Anda di halaman 1dari 9

1.

Bagaimana cara kerja Obat Antituberkulosis (OAT) first line dan kenapa
pemberiannya6bulan?

Firstline

Firstline essential obat antituberkulosis paling efektif, komponen terpenting


regimenterapijangkapendek.(rifampisin,isoniaziddanpirazinamid)
a.rifampisin: Bersifatbakterisid,dapatmembunuhkumansemidormantyang
tidakdapatdibunuholehisoniazid.Mekanismekerja,Berdasarkanperintangan
spesifik dari suatu enzim bakteriRibose Nukleotida Acid(RNA)polimerase
sehinggasintesisRNAterganggu
DosisUntukdewasadananakyangberanjakdewasa600mgsatukalisehari,atau
600mg23kaliseminggu.Rifampisinharusdiberikanbersamadenganobatanti
tuberkulosislain.Bayidananakanak,dosisdiberikandokter/tenagakesehatan
lainberdasarkanatasberatbadanyangdiberikansatukaliseharimaupun23kali
seminggu.Biasanyadiberikan7,515mgperkgberatbadan.AnjuranIkatan
DokterAnakIndonesiaadalah75mguntukanak<10kg,150mguntuk1020
kg,dan300mguntuk2033kg.
b.isoniazid
Bersifatbakterisid,dapatmembunuh90%populasikumandalambeberapahari
pertama pengobatan. Efektif terhadap kuman dalam keadaan metabolik aktif,
yaitu kuman yang sedang berkembang. Mekanisme kerja berdasarkan
terganggunyasintesamycolicacid,yangdiperlukanuntukmembangundinding
bakteri.
Dosis.Untukpencegahan,dewasa300mgsatukalisehari,anakanak10mgper
beratbadansampai300mg,satukalisehari.UntukpengobatanTBbagiorang
dewasasesuaidenganpetunjukdokter/petugas kesehatanlainnya.Umumnya
dipakaibersamadenganobatantituberkulosislainnya.Dalamkombinasibiasa
dipakai300mgsatukalisehari,atau15mgperkgberatbadansampaidengan

900mg,kadangkadang2kaliatau3kaliseminggu.Untukanakdengandosis10
20mgperkgberatbadan.Atau2040mgperkgberatbadansampai900mg,2
atau3kaliseminggu.
c.pirazinamid
Bersifat bakterisid, dapat membunuh kuman yang berada dalam sel dengan
suasana asam. Mekanisme kerja, berdasarkan pengubahannya menjadi asam
pyrazinamidaseyangberasaldaribasiltuberkulosa.
DosisDewasadananaksebanyak1530mgperkgberatbadan,satukalisehari.
Atau 50 70 mg per kg berat badan 2 3 kali seminggu. Obat ini dipakai
bersamaandenganobatantituberkulosislainnya.

Firstline supplemental obatobat ini pun mempunyai efektivitas yang tinggi


(streptomisindanetambutol)
a.streptomisin
Bersifatbakterisid,dapatmembunuhkumanyangsedangmembelah.Mekanisme
kerjaberdasarkanpenghambatansintesaproteinkumandenganjalanpengikatan
padaRNAribosomal.
DosisObat ini hanya digunakan melalui suntikan intra muskular, setelah
dilakukanujisensitifitas.Dosisyangdirekomendasikanuntukdewasaadalah15
mgperkgberatbadanmaksimum1gramsetiaphari,atau2530mgperkg
beratbadan,maksimum1,5gram23kaliseminggu.Untukanak2040mgper
kgberatbadanmaksimum1gramsatukalisehari,atau2530mgperkgberat
badan23kaliseminggu.Jumlahtotalpengobatantidaklebihdari120gram.
b.etambutol
Bersifat bakteriostatik, dengan menekan pertumbuhan kuman TB yang telah
resisten terhadap Isoniazid dan streptomisin. Mekanisme kerja, berdasarkan

penghambatan sintesa RNA pada kuman yang sedang membelah, juga


menghindarkanterbentuknyamycolicacidpadadindingsel.
Dosis.Untukdewasadananakberumurdiatas13tahun,1525mgmgperkg
beratbadan,satukalisehari.Untukpengobatanawaldiberikan15mg/kgberat
badan,danpengobatanlanjutan25mgperkgberatbadan.Kadangkadangdokter
juga memberikan 50 mg per kg berat badan sampai total 2,5 gram dua kali
seminggu. Obat ini harus diberikan bersama dengan obat anti tuberkulosis
lainnya.Tidakdiberikanuntukanakdibawah13tahundanbayi
PharmaceuticalCareUntukPenyakitTuberkulosis.DirektoratBinaKefarmasian
danAlatKesehatanDepartemenKesehatanRI.2005
Pengobatantuberkulosisterutamapadapemberianobatantimikrobadalam
jangka waktu yang lama. Obatobat dapat juga digunakan untuk mencegah
timbulnyapenyakitklinispadaseseorangyangsudahterjangkitinfeksi.Padatahap
intensif (awal) pasien mendapat obat setiap hari dan perlu diawasi secara
langsunguntukmencegahterjadinyaresistensiobat.Padatahaplanjutanpasien
mendapat jenis obat lebih sedikit, namun dalam jangka waktu yang lebih
lama.Tahap lanjutan penting untuk membunuh kuman persister sehingga
mencegahterjadinyakekambuhan.

2. BagaimanakerjaOATsecondlinedankenapapemberiannya2tahun?
1.AsamParaaminoSalisilat(PAS)
Ditemukan tahun 1940, dahulu merupakan OAT garis pertama yang
disunakan bersama dengan isoniazid dan streptomycin; kemudian kedudukannya
digantikan oleh ethambutol. PA memperlihatkan efek bakteriostatik
terhadapM.tuberculosisdengan menghambat secara kompetitif pembentukan asam
folatdariasamparaaminobenzoat1.PenggunaanPASseringdisertaiefeksamping
yang mencakup keluhan saluran cerna, reaksi hipersensitifitas (10% penderita),
hipotiroid,trombositopenia,danmalabsorpsi.9

2.Ethionamide
Mekanisme kerjanya sama seperti isoniazid, yaitu menghambat sintesis
asammikolat.Invirokeduaturunanpyridineinibersifatbakterisid,tetapiresistensi
mudah terjadi. Dosis harian adalah 5001000 mg, terbagi dua dosis. Efek samping
utamaadalahgangguansalurancerna,hepatotoksisitas(4.3%penderita);ethionamide
memperlihatkankekerapanefeksampingyangsedikitlebihrendahdariefeksamping
prothioamide. Efek samping yang lain adalah neuritis, kejang, pusing, dan
ginekomastia.Untungnya,basilyangsudahresistenterhadapisoniazidmasihrentan
denganethioamide,walaupunkeduanyaberasaldarisenyawaanindukyangsamayaitu
asamnikotinat.Antaraethionamidedanprothionamideterjadiresistensisilang.9
3.Thioacetazone
Secarainvirodaninvivodiperlihatkanmempunyaikhasiatbakteriostatik
terhadapM.tuberculosis.Resistensisilangseringterlihatantarathioacetazonedengan
isoniaziddanethioonamide.Karenakerapmenimbulkanreaksihipersensitifitasberat
( sindroma StevenJohnson), thioacetazone tak dianjurkan untuk digunakan pada
penderitadenganHIV3.9
4.Fluorokinolon
Fluorokinolon menghambat trpoisomerase II (DNA gyrase), dan
tropoisomerase IV tetapi enzim ini tak ada pada mikobakteri. Sifat penting
fluorokinolon adalah kemampuannya untuk masuk ke dalam makrofag dan
memperlihatkan efek mikobakterisidnya di dalam sel itu. Yang diakui berkhasiat
sebagaiOATadalahfluorokinolongenerasikedua,yaituciprofloxacin,ofloxacin,dan
levofloxacin.Akantetapijumlahkajianklinikyangmenelitiperanfluorokinolonpaada
pengobatanmultidrugresistanttuberculosis(MDRTB)masihterbatas.Padakajian

kajianituoxofloxacindiberikandalandosis400mgsekaliharidanciprofloxacindalam
dosis 500750 dua kali sehari. Akan tetapi belakangan ini oxofloxacin dan
ciprofloxacin dirubah dosisnya masingmasnig menjadi 800 mg dan 1000 mg yang
diberikansatukalisehari.Didalamsatuujibandingdinyatakanbahwalevofloxacin
lebih unggul khasiatnya daripada ofloxacin yang dicakupkan kedalam pengobatan
penderitamultipledrug resistanttuberculosis(MDRTB). Efek samping yang
berkaitandenganpenggunaanfluorokinolonmencakupgangguansalurancerna,efek
neurologik, artopathy dan fotosensitifitas. Percobaan invitro dengan fluorokinolon
baru yakni gatifloxacin dan moxifloxacin, memperlihatkan aktifitas antimikobakteri
yang lebih baik dari levofloxacin. Kedua kinolon baru itu memperlihatkan kadar
hambat minimal (MIC) yang lebih rendah dari kinolon lama. Sparfloxacin juga
memperlihatkanaktifitasantimikrobayangkuat,tetapifotosensitifitasnyayangberat
menghambat penggunaan klinis. Aktifitas farmakodinamik fluorokinolon
bersifatconcentrationdependent. Parameter farmakokinetiknya, yaitu kadar puncak
(Cmax) dan rasio luas area dibawah kurva (area under theconcentrationtime
curve/AUC)terhadapMICikutmenentukankemanjuranantimkobakterifluorokinolon.
Berdasarkan kedua parameter ini, moxifloxacin dalam dosis harian yang
direkomendasikan400mgterlihatpalingaktifterhadapMtuberculosis.Padapenderita
dengantuberculosisaktif,diperlihatkanmoxifloxacinmempunyaiaktifitasbakterisidal
awalyangsetaradenganrifampicin.Sampaisaatinipengalamanklinikpenggunaan
moxifloxacinmasihterbatasdanbelumadaizinpenggunaanuntuktuberculosis.
5.AminoglikosidadanCapreomycin
Kelompokobatsuntikinimempunyaimekanismekerjamengikatribosomdi
subunit30S,yangselanjutnyaberakibatpengambatansistesiprotein6.Obatiniharus
dapatmelintasidindingselsupayatempatkerjanyadiribosom.PadapHrendahyaitu
didalamkavitasdanabses,penetrasiobatmeliwatidindingselmikobakteriterhalang,
dan ini dapat menerangkan kekurangmanjuran aminoglikosida sebagai
antitiberkulosis.Lebihlanjutaminoglikosidatakdapatmelintasidindingsel,sebabitu
tak berkhasiat terhadap mikobakteri intrasel. Aminoglikosida berkhasiat bakterisid
hanya terhadap mikobakteri yang sedang membelah dan sedikit sekali efeknya

terhadapbasilyangtaksedangmembelah.Olehkarenaituaminoglikodsidahanya
bermanfaat pada pengobatan fase induksi, ketika mikobakteri dalam jumlah besar
sedangmembelahdiri,sedangkanpadapengobatanfaselanjutyangdiperlukanadalah
OAT yang aktif terhadap mikobakteri intrasel yang sedang membelah diri secara
lambat.9
Resistensi terhadap streptomycin biasanya sering dijumpai pada wilayah
dimana obat itu luas digunakan. Tempat kerja masingmasing aminoglikosida di
ribosom30Sadalahtaksama.Amikacinumumnyaaktifterhadapmikobakteriyang
sudahresistantterhadapstreptomycin,tetapiantaraamikacindengankanamycinselalu
adaresistensisilang.Dilainfihakmikobakteriyangsudahresistendenganamikasin
selaluresistenpuladenganstreptomycin.Capreomycinadalahobatmahal,tetapiaktif
terhadapstrainmikobakteriyangsudahresistenterhadapstreptomycin.Strainyang
sudah resisten dengan capreomycin masih dapat diatasi dengan amikacin, tetapi
sebaliknyatidak.9
6.Betalaktam
Coamoxiclav dan ampicillin/sulbactam invitro mempunyai aktifitas
terhadapM tuberculosis. Penghambat betalaktamase adalah esensial untuk
menghambat hidrolisis oleh betalaktamase yang dihasilkan oleh mikobakteri,
sehinggamemungkinkanpenetrasiaminopenicillinmeliwatidindingsel.Aktifitas
bakterisidal dini coamoxiclav yang dilaporkan sebanding dengan oxofloxacin
menyokong penggunaan obatini diklinik.Akantetapi aktifitas bakterisidhanya
terhadapmikobakteripadafaseeksponensialdantidakpadafasestasioner,sehingga
diperkirakan obat ini hanye bermanfaat untuk mencegah timbulnya resistensi
terhadapobatobatlainnyayangdiberikanbersama..Kemanjurancoamoxiclavdalam
regimenpengobatanpadakasustuberkulosisyangresistensudahdilaporkan,tetapi
belumadaujiklinikyangmenilaiefeknyasecaradefinitif.9
7.Rifabutin

Rifabutindanrifampicinadalahturunanrifamycin,resitensisilangdapat
terjadi antara keduanya, akan tetapi masih ada sekitar 15%
strainMtuberculosisyangsudahresistendenganrifampicinditemuimasihsensitif
dengan rifabutin. Rifabutin lebih disukai dari rifampicin pada pengobatan
penderitatuberkulosisdenganHIVyangsedangdiobatidenganproteaseinhibitor,
karena rifabutin merupakanmetabolicinduceryang lebih lemah daripada
rifampicin.9
8.Cycloserine
Cycloserine memperlihatkan efek mikobakteriostatiknya melalui
penghambatansintesisdindingsel.Penelitianklinisyangdilalukanpadatahun
1950anmemperlihatkankemanjuranyanglebihrendahdisbandingdenganPAS,
disertaidenganefeksampingneueopsikiatrikyangterlihatpada50%penderita
yang menerima dosis 1 gram perhari. Gejalanya mencakup serangan kejang,
psikosis,berbicaratakjelas,mengantuk,dankoma.Pyridoxindalamdosis100
200mgmungkindapatdigunakanuntukmencegahataumeringankankejadian
efeksampingneurotoksisk.Dalamdosisrendahefeksampingkurangkerap;dosis
yang digunakan adalah 23 kali 250 mg perhari, dan kadarnya dalam darah
dianjurkantaklebihdari30ng/ml.9
9.Clarithromycin
Makrolidinimempunyaispectrumyangmencakupmikobakteri.,dan
sering digunakan untuk pengobatan infeksiMycobacterium avium. Kadar
clarithromycin yang tercapai dalam darah dan jaringan paru adalah diatas
MIC90, sehingga efektif terhadapM tuberculosis.Pada hewan coba
diperlihatkanadanyapenumpukanclarithromycindidalamselmakrofag,dan
inikelihatannyaterkaitdengankasiatantimikrobanya.Yangmenarikadalah
obat penghambat sintesis dinding sel dalam kadarsubinhibitorydapat
meniadakan resistensiMtuberculosisterhadap clarithromycin, barangkali
dengan cara mempermudah masuknya clarithromycin ke dalam sel. Lebih

lanjut telah diperlihatkan clarithromyci dapat mengembalikan aktifitas


antimikroba OAT primer (isoniazid, rifampicin dan ethambutol) terhadap
mikobakteriyangsudahresisten.Akanterapisampaisekarangbelumadadata
klinistentangpenggunaanclarithromycinterhadappenderitaMDRTB.9
10.Linezolid
Linezolidadalahturunanoxazolidinoneyangterutamadigunakan
untuk infeksi kuman gram positif yang juga mempunyai khasiat
antimikobakteri.Carakerjanyaadalahmenghambatsintesisproteindengan
cara berikatan dengan ribosom subunit 5013. Pengalaman klinik
penggunaanobatinipadapenderitatuberkulosismasihsangatterbatas.9
11.Obatobatlain
Invitro, clofazimin aktif menghambat pertumbuhanM
tuberculosisdidalamsel.Clofaziminterkonsentrasididalammakrofagdan
dilaporkanmanjurdalampengobatantubekulosispadahewancoba..Belum
ada data klinis tentang penggunaannya pada tuberkulosis yang resisten
terhadapobatobatgarispertama.Chlorpromazinedanturunanphenothiazine
lainnya diperlihatkan invitro menghambat pertumbuhan intrasel dariM
tuberculosisyang resisten terhadap OAT primer. Tetapi kemanjurannya
belum diuji pada penderita tuberkulosis. Senyawaan baru, turunan
nitroimidazopyran,polipeptidadanpyrrolesedangdalampengujianinvitro
daninvivoterhadapMtuberculosisyangresisten.9
Alaspemberianlebihlamakarenamencegahresitensiterhadapoatyangsudah
diberikansebelumnya.
3. ApaalatpemeriksaanTBterbaru?

Badan Bantuan Amerika Serikat (USAID) menghibahkan mesin diagnosa TBMDR


yangdikenaldengannamaXpertuntukIndonesia.Denganalatini,Tuberculosisyangresisten
denganobatdapatdideteksidalamsatujam.

SUMBER
1. Amin Z, Bahar A. Tuberkulosis Paru. Dalam: Sudoyo AW, Setyohadi B, Alwi I,
SimadibrataKM,SetiatiS,editors.Bukuajarilmupenyakitdalam.JilidIII.EdisiIV.
Jakarta:InternaPublishing;2009.hal.22309.
2. http://healthcarepharmacist.blogspot.com/2011/10/obatantituberkulosis.html
MuchtarA.FarmakologiObatAntituberkulosis(OAT)Sekunder.JurnalTuberkulosis.
2006;3(2):239
3. http://dunia.news.viva.co.id/news/read/313663sejamdeteksitbdenganalathibahdari
as

Anda mungkin juga menyukai