung dengan udara luar. Tambang dalam yaitu sistem penambangan
yang aktivitas penambangannya dibawah permukaan atau di dalam tanah.
Tambang bawah air (Under water Mining). Dalam penentuan sistem
penambangan yang akan digunakan ada beberapa hal yang harus
diperhatikan, diantaranya adalah:
Letak kedalaman endapan apakah dekat dengan permukaan bumi atau
jauh dari permukaan.
Pertimbangan ekonomis yang tujuannya untuk memperoleh keuntungan
yang maksimal dengan Mining Recovery yang maksimal dan relatif
aman.
Pertimbangan teknis

Pertimbangan Teknologi.
Ketiga sistem penambangan yang telah disebutkan sebelumnya,
mempunyai kelebihan dan kekurangan masing-masing serta sesuai dengan
karakteristik dari endapan yang akan ditambang. Khusus dalam penelitian
ini akan dibahas sistem penambangan secara tambang terbuka. Metode
penambangan yang biasanya digunakan untuk tambang bijih adalah
metode open pit, open mine, open cut, dan open cast.
Pada kegiatan penambangan menggunakan empat metode diatas,
bijih berasal dari penggalian excavator baik dilakukan sendiri atau dengan
kombinasi alat lain cara penggalian bijih nikel yang digunakan pada
metode penambangan open pit, open cut, open cast dan open mine adalah:
a. Sistem jenjang tunggal (Single Bench) Sistem jenjang tunggal biasanya
dipakai untuk menambang bahan galian yang relatif dangkal dan
memungkinkan unutk beroperasi dengan jenjang tunggal. Tinggi
jenjang maksimum yang stabil, kemiringannya tergantung pada jenis
batuan yang ditambang. Ketinggian jenjang yang aman ditetapkan
dengan mempertimbangkan keselamatan pekerja dan peralatan.
Ketinggian jenjang berhubungan erat dengan kesetabilan permukaan
yang aman adalah apabila alat-alat yang berioperasi dan pekerja dalam
kondisi tidak aman, dimana tempat yang enjadi landasan terdapat
kemungkinan akan runtuh/longsor. Besarnya hasil produksi yang
dihasilkan dengan jenjang tunggal sangat terbatas dan ditentukan oleh
kapasitas alat. Selain itu juga ditentukan oleh luas permukaan kerja
(front).
b. Sistem jenjang bertingkat (Multiple bench) Penambangan dengan
jenjang bertingkat umumnya digunakan untuk menambang bahan galian
yang kompak (massive) dan endapan bijih tebal yang sanggup
ditambang jika menggunakan cara penambangan dengan jenjang
tunggal. Jenis batuannya harus kuat dan keras agar dapat mendukung
beban yang ada diatasnya.

Kemiringan lereng dapat dibuat lebih vertikal jika daya dukung


batuan besar. Pit slope bervariasi antara 20 - 70. Dari horizontal. Hal
ini diaksud agar mendapatkan perolehan bijih yang lebih banyak lagi.
Kestabilan jenjang perlu dijaga terutama untuk mempertinggi faktor
keamanan. Untuk menghindari kecelakaan, beberapa cara dapat
dilakukan yaitu dengan pembersihan bongkah-bongkah batu yang
menempel

pada dinding

jenjang, mengetahui

daerah

kritis,

pengeringan, dan memonitor pergerakan dan pergeseran. Pada


pemilihan sistem penambangan secara tambang terbuka ada beberapa
faktor yang berpengaruh terhadap pemilihan sistem penambangan,
yaitu:
Jumlah Tanah Penutup
Tanah penutup atau overburden yaitu tanah yang berada di
atas lapisan bijih. Sebelum pengambilan bijih, terlebih dahulu tanah
penutupnya harus dikupas. Jumlah dari tanah penutup harus
diketahui dengan jelas untuk menentukan nilai Stripping Ratio.
Jumlah Cadangan Bijih
Dari data hasil pemboran dan eksplorasi, dapat diketahui
jumlah cadangan bijih yang dapat ditambang (mineable). Dari
jumlah bijih nikel hasil perhitungan cadangan tersebut terdapat
standar pengurangan yang digunakan oleh perusahaan sehinggga
diperoleh mining recovery. Standar pengurangan tersebut dapat
berupa: - Geologi faktor - Mining loss Dilution.
Batas Penambangan (Pit Limit) dan Stripping ratio
Batas penambangan ditentukan dengan cara menentukan
daerah yang layak untuk diproduksi. Cara penentuannya adalah
dengan memisahkan daerah yang layak dalam masalah kadar,
diman kelayakan kadar adalah cut off grade (COG). COG adalah
kadar rata-rata terendah yang asih menguntungkan. Kemudian
langkah selanjutnya adalah menghitung stripping ratio (SR). SR
adalah

perbandingan

antara

volume

tanah

penutup

yang

dipindahkan per satuan berat bijih (satuan m3/ton). Sehingga


dengan mengetahui nilai SR, maka dari daerah yang sudah
memenuhi syarat COG dilihat lagi SRnya. Jika SRnya lebih besar
dari SR yang ditentukan perusahaan, maka daerah tersebut tidak
layak untuk diproduksi.
2.4.4

Rancangan Teknis Penambangan


Rancangan teknis penambangan merupakan bagian dari suatu
perencanaan tambang. Rancangan penambangan ini merupakan program
penambangan yang akan dikerjakan dan telah diberikan batas-batas dan
aturan tegas yang harus dipenuhi dalam setiap aktivitasnya sebagai bagian
dari keseluruhan perencanaan tambang tersebut. Setelah menganalisa dasar
dari pemilihan sistem penambangan, maka dibuat suatu rancangan
penambangan atau teknis pelaksanaan penambangan tersebut. Analisa
yang dibuat berupa metode penambangan yang akan diterapkan.

Persiapan Penambangan
Persiapan penambangan merupakan kegiatan pendahuluan dari
aktivitas

penambangan.

Persiapan

penambangan

ini

berupa

pembersihan areal yang akan ditambang (Land Clearing), pembuatan


jalan tambang, penanganan masalah air (drainase) dan pengupasan
tanah penutup (Stripping OB). Pembersihan lahan adalah suatu
pekerjaan tahap awal pada kegiatan penambangan. Pembersihan lahan
ini dilakukan untuk menyingkirkan pepohonan dan semak belukar yang
tubuh di sekitar areal penambangan dan mempersiapkan akses masuk
ke tambang atau pembuatan jalan angkut. Penanganan masalah air
tambang

mencakup

pembuatan

saluran,

sumuran,

dan

kolam

pengendapan. Dimensi saluran, sumuran dan kolam pengendapan harus


dibuat sesuai dengan debit air yang ada sehingga air tambang tidak
langsung mengalir ke air bebas yang dapat menimbulkan masalah
lingkungan. Pekerjaan pengupasan yang dilakukan pada tanah
penutup,biasanya dilakukan bersama-sama dengan clearing dengan

menggunakan alat bulldozer. Pekerjaan ini dimulai dari tepat yang lebih
tinggi, dan tanah penutup didorong ke bawah ke arah yang lebih rendah

sehingga alat dapat bekerja dengan bantuan gaya gravitasi.


Desain Jenjang dan Analisis Kemantapan Lereng
Karena letak bijih berada dilapisan bawah dari permukaan dan
tertutup oleh lapisan tanah penutup, maka untuk mencapai lapisan bijih
itu biasanya dibuat jenjang/bench. Suatu jenjang yang dibuat harus
mampu menampung dan mempermudah pergerakan alat-alat mekanis
pada saat aktivitas pengupasan tanah penutup dan pengambilan bijih.
Dimensi suatu jenjang dapat ditentukan dengan mengetahui data
produksi yang diinginkan, peralatan mekanis yang digunakan, material
yang digali, jenis pembongkaran dan penggalian yang dipergunakan
dan batas kedalaman penggalian atau tebalnya lapisan bijih, serta data
sifat mekanik dan sifat fisik batuan unutk kestabilan lereng.
Dimensi dari pada jenjang adalah:
a. Panjang jenjang
Panjang jenjang tergantung pada produksi yang diinginkan dan
luas dari areal penambangan atau dibuat sampai pada batas
penambangan yang direncanakan. Pada dasarnya adalah alat-alat
mekanis yang digunakan mempunyai ruang gerak yang cukup untuk
bermanuver dalam aktivitasnya.
b. Lebar jenjang
Lebar jenjang dirancang sesuai dengan jarak yang dibutuhkan
oleh alat mekanis dalam beroperasi, dalam hal ini alat gali/muat dan
alat angkut. Untuk menghitung lebar jenjang minimum dapat
dihitung dengan menggunakan persamaan:
Wmin = 2R +JP + C + JA
Dimana: W min = Lebar jenjang minimum
R

= Radius putar alat muat excavator back hoe

JP

= Jangkauan penumpahan BH

= Lebar alat angkut

JA

= Jarak aman

c. Tinggi jenjang
Tinggi jenjang adalah jarak vertikal yang diukur dari kaki
jenjang ke puncak jenjang tersebut. Tinggi jenjang dibuat tergantung
dari faktor keamanan suatu lereng dan tinggi maksimum penggalian
dari alat gali yang digunakan. Analisis kemantapan lereng (slope
stability) diperlukan sebagai pendekatan untuk memecahkan masalah
kemungkinan longsor yang akan terjadi pada suatu lereng. Lereng
pada daerah penambangan dapat mengalami kelongsoran apabila
terjadi perubahan gaya yang bekerja pada lereng tersebut. Perubahan
gaya ini dapat terjadi karena pengaruh alam atau karena aktivitas
penambangan. Kemantapan lereng tergantung pada gaya penggerak
(driving force) yaitu gaya yang menyebabkan kelongsoran dan gaya
penahan (resisting force) yaitu gaya penahan yang melawan
kelongsoran yang ada pada bidang gelincir tersebut serta tergantung
pada besar atau kecilnya sudut bidang gelincir atau sudut lereng.
Ada beberapa faktor yang mempengaruhi kemantapan dari
lereng diantaranya adalah:
Geometri lereng
Sifat fisik dan mekanik tanah/batuan
Struktur geologi
Pengaruh air tanah
Pengaruh gaya-gaya luar
Kedudukan lereng terhadap bidang perlapisan batuan
Faktor waktu.
Longsoran pada suatu lereng dapat terjadi dengan beberapa
bentuk atau cara. Hal ini yang membuat analisa dari kemantapan lereng
sangat penting menurut Hoek & Bray (1981), klasifikasi longsoran
dapat dibagi atas :
1. Longsoran busur
Bidang gelincir dari longsoran ini mempunyai bentuk busur
lingkaran. Longsoran ini biasanya terjadi pada lereng dengan batuan
yang sudah mengalai pelapukan, tanah atau batuan yang ikatan

anatarbutirnya relatif lemah. Analisis kemantapan lereng dengan


bentuk longsoran busur adalah yang paling banyak dipakai terutama
pada pekerjaan sipil dan pertambangan atau tambang terbuka di
daerah tropis.
2. Longsoran bidang (Plane failure)
Pergerakan material pada jenis longsoran ini akan melalui satu
bidang luncur. Bidang luncur adalah bidang lemah pada lereng
perlapisan, sesar, dan kekar. Longsoran ini dapat terjadi jika terdapat
bidang luncur dan arah bidang luncur relatif sejajar dengan
kemiringan lereng. Kemiringan lereng lebih besar dari sudut geser
dalam dan terdapat bidang bebas pada kedua sisi lereng.
3. Longsoran baji (wedge failure)
Bidang luncur dari longsoran jenis ini merupakan dua bidang
lemah yang saling berpotongan. Arah pergerakan akan searah dengan
garis perpotongan bidang lemah tersebut.
4. Longsoran guling ( topling failure)
Longsoran guling terjadi pada jenis batuan yang keras dan
pada batuan tersebut banyak terdapat bidang lemah yang relatif
sejajar satu sama lain. Kondisi yang memungkinkan terjadinya
longsoran ini adalah jika kemiringan lereng berlawanan arah dengan
kemiringan bidang-bidang lemahnya. Longsoran tanah pada daerah
penambangan diasumsikan bahwa:
a. Material yang membentuk lereng dianggap homogen dngan sifat
mekanik akibat beban sama ke segala arah.
b. Longsoran yang terjadi menghasilkan bidang luncur berupa busur.
c. Tinggi permukaan air pada lereng adalah jenuh sampai kering
sesuai dengan standar yang telah ditetapkan.
Untuk menganalisa keungkinan longsoran, ada beberapa macam
cara yang digunakan. Salah satu diantara cara yang digunakan
adalah dengan menggunakan diagaram Hoek & Bray dimana
tanah dengan lima macam kondisi permukaan air tanahnya dibagi
ke dalam lima diagram. Pemilihan metode ini selain dan cepat
hasilnya juga cukup teliti dan sering dipergunakan untuk tahap
perancangan.

2.5 Penambangan Batubara


Dalam proses penambangan batubara ada banyak proses yang perlu
dilakukan dalam penambangan batubara juga tidak boleh ditinggalkan
aspek

lingkungan,

agar

setelah

penambangan

selesai

dilakukan,

lingkungan dapat dikembalikan ke keadaan yang baik.


1. Persiapan
Kegiatan ini merupakan kegiatan tambahan dalam tahap
penambangan. Kegiatan ini bertujuan mendukung kelancaran kegiatan
penambangan. Pada tahap ini akan dibangun jalan tambang (acces
road), stockpile, dan lain-lain.
2. Pembersihan lahan (land clearing)
Kegiatan yang dilakukan untuk membersihkan daerah yang akan
ditambang mulai dari semak belukar hingga pepohonan yang
berukuran besar. Alat yang biasa digunakan adalah buldozer ripper
dan dengan menggunakan bantuan mesin potong chainsaw untuk
menebang pohon dengan diameter lebih besar dari 30 cm.
3. Pengupasan Tanah Pucuk (top soil)
Maksud pemindahan tanah pucuk adalah untuk menyelamatkan
tanah tersebut agar tidak rusak sehingga masih mempunyai unsur
tanah yang masih asli, sehingga tanah pucuk ini dapat diguanakan dan
ditanami kembali untuk kegiatan reklamasi. Tanah pucuk yang
dikupas tersebut akan dipindahkan ke tempat penyimpanan sementara
atau langsung di pindahkan ke timbunan. Hal tersebut bergantung
pada perencanaan dari perusahaan.
4. Pengupasan Tanah Penutup (stripping overburden)
Bila material tanah penutup merupakan material lunak (soft
rock) maka tanah penutup tersebut akan dilakukan penggalian bebas.
Namun bila materialnya merupakan material kuat, maka terlebih
dahulu dilakukan pembongkaran dengan peledakan (blasting)

kemudian dilakukan kegiatan penggalian. Peledakan yang akan


dilakukan perlu dirancang sedemikian rupa hingga sesuai dengan
produksi yang diinginkan.
5. Penimbunan Tanah Penutup (overburden removal)
Tanah penutup dapat ditimbun dengan dua cara yaitu backfilling
dan penimbunan langsung. Tanah penutup yang akan dijadikan
material backfilling biasanya akan ditimbun ke penimbunan sementara
pada saat tambang baru dibuka.
6. Penambangan Batubara (coal getting)
Untuk melakukan penambangan batubara (coal getting) itu
sendiri, terlebih dahulu dilakukan kegiatan coal cleaning. Maksud dari
kegiatan coal cleaning ini adalah untuk membersihkan pengotor yang
berasal dari permukaan batubara (face batubara) yang berupa material
sisa tanah penutup yang masih tertinggal sedikit, serta pengotor lain
yang berupa agen pengendapan (air permukaan, air hujan, longsoran).
Selanjutnya dilakukan kegiatan coal getting hingga pemuatan ke alat
angkutnya. Untuk lapisan batubara yang keras, maka terlebih dahulu
dilakukan penggaruan.
7. Pengangkutan Batubara (coal hauling)
Setelah dilakukan kegiatan coal getting, kegiatan lanjutan
adalah pengangkutan batubara (coal hauling) dari lokasi tambang (pit)
menuju stockpile atau langsung ke unit pengolahan.
8. Pengupasan parting (parting removal)
Parting batubara yang memisahkan dua lapisan atau lebih
batubara

peerlu

dipindahkan

agar

tidak

mengganggu

dalam

penambangan batubara.
9. Backfilling (dari tempat penyimpanan sementara)
Tanah penutup maupun tanah pucuk yang sebelumnya disimpan
di tempat penyimpanan sementara akan diangkut kembali ke daerah
yang telah tertambang (mined out). Kegiatan ini dimaksudkan agar pit
bekas tambang tidak meninggalkan lubang yang besar dan digunakan
untuk rehabilitasi lahan pasca tambang.
10. Perataan dan Rehabilitasi Tanah (spreading)
Terdiri dari pekerjaan penimbunan, perataan, pembentukan, dan
penebaran tanah pucuk diatas disposal overburden yang telah di

backfilling, agar daerah bekas tambang dapat ditanami kembali untuk


pemulihan lingkungan hidup (reclamation).
11. Penghijauan (reclamation)
Merupakan proses untuk penanaman kembali lahan bekas
tambang, dengan tanaman yang sesuai atau hampir sama seperti pada
saat tambang belum dibuka.
12. Kontrol (monitoring)
Kegiatan ini ditujukan untuk pemantauan terhadap aplikasi
rencana awal penambangan. kontrol akan dilakukan terhadap lereng
tambang, timbunan, ataupun lingkungan, baik terhadap pit yang
sedang aktif maupun pit yang telah ditambang.
2.5.1
Metode Penambangan Batubara
Metode penambangan batubara sangat tergantung pada :
Keadaan geologi daerah antara lain sifat lapisan batuan penutup, batuan
lantai batubara dan struktur geologi.
Keadaan lapisan batubaradan bentuk deposit.
Pada dasarnya dikenal dua cara penambangan batubara yaitu :
Cara tambang dalam, dilakukan pertama-tama dengan jalan
membuat lubang persiapan baik berupa lubang sumuran ataupun berupa
lubang mendatar atau menurun menuju ke lapisan batubara yang akan
ditambang. Selanjutnya dibuat lubang bukaan pada lapisan batubaranya
sendiri.
Cara penambangnnya dapat dilakukan :
a. Secara manual, yaitu menggunakan banyak alat yang memakai
kekuatan tenaga manusia.
b. Secara mekanis, yaitu mempergunakan alat sederhana sampai
menggunakan sistem
elektronis dengan pengendalian jarak jauh.
Cara tambang terbuka, dilakukan pertama-tama dengan mengupas
tanah penutup. Pada saat ini metode penambangan mana yang akan
digunakan dipilih dan kemungkinan mendapatkan peralatan tidak
mengalami masalah. Peralatan yang ada sekarang dapat dimodifikasikan
sehingga berfungsi ganda . Perlu diketahui pula bahwa berbagai jenis
batubara memerlukan jenis dan peralatan yang berbeda pula. Mesin-mesin
tambang modern sudah dapat digunakan untuk pekaerjaan kegiatan

penambangan dengan jangkauan kerja yang lebih luas dan mampu


melaksanakan berbagai macam pekerjaan tanpa perlu dilakukan perubahan
atau modifikasi yang besar.
Pemilihan metode penambangan batubara baik yang akan ditambang
secara tambang dalam ataupun tambang terbuka.
2.5.2 Metode Penambangan Secara Tambang Dalam
Pada penambangan batubara dengan metode penambangan dalam
yang peting adalah bagaimana mempertahankan lubang buka seaman
mungkin agar terhindar dari kemungkinan :

Keruntuhan atap batuan


Ambruknya dinding lubang (rib spalling)
Penggelembungan lantai lapisan batubara (floor heave)
Kejadian tersebut diatas disebabkan oleh terlepasnya energi yang

tersimpan secara alamiah dalam endapan batubara. Energi yang terpendam


tersebut merupakan akibat terjadinya perubahan atau deformasi bentuk
endapan batubara selama berlangsungnya pembentukan deposit tersebut.
Pelepasan

energi

tersebut

disebabkan

oleh

adanya

perubahan

keseimbangan tegangan yang terdapat pada massa batuan akibat


dilakukannya kegiatan pembuatan lubang-lubang bukaan tambang.
Disamping itu kegagalan yang disebabkan batuan dan batubara itu tidak
mempunyai daya penyangga di samping faktor-faktor alami dari keadaan
geologi endapan batubara tersebut.
Penambangan batubara secara tambang dalam kenyatannnya sangat
ditentukan

oleh

cara

mengusahakan

agar

lubang

bukaan

dapat

dipertahankan selama mungkin pada saat berlangsungnya penambangan


batubara dengan biaya rendah atau seekonomis mungkin. Untuk mencapai
keinginan tersebut maka pada pembuatan lubang bukaan selalu
diusahankan agar :

Kemampuan penyangga dari atap lapisan


Kekuatan lantai lapisan batubara
Kemampuan daya dukung pilar penyangga.

Namun apabila cara manfaat sifat alamiah tersebut sulit untuk


dicapai, maka beberapa cara penyanggan buatan telah diciptakan oleh ahli
tambang. Metode penambangan secara tambang dalam pada garis besarnya
dapat dibedakan yaitu :
Room and Pillar atau disebut Bord and Pillar
Longwall
Kedua metode tersebut mempunyai kelebihan dan kekurangan
sendiri-sendiri terutama pada keadaan endapan batubara yang dihadapi di
samping faktor lainnya yang perlu diperhatikan dalam pemilihan metode
penambangan tersebut.
a. Metode Room and Pillar
Cara penambangan ini mengandalkan endapan batubara yang
tidak diambil sebagai penyangga dan endapan batubara yang diambil
sebagai room. Pada metode ini penambangan batubara sudah dilakukan
sejak pada saat pembuatan lubang maju. Selanjutnya lubang maju
tersebut dibesarkan menjadi ruanganruangan dengan meninggalkan
batubara sebagai tiang penyagga. Besar bentuk dan ruangan sebagai
akibat pengambilan batubaranya harus diusahakan agar penyangga yang
dipakai cukup memadai kuat mempertahankan ruangan tersebut tetap
aman sampai saatnya dilakukan pengambilan penyangga yang
sebenarnya yaitu tiang penyangga batubara (coal pillar). Metode ini
mempunyai keterbatasan-keterbatasan dalam besaran jumlah batubara
yang dapat diambil dari suatu cadangan batubara karena tidak semua
tiang penyangga batubara dapat diambil secara ekonomis maupun
teknik.
Dari seluruh total cadangan terukur batubara yang dapat diambil
dengan cara penambangan metode Room and Pillar ini paling besar
lebih kurang 30-40% saja. Hal ini disebabkan banyak batubara
tertinggal sebagi tiang-tiang pengaman yang tidak dapat diambil.
b. Metode Longwall
Ada dua cara penambangan dengan menggunakan metode Longwall
yaitu :
Cara maju (advancing)
Cara mundur (retreating)

Pada penambangan dengan metode advancing Longwall terlebih


dahulu dibuat lubang maju yang nantinya akan berfungsi sebagi lubang
utama (main gate) dan lubang pengiring (tail gate), dibuat bersamaan pada
pengambilan batubara dari lubang buka tersebut.
Kedua lubang bukaan tersebut digunakan sebagai saluran udara yang
diperlukan untuk menyediakan udara bersih pada lubang bukaannya di
samping untuk keperluan transportasi batubaranya dan keperluan
penyediaan material untuk lubang bukannya. Metode ini akan memberikan
hasil lebih cepat karena tidak memerlukan waktu menunggu lubang yang
diperlukan yaitu lubang utama dan lubang pengiring.
Pada metode retreating Longwall merupakan kebalikan dari metode
advancing longwall karena pengambilan batubara belum dapat dilakukan
sebelum selesai dibuat suatu panel yang akan memberikan batasan lapisan
batubara yang akan diekstraksi (diambil). Pemilihan salah satu metode
tersebut harus memperhatikan keadaan dan kondisi alami yang diremukan
pada endapan batubara itu sendiri agar nantinya tidak menghadapi
kesulitan-kesulitan selama dilakukan ekstraksi yang pada akhirnya tentu
bertujuan mencari biaya serendah mungkin.
Selain kedua metode tersebut terdapat pula beberapa variasi metode
penambangan yang dapat diterapkan. Hal ini tergantung pada macam dan
jenis serta ketebalan lapisan disamping kemiringan lapisan batubara yang
perlu juga diperhatikan.
Peralatan yang digunakan pada penambangan tambang dalam dapat
dibagi dalam dua kategori yaitu :

Peralatan untuk pekerjaan persiapan


Peralatan untuk pengambilan batubara.
Pada saat ini kemampuan peralatan tambang dalam sudah demikian

maju sehingga seluruih kegiatan pekerjaan fisik yang dilakukan oleh


manusia, praktis sudah dapat digantikan oleh mesin atau alat batu mekanis.
2.5.3 Metode Penambangan Secara Tambang Terbuka

Kelebihan dari tambang terbuka dibandingkan dengan tambang dalam


adalah :

Relatif lebih aman


Relatif lebih sederhana
Mudah pengawasannya
Pada saat ini sebagian besar penambangan batubara dilakukan

dengan metode tambang terbuka, lebih-lebih setelah digunakannya alatalat besar yang mempunyai kapasitas muat dan angkut yang besar untuk
membuang lapisan penutup batubara menjadi lebih murah dan menekan
biaya ekstraksi batubara.
Selain itu prosentase batubara yang diambil jauh lebih besar
dibandingkan dengan batubara yang dapat diekstraksi dengan cara
tambang dalam. Penambangan batubara dengan metode tambang terbuka
saat ini diperoleh 85% dari total mineable reserve, sedang dengan metode
tambang dalam paling besar hanya 50% saja.

Walaupun

demikian

penambangan

secara

tambang

terbuka

mempunyai keterbatasan yaitu :

Dengan peralatan yang ada pada saat sekarang ini keterbatasan

kedalaman lapisan batubara yang dapat ditambang.


Pertimbangan ekonomi antara biaya pembuangan batuan penutup
dengan biaya pengambilan batubara.

Beberapa tipe tambang terbuka :


Tipe penambangan batubara dengan metode tambang terbuka
tergantung pada letak dan kemiringan serta banyaknya lapisan batubara
dalan satu cadangan. Disamping itu metode tambang terbuka dapat
dibedakan juga dari cara pemakain alat dan mesin yang digunakan dalam
penambangan.

Beberapa tipe penambangan batubara dengan metode tambang


terbuka adalah :
a. Contour Mining
Tipe penambangan ini pada umumnya dilakukan pada endapan
batubara yang terdapat di pegunungan atau perbukitan. Penambangan
batubara dimulai pada suatu singkapan lapisan batubara dipermukaan
atau crop line dan selanjutnya mengikuti garis kontur sekeliling bukit
atau pegunungan tersebut. Lapisan batuan penutup batubara dibuang
kearah lereng bukit dan selanjutnya batuan yang telah tersingkap
diambil dan diangkut. Kegiatan penambangan berikutnya dimulai lagi
seperti tersebut diatas pada lapisan batubara yang lain sampai pada
suatu ketebalan lapisan penutup batubara yang menentukan batas limit
ekonominya atau sampai batas maksimum ke dalaman dimana peralatan
tambang tersebut dapat bekerja. Batas ekonomi ini ditentukan oleh
beberapa variabel antara lain :

Ketebalan lapisan batubara


Kualitas
Pemasaran
Sifat dan keadaan lapisan batuan penutup
Kemampuan peralatan yang digunakan
Persyaratan reklamasi
Peralatan yang digunakan untuk cara penambangan ini pada

umumnya memakai peralatan yang mempunyai mobilitas tinggi atau


dikenal sebagai mobil equipment.
Alat-alat besar seperti :

Sebagai alat muat : Wheel Loader, Track Loader, Face Shovel


Backhoe

Sebagai alat angkut jarak jauh : Off Highway Dump Truck


Sebagai alat angkut jarak dekat : Scraper
Alat-alat tersebut dipergunakan untuk pekerjaan pembuangan

lapisan penutup batubara sedangkan untuk pengambilan batubaranya


dapat digunakan alat yang sama atau yang lebih kecil tergantung tingkat

produksinya. Kapasitas alat angkut berupa Off Highway Dump Truck


antara 18 ton sampai 170 ton.
Mengingat batuan penutupnya sangat keras maka digunakan
sistem peledakan ( Blasting system), dengan menggunakan beberapa
unit alat bor drill blasthole Machine yang mempunyai kemampuan bor
berdiameter sampai 6 inches, sedangkan bahan peledaknya digunakan
Ammonium Nitrate dan Solar ANFO.
b. Open Pit Mining
Open Pit Mining adalah penambangan secara terbuka dalam
pengertian umum. Apabila hal ini diterapkan pada endapan batubara
dilakukan dengan jalan membuang lapisan batuan penutup sehingga
lapisan batubaranya tersingkap dan selanjutnya siap untuk diekstraksi.
Peralatan yang dipakai pada penambangan secara open pit dapat
bermacam-macam tergantung pada jenis dan keadaan batuan penutup
yang akan dibuang. Dalam pemilihan peralatan perlu dipertimbangkan :

Kemiringan lapisan batubara


Pada lapisan dengan kemiringan cukup tajam, pembuangan
lapisan penutup dapat menggunakan alat muat baik berupa face
shovel, front end loader atau alat muat yang lainnya.

Masa operasi tambang


Penambangan tipe open pit biasanya dilakukan pada endapan
batubara yang mempunyai lapisan tebal atau dalam dan dilakukan
dengan menggunakan beberapa bench. Peralatan yang digunakan
untuk pembuang lapisan penutup batubara dibedakan sebagai
berikut:
1. Peralatan yang bersifat mobil antara lain Truck Shovel, Front end
loader, Bulldozer, Scrapper.
2. Peralatan yang bersifat bekerja secara kontinu membuang lapisan
penutup tanpa dibantu alat angkut antara lain :

Dragline
Baik yang dengan scrawler maupun walking dragline.
Alat

ini

mengeruk

dan

langsung

membuang

sendiri.

Kapasitasnya bervariasi mulai dari yang kecil kurang dari 5 m


dan jarak buang lebih dari 75 m.

Face Shovel
Ada dua tipe yaitu :
a. Stripping Shovel
Mempunyai kapasitas mangkok (bucket) yang besar
dan jangkauan yang panjang digunakan sebagai alat
pembuangan lapisan penutup batubara tanpa perlu bantuan
alat angkut yang lain. Pada umumnya kapasitas mangkok
berukuran lebih besar dari 20 m , dengan jangkauan buang
lebih dari 25 m.
b. Loading Shovel
Yang dipergunakan sebagai alat muat yang umunya
kapasitas isi mangkok dan panjang jangkauan lebih pendek.
c. Bucket Wheel Excavator
Adalah alat penggali dan pengangkut sekaligus. Alat
ini dapat bekerja sendiri atau dibantu alat lain berupa belt
conveyor dan dapat dibantu dengan alat yang dinamakan
belt transfer, dan selanjutnya pada ujung belt conveyor
dipasang alat yang dinamakan belt spreader yang digunakan
untuk menyebarkan hasil galian batuan penutup ketempat
pembuangan dumping disposal area.

Stripping Mining
Tipe penambangan terbuka yang diterapkan pada
endapan batubara yang lapisannya datar dekat permukaan
tanah. Alat yang digunakan dapat berupa alat yang sifatnya
mobil atau alat penggalian yang dapat membuang sendiri.
Penambangan batubara khususnya di Kalimantan akan dimulai

dengan cara tambang terbuka yang memakai alat kerja bersifat


mobil.
2.5.4 Teknik Penambangan Lapisan Batubara Tipis
Penyebaran batubara tidak selalu diiringi oleh kualitas dan ketebalan
yang menggembirakan, karena sering dijumpai kualitas batubara di suatu
daerah cukup tinggi sementara ketebalannya kurang dari 1 m atau
sebaliknya.
Ketebalan lapisan batubara berhubungan erat dengan teknik
penggaliannya yang sudah barang tentu diarahkan pada efisiensi sistem
penambangan yang secara ekonomi layak diterapkan. Sampai saat ini
untuk menggali lapisan batubara dengan ketebalan kurang dari 1 m, baik
pada tambang bawah tanah maupun terbuka, terbentur pada masalah
pemilihan sistem penambangan yang ekonomis. Misalnya pada sistem
longwall, alat pemotong batubara (shearer) paling kecil yang diproduksi
mempunyai ketinggian 0,81 m, tentu alat ini tidak dapat digunakan
menambang lapisan batubara yang lebih tipis dari 0,81 m. pada
penambangan terbuka, lapisan penutup yang tebal umumnya menjadi
kendala untuk menambang lapisan batubara yang tipis, bila ditinjau dari
aspek ekonomi. Tetapi kendala pemilihan alat penggali lapisan batubara
tipis telah dapat diatasi berkat kemajuan teknologi untuk merancang suatu
alat pembajak batubara (plow) yang dapat digunakan untuk mengekstrak
lapisan batubara dengan ketebalan 0,46 m. Masalah yang timbul kemudian
adalah bagaimana memanfatkan alat bajak ini pada suatu sistem
penambangan batubara tipis.
Cara penambangan batubara tipis yang sedang beroperasi saat ini
secara ekonomi sulit dapat diterima, tetapi cara tersebut terus dilakukan
karena setiap pemerintahan mempunyai kebijakan berbeda dalam
mengelola sumberdaya alam yang strategis yang dimilikinya. Ada
beberapa sistem penambangan lapisan batubara tipis yaitu :
a. Sistem Tarik Kabel-Rantai

Sistem penambangan ini telah diterapkan di Korea untuk


mengekstrak lapisan batubara dengan ketebalan antara 0,3 0,5 m
dengan kemiringan 45 . Tahap persiapan penambangannya , bagian
yang penting yang harus dibuat disamping komponen lain adalah pilarpilar berdimensi 15.2 x 30,5 m diantara dua raise yaitu pilar-pilar
batubara yang akan dipotong menggunakan gesekan rantau penggali.
Pilar-pilar ini juga berfungsi sebagai penyangga sementara pada
saat salah satu pilar sedang dipotong. Disamping itu harus dirancang
pula dua corong di bagian bawah pilar untuk menampung serpihan
batubara.
Rantai pemotong batubara disambung dengan kabel yang
dihubungkan ke mesin penggerak yang dapat menjalankan rantai
pemotong tersebut maju mundur. Mesin penggerak diletakkan pada
level atas, sedangkan pada level bawah tersedia kendaraan penampung
serpihan batubara hasil pemotongan. Penggalian dimulai dari bagian
bawah pilar bergerak ke atas sehingga serpihan batubara mengalir
karena gravitasi menuju dua buah corongan yang dapat menampung
serpihan batubara tersebut dan siap dimuatkan secara periodik kedalam
kendaraan penampung.Diameter nominal rantai pemotong berkisar
antara 100 sampai 200 mm yang sangat efektif digunakan untuk
menggali lapisan batubara dengan ketebalan 0,5 meter.
b. Sistem Backfilling
Konsep sistem backfilling dipersiapkan untuk lapisan batubara
tipis yang relatif datar, untuk itu harus dipersiapkan suatu sistem
pengangkutan yang sesuai dengan ketebalan lapisan batubaranya.
Teknik penggalian dan penyanggaan yang akan diterapkan
mengacu pada sistem longwall, yaitu suatu sistem dengan proses
penambangan dan pengangkutan bergerak maju dan meninggalkan
runtuhan

lapisan

atap

diatap

dibelakang

penyangga.

Dengan

mempertimbangkan tipisnya lapisan batubara dan penyangga yang


harus dapat bergerak maju, maka sistem penyangga bertekan udara

diharapkan sebagai jawaban yang tepat. Dasar konsep ini menggunakan


seoptimal muingkin teknik pengontrolan jarak jauh, baik terhadap
mobilitas penyangga maupun penggalian, sehingga tidak diperlukan
personil yang bekerja di dalam tambang.
c. Sistem Roof-Fall Tolerant
Seperti halnya sistem backfilling, sistem roof-fall tolerant juga
merupakan konsep yang sasaran utamanya tidak memerlukan adanya
karyawan yang bekerja didalam tambang. Bahkan dalam sistem ini
dirancang tidak memerlukan penyangga sama sekali. Konsep sistem
Roof-fall tolerant dibuat atas dasar hipotesis sisipan tipis, yaitu akan
terbentuknya rongga dibelakang alat pemotong secara bertahap dan
runtuhan atap terjadi pada toleransi jarak yang cukup aman.
Adanya toleransi jarak runtuhan tersebut merupakan keuntungan
karena alat potong dan alat angkut tidak akan terjepit oleh runtuhan
atap. Konsep sisipan tipis ini meliputi seluruh perangkat penambangan
yang diperlukan antara lain rantai pemotong yang panjang dan bergerak
memutar (looping) serta sistem pengangkutnya. Penggalian batubara
bergerak dari satu arah sampai jarak tertentu, kemudian berbalik ke arah
yang berlawanan, begitu seterusnya sampai lapisan batubaranya habis.
2.6 Tahap Pengolahan Batubara
Bahangalianyangsudahselesaiditambangpadaumumnyaharus
diolahterlebihdahuluditempatpengolahan.Halinidisebabkanantarlain
oleh tercampurnya pengotor bersama bahan galian, perlu spesifikasi
tertentu untuk dipasarkan serta kalau tidak diolah maka harga jualnya
relative lebih rendah jika dibandingka dengan yang sudah diolah, dan
bahan galian perlu diolah agar dapat mengurangi volume dan ongkos
angkut, mningkatkan nilai tambah bahan galian, dan untuk mereduksi
senyawasenyawakimiayangtidakdikehendakipabrikpeleburan.
CaraPengolahanbahangaliansecaragarisbesardapatdibagiatas
pengolahansecarafisikadankimiatanpaekstraksimetal,danpengolahan

secrafisikadankimiadenganekstraksimetal.Pengolahanbahangalian
secara fisika ialah pengolahan bahan galian dengan cara memberikan
perlakuanfisikasepertiperemukan,penggerusan,pencucian,pengeringan,
danpembakarandengansuhurendah.Contohyangtergolongpengolahan
inisepertipencucianbatubara.Yangkeduapengolahansecarafisikadan
kimiatanpaekstraksimetal,yaitupengolahandengancarafisikadankimia
tanpa adanya proses konsentrasi dan ekstraksi metal. Contohnya,
pengolahan batubara skala rendah menggunakan reagen kimia. Ketiga,
pengolahanbahangaliansecarafisikadankimiadenganekstraksimetal,
yaitupengolahanlogammuliadanlogamdasar.
2.6.1

Proses Pencucian Batubara


Pencucian ialah usaha yang dilkakukan untuk memperbaiki kualitas

batubara, agar batubara tersebut memenuhi syarat penggunaan tertentu.


Termasuk

didalamnya

pembersihan

untuk

mengurangi

impurities

anorganik.Karakteristik batubara dan impurities yang utama ditinjau dari


segi pencucian secara mekanis ialah komposisi ukuran yang disebut size
consist, perbedaan berat jenis dari material yang dipisahkan, kimia
permukaan, friability relatif dari batubara dan impuritiesnya serta kekuatan
dan kekerasan. Ada beberapa cara, Contoh sulfur, sulfur adalah zat kimia
kekuningan yang ada sedikit di batubara, pada beberapa batubara yang
ditemukan di Ohio, Pennsylvania, West Virginia dan eastern states lainnya,
sulfur terdiri dari 3 sampai 10 % dari berat batu bara, beberapa batu bara
yang ditemukan di Wyoming, Montana dan negara-negara bagian sebelah
barat lainnya sulfur hanya sekitar 1/100ths (lebih kecil dari 1%) dari berat
batubara. Penting bahwa sebagian besar sulfur ini dibuang sbelum
mencapai cerobong asap.
Satu cara untuk membersihkan batubara adalah dengan cara mudah
memecah batubara ke bongkahan yang lebih kecil dan mencucinya.
Beberapa sulfur yang ada sebagai bintik kecil di batu bara disebut sebagai
pyritic sulfur karena ini dikombinasikan dengan besi menjadi bentuk

iron pyrite, selain itu dikenal sebagai fools gold dapat dipisahkan dari
batubara. Secara khusus pada proses satu kali, bongkahan batubara
dimasukkan ke dalam tangki besar yang terisi air , batubara mengambang
ke permukaan ketika kotoran sulfur tenggelam. Fasilitas pencucian ini
dinamakan coal preparation plants yang membersihkan batubara dari
pengotor-pengotornya.
Tidak semua sulfur bisa dibersihkan dengan cara ini, bagaimanapun
sulfur pada batubara adalah secara kimia benar-benar terikat dengan
molekul karbonnya, tipe sulfur ini disebut organic sulfur, dan pencucian
tak akan menghilangkannya. Beberapa proses telah dicoba untuk
mencampur batubara dengan bahan kimia yang membebaskan sulfur pergi
dari molekul batubara, tetapi kebanyakan proses ini sudah terbukti terlalu
mahal, ilmuan masih bekerja untuk mengurangi biaya dari prose pencucian
kimia ini.
Kebanyakan pembangkit tenaga listrik modern dan semua fasilitas
yang dibangun setelah 1978 telah diwajibkan untuk mempunyai alat
khusus yang dipasang untuk membuang sulfur dari gas hasil pembakaran
batubara sebelum gas ini naik menuju cerobong asap. Alat ini sebenarnya
adalah flue gas desulfurization units, tetapi banyak orang menyebutnya
scrubbers karena mereka men-scrub (menggosok) sulfur keluar dari
asap yang dikeluarkan oleh tungku pembakar batubara.
Dalam pencucian batubara, yang harus dipertimbangkan ialah
metode pencucian mana yang akan diterapkan untuk mempersiapakan
batubara sesuai keperluan pasar, dan apakah pencucian masih diperlukan,
karena pada prinsipnya batubara dapat dijual langsung setelah ditambang.
Kenyataannya penjualan langsung setelah ditambang tidak berarti produser
memperoleh keuntungan maksimum. Oleh karena itu dalam memutuskan
ini perlu dimasukan juga pertimbangan komersial.Untuk menentukan
kesesuaian alat yang digunakan dalam mencuci batubara syarat yang
diperlukan adalah ukuran butir dari batubara yang akan dicuci, spesifik
gravity dan kapasitas produksi yang digunakan. Alat-alat tersebut antara

lain dapat dipilih Dense Medium Separation, Concentration Table, Jig dan
Flotasi.
Dalam proses pencucian batubara untuk memisahkan dari mineral
pengotor, dipakai berbagai jenis peralatan konsentrasi berdasarkan sifatsifat batubara dari mineral pengotor. Perbedaan tersebut dapat berupa sifat
fisik atau mekanik dari butiran tersebut, seperti halnya berat jenis, ukuran,
warna, gaya sentripetal, gaya sentrifugal ataupun desain peralatan itu
sendiri.
Pencucian batubata dilakukan karena batubara hasil penambangan
bukanlah batubara yang bersih, tetapi masih banyak mengandung material
pengotor. Pengotor batubara dapat berupa pengotor homogen yang terjadi
di alam saat pembentukan batubara itu sendiri, yang disebut dengan
Inherent Impurities, maupun pengotor yang dihasilkan dari operasi
penambangan itu sendiri, yang disebut extraneous impurities.
Dengan demikian pencucian batubara bertujuan untuk memisahkan
dari material pengotornya dalam upaya meningkatkan kualitas batubara
sehingga nilai panas berrtambah dan kandungan air serta debu berkurang.
Batubara yang terlalu banyak pengotor cenderung akan menurunkan
kualitas batubara itu sendiri sehingga tidak dapat diandalkan dalam upaya
penjualan ke konsumen. Pada umumnya persyaratan pasar menghendaki
kandungan abu tidak lebih dari 10 %, dan pada umumya menghendaki
nilai panas yang berkisar antara 6000-6900 kcal/kg.
Batubara dari tambang terbuka dan tambang dalam harus dipisahkan
terlebih dahulu dari material pengotornya yang ditimbun terlebih dahulu di
Coal Yard. Dengan bantuan Whell Looader, raw coal dimuat ke hopper,
umpan dari hopper ini dipisahkan melalui grizzly, sehingga batubara yang
memiliki ukuran diatas 75 mm akan dimuat ke Picking Belt yang
selanjutnya akan dipisahkan dari material pengotornya melalui hand
picking secara manual, sedangkan batubara yang berukuran -75 mm akan
dijadikan umpan pencucian.
2.6.2
Macam-Macam Alat Pencucian Batubara
1. Jig

Pencucian dengan alat ini didasarkan pada perbedaan spesific


gravity. Proses yang dilakukan Jig ini adalah adanya stratifikasidalam
bed sewaktu adanya air hembusan. Kotoran cenderung tenggelam dan
batubara bersih akan timbul di atas.
Basic jig, Baum jig sesuai digunakan untuk pencucian batubara
ukuran besar, walaupun Baum Jig dapat melakukan pencucian pada
batubara ukuran besar tetapi lebih efektif melakukan pencucian pada
ukuran 10 35 mm dengan spesifik gravity 1,5 1,6. Modifikasi Baum
jig adalah Batac jig yang biasa digunakan untuk batubara ukuran halus.
Untuk batubara ukuran sedang, prinsipnya sama yaitu pulsing
(tekanan) air hembusan berasal dari samping atau dari bawah bed.
Untuk menambah bed atau mineral keras yang digunakan untuk
meningkatkan stratifikasi dan menghindari percampuran kembali,
mineral yang digunakan biasanya adalah felspar yang berupa lump
silica dengan ukuran 60 mm.
2. Dense Medium Separator (DMS)
Dense medium ini juga dioperasikan berdasarkan perbedaan
spercific gravity. Menggunakan medium pemisahan air, yaitu campuran
magnetite dan air. Medium campuran ini mempunyai spesific gravity
antara batubara dan pengotornya. Slurry magnetite halus dalam air
dapat mencapai densitas relatif sekitar 1,8 ukuran batubara yang efektif
untuk dilakukan pencucian adalah 0,5 150 mm dengan Spesifik
gravity 1,3 1,9 type dense-medium separator yang digunakan dapat
berupa bath cyclone dan cylindrical centrifugal. Untuk cylinder
centrifugal separator digunakan untuk pencucian batubara ukuran besar
dan sedang.
Dense medium cyclone bekerja karena adanya kecepatan dense
medium, batubara dan pengotor oleh gaya centrifugal. Batubara bersih
ke luar menuju ke atas dan pengotornya menuju ke bawah. Gambar 2
menunjukkan contoh dense medium bath dan dense medium cyclone.
Faktor penting dalam operasi berbagai dense medium sistem didasarkan
pada magnetite dan efisiensi recovery magnetite yang digunakan lagi.
3. Hydrocyclone

Hydrocyclone adalah water based cyclone dimana partkel-partikel


berat mengumpul dekat dengan dinding cyclone dan kemudian akan ke
luar lewat co ne bagian bawah. Partikel-partikel yang ringan (partikel
bersih) mennuju pusat dan kemudian ke luar lewat vortex finder.
Diameter cyclone sangat berpengaruh terhadap efektifitas pemisahan.
Kesesuaian ukuran partikel batubara yang akan dicuci adalah 0,5 150
cm dengan spesifik gravity 1,3 1,5
4. Concentration Tables
Proses konsentrasi table adalah konsentrasi dengan meja miring
terdiri dari rib-rib (tulang-tulang) bergerak ke belakang dan maju terus
menerus dengan arah yang horisontal. Partikel-partikel batubara bersih
(light coal) bergerak ke bawah table, sedangkan partikel-partikel kotor
(heavy partical) merupakan partikel yang tidak diinginkan terkumpul
dalam rib dan bergerak ke bagian akhir table.
Batubara ukuran halus dapat dicuci dengan alat ini secara murah
tetapi kapasitasnya kecil dan hanya efektif untuk melakukan pencucian
pada batubara dengan spesific gravity lebih besar 1,5 dengan ukuran
partikel batubara yang dicuci 0,5 15 mm.
Harga Batubara saat ini ditentukan melalui Indonesian Coal Index.
Indonesian Coal Index (ICI) ialah indeks harga jual batubara berdasarkan
kualitasnya yang berlaku di Indonesia. ICI ini sendiri dibentuk oleh PT
Coalindo Energy yang bekerja sama dengan Argus Media Limited
(Inggris) dan sudah dimulai pada tahun 2006. ICI ini dibentuk karena
didasari oleh kebutuhan Indonesia untuk memiliki standar harga sendiri.
Sebelumnya, harga jual batubara di Indonesia mengikuti harga
internasional, tetapi karena perbedaan spesifikasi dan otonomi antara pasar
di Indonesia dan di luar, maka dibentuklah ICI ini. ICI ini didapat dari
analisis oleh Coalindo dan Argus Media. Coalindo menggunakan metode
panelis dimana panelis ini teridir dari 14 orang produsen, 14 orang
konsumen dan 7 orang trader dan broker. Mula-mula panelis dari Coalindo
mengajukan harga. Kemudian nilai yang didapatkan akan di evaluasi

kembali oleh Coalindo. Dari sana, 10% harga tertinggi dan terendah akan
dibuang, sisanya akan dihitung rata-ratanya sehingga didapatkan nilai jual
dari 4 macam batubara. Kemudian coalindo akan mengirimkan hasilnya ke
Argus Media di inggris, dan Argus Media di Singapura akan mengajukan
harga jual berdasarkan analisis harga harian dan data transaksi di pasar.
Kedua nilai yang didapat Argus Media di Inggris kemudian akan dirataratakan dan akan mendapat nilai akhir ICI.

2.7 Tahap Pemasaran


Jika bahan galian sudah selesai diolah maka dipasarkan ke tempat
konsumen. Antara perusahaan pertambangan dan konsumen terjalin ikatan
jual beli kontrak jangka panjang, dan spot ataupun penjualan sesaat. Pasar
kontrak jangka panjang yaitu pasar yang penjualan produknya dengan
kontrak jangka panjang misalnya lebih dari satu tahun. Sedangkan
penjualan spot, yaitu penjualan sesaat atau satu atau dua kali pengiriman
atau order saja.
Batubara memiliki tiga komponen yang melekat yang mempengaruhi
biaya :
1. Nilai kalori yang terkandung di semua batubara termal.
2. Besarnya biaya ditanggung oleh produsen untuk membawa batu bara
dari tambang ke pelabuhan terdekat.
3. Biaya angkutan yang dibutuhkan untuk mengirimkan batubara dari
pelabuhan ke tempat pelanggan atau pengguna akhir.
2.8 Tahapan Pasca Tambang
Reklamasi merupakan kegiatan untuk merehabilitasi kembali
lingkungan yang telah rusak baik itu akibat penambangan atau kegiatan
yang lainnya. Reklamasi ini dilakukan dengan cara penanaman kembali
atau penghijauan suatu kawasan yang rusak akibat kegiatan penambangan

tersebut. Reklamasi perlu dilakukan karena Penambangan dapat mengubah


lingkungan fisik, kimia dan biologi seperti bentuk lahan dan kondisi tanah,
kualitas dan aliran air, debu, getaran, pola vegetasi dan habitat fauna, dan
sebagainya. Perubahan-perubahan ini harus dikelola untuk menghindari
dampak lingkungan yang merugikan seperti erosi, sedimentasi, drainase
yang buruk, masuknya gulma/hama/penyakit tanaman, pencemaran air
permukaan/air tanah oleh bahan beracun dan lain-lain. Dalam kegiatan
reklamasi terdiri dari dua kegiatan yaitu Pemulihan lahan bekas tambang
untuk

memperbaiki

lahan

yang

terganggu

Ekologinya,

dan

Mempersiapkan lahan bekas tambang yang sudah diperbaiki ekologinya


untuk pemanfaatannya selanjutnya.
Menurut Undang-Undang No. 32 tahun 2009 tentang Pengelolaan
Lingkungan Hidup dijelaskan bahwa Pengelolaan lingkungan hidup adalah
upaya terpadu untuk melestarikan fungsi lingkungan hidup yang meliputi
kebijaksanaan penataan, pemanfaatan, pengembangan, pemeliharaan,
pemulihan, pengawasan, dan pengendalian lingkungan hidup.
Pengelolaan lingkungan hidup yang diselenggarakan dengan asas
tanggung jawab Negara, asas berkelanjutan dan asas manfaat bertujuan
untuk mewujudkan pembangunan berkelanjutan yang berwawasan
lingkungan hidup dalam rangka pembangunan manusia Indonesia
seutuhnya dan pembangunan masyarakat Indonesia seluruhnya yang
beriman dan bertaqwa kepada Tuhan yang Maha Esa.
Menurut Sitorus (2003) alat strategis untuk memperbaiki kerusakan
akibat penambangan sistem terbuka adalah dengan mengembalikan sisa
hasil penambangan kedalam lubang-lubang tambang, dan menanam
kembali vegetasi dengan memperhatikan sisa galian (tailing) yang
mengandung bahan beracun. Pada lahan pasca tambang batubara,
reklamasi lahan adalah usaha / upaya menciptakan agar permukaan tanah
dapat stabil, dapat menopang sendiri secara keberlanjutan (self-sustaining)
dan dapat digunakan untuk berproduksi, dimulai dari hubungan antara
tanah dan vegetasi, sebagai titik awal membangun ekosistem baru.
Reklamasi lahan pasca tambang batubara yang dikaitkan dengan revegetasi

pada dasarnya adalah untuk mengatasi berlanjutnya kerusakan lahan dan


menciptakan proses pembentukan unsur hara melalui pelapukan serasah
daun yang jatuh. Aktifitas tersebut diharapkan dapat secara berkelanjutan
dan dapat membentuk ekosistem baru.
Reklamasi adalah kegiatan yang bertujuan memperbaiki atau menata
kegunaan

lahan

pertambangan,

yang

agar

terganggu

dapat

sebagai

berfungsi

dan

akibat

kegiatan

berdaya

guna

usaha
sesuai

peruntukannya. Reklamasi lahan bekas tambang selain merupakan upaya


untuk memperbaiki kondisi lingkungan pasca tambang, agar menghasilkan
lingkungan ekosistem yang baik dan juga diupayakan menjadi lebih baik
dibandingkan rona awalnya, dilakukan dengan mempertimbangkan potensi
bahan galian yang masih tertinggal.
Prinsip lingkungan hidup yang wajib dipenuhi dalam melaksanakan
reklamasi dan pasca tambang adalah :
1. Perlindungan terhadap kualitas air permukaan, air tanah, tanah dan
udara,
2. Perlindungan Keanekaragaman hayati,
3. Penjaminan stabilitas dan keamanaan timbunan batuan penutup,
kolam tailing, lahan bekas tambang dan struktur buatan lainnya,
4. Pemanfaatan lahan bekas tambang,
5. Memperhatikan nilainilai sosial dan budaya setempat,
6. Perlindungan terhadap kuantitas air tanah.
Kegiatan reklamasi merupakan akhir dari kegiatan pertambangan
yang diharapkan dapat mengembalikan lahan kepada keadaan semula,
bahkan jika memungkinkan dapat lebih baik dari kondisi sebelum
penambangan. Kegiatan reklamasi meliputi pemulihan lahan bekas
tambang untuk memperbaiki lahan yang terganggu ekologinya dan
mempersiapkan lahan bekas tambang yang sudah diperbaiki ekologinya
untuk pemanfaatan selanjutnya. Sasaran akhir dari reklamasi adalah untuk
memperbaiki lahan bekas tambang agar kondisinya aman, stabil dan tidak
mudah tererosi sehingga dapat dimanfaatkan kembali.
Secara teknis usaha reklamasi lahan tambang terdiri dari
recontouring/ regrading/resloping lubang bekas tambang dan pembuatan
saluran-saluran drainase untuk memperoleh bentuk wilayah dengan

kemiringan stabil, top soil spreading agar memenuhi syarat sebagai media
pertumbuhan tanaman, untuk memperbaiki tanah sebagai media tanam,
revegetasi dengan tanaman cepat tumbuh, tanaman asli lokal dan tanaman
kehutanan introduksi. Perlu juga direncanakan pengembangan tanaman
pangan, tanaman perkebunan dan atau tanaman hutan industri, jika
perencanaan penggunaan lahan memungkinkan untuk itu (Djati, 2011).
Teknologi dan langkah-langkah reklamasi
Menurut Dariah (2010), bahwa Reklamasi lahan perlu dilakukan
diantaranya untuk meningkatkan daya dukung dan daya guna bagi
produksi biomassa. Penentuan jenis pemanfaatan lahan antara lain perlu
didasarkan atas status kepemilikan dan kondisi bio-fisik lahan, serta
kebutuhan masyarakat atau Pemda setempat. Ke depan, persyaratan
pengelolaan lahan tambang tidak cukup hanya dengan study kelayakan
pembukaan usaha penambangan saja, namun perlu dilengkapi juga dengan
perencanaan penutupannya (planning of closure), yang mencakup
perlindungan lingkungan dan penanggulangan masalah sosial-ekonomi.
Hal ini perlu dijadikan salah satu persyaratan dalam pemberian izin
penambangan. Reklamasi lahan bekas tambang memerlukan pendekatan
dan teknologi yang berbeda tergantung atas sifat gangguan yang terjadi
dan juga peruntukannya (penggunaan setelah proses reklamasi). Namun
secara umum, garis besar tahapan reklamasi adalah sebagai berikut:
1. Konservasi Top Soil
Lapisan tanah paling atas atau tanah pucuk, merupakan lapisan
tanah yang perlu dikonservasi, karena paling memenuhi syarat untuk
dijadikan media tumbuh tanaman. Hal ini mencerminkan bahwa proses
reklamasi harus sudah mulai berjalan sejak proses penambangan
dilakukan, karena konservasi tanah pucuk harus dilakukan pada awal
penggalian. Namun banyak perusahaan tambang yang tidak mematuhi
hal ini, akibatnya harus mengangkut tanah pucuk dari luar dengan biaya
tinggi, dan menimbulkan permasalahan di lokasi tanah pucuk berada.
Beberapa hal yang harus diperhatikan, adalah:

a. Menghindari tercampurnya subsoil yang mengandung unsur atau


senyawa beracun, seperti pirit, dengan tanah pucuk, dengan cara
mengenali sifat-sifat lapisan tanah sebelum penggalian dilakukan,
b. Menggali tanah pucuk sampai lapisan yang memenuhi persyaratan
untuk tumbuh tanaman,
c. Menempatkan galian tanah pucuk pada areal yang aman dari erosi
dan penimbunan bahan galian lainnya,
d. Menanam legum yang cepat tumbuh pada tumpukan tanah pucuk
untuk mencegah erosi dan menjaga kesuburan tanah.
2. Penataan Lahan
Penataan lahan dilakukan untuk memperbaiki kondisi bentang
alam, antara lain dengan cara:
a. Menutup lubang galian (kolong) dengan menggunakan limbah
tailing (overburden). Lubang kolong yang sangat dalam dibiarkan
terbuka, untuk penampung air;
b. Membuat saluran drainase untuk mengendalikan kelebihan air,
c. Menata lahan agar revegetasi lebih mudah dan erosi terkendali,
diantaranya dilakukan dengan cara meratakan permukaan tanah, jika
tanah sangat bergelombang penataan lahan dilakukan bersamaan
dengan penerapan suatu teknik konservasi, misalnya dengan
pembuatan teras,
d. Menempatkan tanah pucuk agar dapat digunakan secara lebih
efisien. Karena umumnya jumlah tanah pucuk terbatas, maka tanah
pucuk diletakan pada areal atau jalur tanaman. Tanah pucuk dapat
pula diletakkan pada lubang tanam.
3. Pengelolaan Sedimen dan Pengendalian Erosi
Pengelolaan sedimen dilakukan dengan membuat bangunan
penangkap sedimen, seperti rorak, dan di dekat outlet dibuat bangunan
penangkap yang relatif besar. Cara vegetative juga merupakan metode
pencegahan erosi yang dapat diterapkan pada areal bekas tambang.
Talaohu et al. (1995) menggunakan strip vetiver untuk pencegahan
erosi pada areal bekas tambang batu bara. Vetiver merupakan pilihan
yang terbukti tepat, karena selain efektif menahan erosi, tanaman ini

juga relatif mudah tumbuh pada kondisi lahan buruk sehingga bertindak
sebagai tanaman pioner.
4. Penanaman Cover Crop
Penanaman cover crop (tanaman penutup) merupakan usaha
untuk memulihkan kualitas tanah dan mengendalikan erosi. Oleh karena
itu keberhasilan penanaman penutup tanah sangat menentukan
keberhasilan reklamasi lahan pasca penambangan. Karakteristik cover
crop yang dibutuhkan, sebagai berikut : mudah ditanam, cepat tumbuh
dan rapat, bersimbiosis dengan bakteri atau fungi yang menguntungkan
(rhizobium,
biomassa

frankia,
yang

azospirilum,

melimpah

dan

dan

mikoriza),

mudah

menghasilkan

terdekomposisi,

tidak

berkompetisi dengan tanaman pokok dan tidak melilit. Pada areal bekas
tambang nikel PT Inco (Ambodo, 2008) menggunakan dua jenis rumput
(Echinocloa sp. dan Cynodon dactylon) serta dua jenis legum
(Macroptilium bracteatum dan Chamaecrista sp.) sebagai cover crop.
Selain itu juga dicampurkan tanaman legum lokal seperti Clotalaria
sp., Theprosia sp., Calindra sp., dan Sesbania rostata. Dengan
campuran jenis tersebut dalam waktu dua bulan setelah penanaman
didapatkan penutupan lebih dari 80%. Kemampuan tanaman penutup
untuk mendukung pemulihan kualitas tanah sangat tergantung pada
tingkat kerusakan tanah.

Santoso (2008).

menyatakan bahwa

sebaiknya cover crop ditanam pada tahun pertama dan kedua proses
reklamasi.
5. Penanaman Tanaman Pionir
Untuk mengurangi kerentanan terhadap serangan hama dan
penyakit, serta untuk lebih banyak menarik binatang penyebar benih,
khususnya burung, lebih baik jika digunakan lebih dari satu jenis
tanaman pionir/multikultur (Ambodo, 2008). Beberapa jenis tanaman
pionir adalah : sengon buto (Enterrolobium cylocarpum), Sengon
(Paraserianthes falcataria), johar (Casia siamea), Cemara (Casuarina
sp.), dan Eukaliptus pelita. Dalam waktu dua tahun kerapatan tajuk

yang dibentuk tanaman-tanaman tersebut mampu mencapai 50-60%


sehingga kondusif untuk melakukan restorasi jenis-jenis lokal, yang
umumnya bersifat semitoleran. Tanaman pioner ditanam dengan sistem
pot pada lubang berukuran lebar x panjang x dalam sekitar 60 x 60 x 60
cm, yang diisi dengan tanah pucuk dan pupuk organik. Di beberapa
lokasi, tanaman pioneer ditanam langsung setelah penataan lahan,
padahal tingkat keberhasilannya relatif rendah (Puslittanak, 1995). Pada
areal bekas timah, meskipun sudah ditanam dengan sistem pot, tanaman
tumbuh

baik

hanya

pada

awal

pertumbuhan,

selanjutnya

pertumbuhannya lambat dan beberapa diantaranya mati, karena media


tanam dalam pot sudah tidak dapat memenuhi kebutuhan tanaman.
Santoso (2008) menyatakan bahwa penanaman tanaman pioner
sebaiknya dilakukan pada tahun ke 3-5, setelah penanaman tanaman
penutup tanah.
6. Penanggulangan Logam Berat
Pada areal yang mengandung logam berat dengan kadar di atas
ambang batas diperlukan perlakuan tertentu untuk mengurangi kadar
logam berat tersebut. Vegetasi penutup tanah yang digunakan untuk
memantapkan timbunan buangan tambang dan membangun kandungan
bahan organik, bermanfaat pula untuk mengurangi kadungan logam
berat dengan menyerapnya ke dalam jaringan (Notohadiprawiro, 2006).
Beberapa laporan juga menunjukkan bahwa bahan organik berkorelasi
negatif dengan kelarutan logam berat di dalam tanah, karena
keberadaan bahan organik tanah meningkatkan kapasitas tukar kation
(KTK) tanah (Salam, dalam Haryono dan Soemono, 2009). Hasil
penelitian menunjukkan pemberian bahan organik dikombinasikan
dengan pencucian dapat menurunkan kandungan logam mercuri (Hg)
dalam tanah sampai 84%. Pada areal dengan kandungan logam berat
tinggi sebaiknya jangan dulu dilakukan penanaman komoditas yang
dikonsumsi. Perlu dipilih jenis tanaman yang toleran terhadap logam
berat, misalnya di Ameria Serikat ditemukan jenis tanaman pohon

hutan, diantaranya Betula spp. dan Salix spp. yang dapat bertahan hidup
di areal bekas tambang yang mengandung Pb sampai 30.000 mg/kg dan
Zn sampai 100.000 mg/kg. Kemampuan ini ternyata dibangkitkan oleh
asosiasi pohon dengan mikoriza (Notohadiprawiro, 2006).

Perlu

diidentifikasi tanaman-tanaman lain yang toleran terhadap logam berat


yang dapat tumbuh baik di wilayah tropis seperti Indonesia. Selain
dalam tanah penanggulangan pencemaran logam berat dalam air juga
harus dilakukan, tanaman eceng gondok dapat digunakan untuk
membersihkan badan air dari logam berat (Notohadiprawiro, 2006).
Penanganan logam berat dengan mikroorganisme atau mikrobia (dalam
istilah biologi disebut dengan bioakumulsi, bioremediasi, atau
bioremoval), menjadi alternatif yang dapat dilakukan untuk mengurangi
keracuan elemen logam berat di lingkungan perairan (Mursyidin, 2006).
Menurut Latifah (2003) mengatakan bahwa Penambangan dapat
mengubah lingkungan fisik, kimia dan biologi seperti : bentuk lahan
dan kondisi tanah, kualitas dan aliran air, debu, getaran, pola vegetasi
dan habitat fauna, dan sebagainya. Perubahan-perubahan ini harus
dikelola untuk menghindari dampak lingkungan yang merugikan seperti
erosi, sedimentasi, drainase yang buruk, masuknya gulma / hama /
penyakit tanaman, pencemaran air permukaan / air tanah oleh bahan
beracun dan lain-lain.
Sasaran Reklamasi Dalam kegiatan reklamasi terdiri dari dua
Kegiatan yaitu :
a. Pemulihan lahan bekas tambang untuk memperbaiki lahan yang
terganggu ekologinya.
b. Mempersiapkan lahan bekas tambang yang sudah diperbaiki
ekologinya untuk pemanfaatannya selanjutnya.
Untuk melakukan reklamasi lahan bekas tambang diperlukan
perencanaan yang baik agar dalam pelaksanaannya dapat tercapai
sasaran sesuai yang dikehendaki.

Hal-hal yang harus diperhatikan didalam perencanaan reklamasi


adalah sebagai berikut :
a. Mempersiapkan
penambangan,
b. Luas areal yang

rencana

reklamasi

direklamasikan

sebelum

sama

pelaksanaan

dengan

luas

areal

penambangan,
c. Memindahkan dan menempatkan tanah pucuk pada tempat tertentu
dan mengatur sedemikian rupa untuk keperluan revegetasi,
d. Mengembalikan/memperbaiki pola drainase alam yang rusak,
e. Menghilangkan/memperkecil kandungan (kadar) bahan beracun
sampai tingkat yang aman sebelum dapat dibuang ke suatu tempat
pembuangan,
f. Mengembalikan lahan seperti keadaan semula dan/atau sesuai
dengan tujuan penggunaannya,
g. Memperkecil erosi selama dan setelah proses reklamasi,
h. Memindahkan semua peralatan yang tidak digunakan lagi dalam
aktifitas penambangan,
i. Permukaan yang padat harus digemburkan namun bila tidak
memungkinkan agar ditanami dengan tanaman pionir yang akarnya
mampu menembus tanah yang keras,
j. Setelah penambangan maka pada lahan bekas tambang yang
diperuntukkan bagi revegetasi, segera dilakukan penanaman kembali
dengan jenis tanaman yang sesuai dengan rencana rehabilitasi dari
Departemen Kehutanan dan RKL yang dibuat,
k. Mencegah masuknya hama dan gulma yang berbahaya,
l. Memantau dan mengelola areal reklamasi sesuai dengan kondisi
yang diharapkan.
Setiap lokasi pertambangan mempunyai kondisi tertentu yang
mempengaruhi

pelaksanaan

reklamasi.

Pelaksanaan

reklamasi

umumnya merupakan gabungan dari pekerjaan teknik sipil dan teknik


revegetasi. Pelaksanaan reklamasi meliputi kegiatan sebagai berikut :
1. Persiapan lahan yang berupa pengamanan lahan bekas tambang,
pengaturan bentuk lahan (landscaping), pengaturan/penempatan
bahan

tambang

dimanfaatkan.

kadar

rendah

(lowgrade)

yang

belum

2. Pengendalian erosi dan sidementasi.


3. Pengelolaan tanah pucuk (top soil).
4. Revegetasi (penanaman kembali) dan/atau pemanfaatan lahan bekas
tambang untuk tujuan lainnya.

BAB III
PENUTUP
3.1 Kesimpulan
Dari makalah ini penulis dapat menarik kesimpulan bahwa:

1. Prospeksi merupakan kegiatan penyelidikan, pencarian, atau penemuan


endapan-endapan mineral berharga. Atau dengan kata lain kegiatan ini
bertujuan untuk menemukan keberadaan atau indikasi adanya bahan
galian yang akan dapat atau memberikan harapan untuk diselidiki lebih
lanjut.
2. Metode Penyelidikan Umum Atau Prospeksi
Penelusuran Tebing-Tebing Di Tepi Sungai Dan Lereng-Lereng
Bukit,
Penelusuran Jejak Serpihan Mineral (Tracing Float),
Penyelidikan Dengan Sumur Uji (Test Pit),
Penyelidikan Dengan Parit Uji (Trench),
Metode Geofisika (Geophysical Prospecting),
Metode Geokimia (Geochemistry Prospecting).
3. Eksplorasi merupakan kegiatan yang dilakukan setelah prospeksi atau
setelah endapan suatu bahan galian ditemukan yang bertujuan untuk
mendapatkan kepastian tentang endapan bahan galian yang meliputi
bentuk, ukuran, letak kedudukan, kualitas (kadar) endapan bahan galian
serta karakteristik fisik dari endapan bahan galian tersebut.
4. Tahapan-tahapan Eksplorasi :
Survey Tinjau
Prospeksi
Eksplorasi Pendahuluan
Tahap Eksplorasi Detail
5. Merupakan tahapan akhir dari rentetan penyelidikan awal yang
dilakukan sebelumnya sebagai penentu apakah kegiatan penambangan
endapan bahan galian tersebut layak dilakukan atau tidak.
Adapun aspek-aspek yang menjadi kajian dalam studi kelayakan
adalah:
Aspek kajian teknis
Aspek kajian nonteknis
Kajian Pasar
Kajian kelayakan ekonomis
Kajian kelayakan lingkungan, berbentuk AMDAL dan UKL-UPL.
6. Perencanaan adalah penentuan persyaratan dalan mencapai
sasaran,kegiatan serta urutan teknik pelaksanaan berbagai macam
kegiatan untuk mencapai suatu tujuan dan sasaran yang diinginkan.

7. Penambangan bahan galian dibagi atas tiga bagian yaitu tambang


terbuka, tambang bawah tanah dan tambang bawah air. Tambang
terbuka dikelompokan atas quarry strip mine, open cut, tambang
alluvial, dan tambang semprot.
8. Bahan galian yang sudah selesai ditambang pada umumnya harus
diolah terlebih dahulu di tempat pengolahan. Hal ini disebabkan antar
lain oleh tercampurnya pengotor bersama bahan galian, perlu
spesifikasi tertentu untuk dipasarkan serta kalau tidak diolah maka
harga jualnya relative lebih rendah jika dibandingka dengan yang sudah
diolah, dan bahan galian perlu diolah agar dapat mengurangi volume
dan ongkos angkut, mningkatkan nilai tambah bahan galian, dan untuk
mereduksi senyawa-senyawa kimia yang tidak dikehendaki pabrik
peleburan.
9. Reklamasi

merupakan

kegiatan

untuk

merehabilitasi

kembali

lingkungan yang telah rusak baik itu akibat penambangan atau kegiatan
yang lainnya. Reklamasi ini dilakukan dengan cara penanaman kembali
atau penghijauan suatu kawasan yang rusak akibat kegiatan
penambangan tersebut.

3.2 Saran
Dengan mengucap syukur alhamdulillah pada Allah SWT kami
dapat menyelesaikan makalah ini dengan baik dan tentunya masih jauh
dari harapan, oleh karena itu kami masih perlu kritik dan saran yang
membangun serta bimbingan, terutama dari Dosen. Semoga makalah ini
bermanfaat bagi pembaca dan bagi kami selaku penulis makalah ini

.
DAFTAR PUSTAKA
Sulun, 2010. Makalah Batubara.http://sulunshare.blogspot.com/2010/11/makalahbatu-bara.html. Di akses pada tanggal 02 April 2015.
Tri,
Gerry.
2014.
Tahapan
Kegiatan

Penambangan.

http://gerrytri.blogspot.com/2014/10/tahapan-kegiatan-penambanganpada.html. Di akses pada tanggal 02 April 2015.


Dzakiemine,
2013.
Proses
Penambangan

Batubara.

https://dzakiemine.wordpress.com/2013/11/19/proses-penambanganbatubara-metode-open-pit/. . Di akses pada tanggal 02 April 2015.

Zozon,

2014.

Metode

Penambangan

Batubara.

https://zozongeologeous.wordpress.com/2014/08/13/metode-penambanganbatubara/. Di akses pada tanggal 02 April 2015.


Hastirullah, 2014. Makalah Reklamasi Lahan Bekas Tambang.
http://psdg.bgl.esdm.go.id/buletin_pdf_file/Bul%20Vol%203%20no.
%201%20thn%202008/3.%20Makalah%20Reklamasi%20Lahan%20Bekas
%20Tambang.pdf. Di akses pada tanggal 02 April 2015.
Real,

2010.

Rincian

Kegiatan

Penyelidikan

Umum.

http://www.realminers.com/2010/12/rincian-kegiatan-penyelidikanumum.html. Di akses pada tanggal 02 April 2015.


Abdullah,
Badawi.
2014.
Perencanaan
Tambang

Batubara.

http://mineritysriwijaya.blogspot.com/2014/03/perencanaan-tambangRizky,

batubara.html. Di akses pada tanggal 02 April 2015.


2011.
Proses
Penambangan

Batubara.

http://rizkimartarozi.blogspot.com/2011/02/proses-penambanganbatubara.html. Di akses pada tanggal 02 April 2015.

Anda mungkin juga menyukai