Anda di halaman 1dari 238

.

LO

1.

2.
3.

HUB. KAPTOPRIL DENGAN


PBESARAN PROSTAT
EFEK AGING HORMON
REPRODUKSI ORGAN
FUNGSI PSA

Meski proses menua dianggap sebuah kewajaran,


namun ada konsekuensi penurunan fungsi tubuh pada
lansia. Orang tua, akan mengalami perubahan baik fisik,
kognitif, sosial, dan psikologis akibat regenerasi sel
yang menurun, atau tingkat hormon yang berkurang.
Perubahan segala sisi itu akan menyebabkan
ketergantungan lansia pada keluarga atau orang
terdekat mereka. Pemeliharaan kesehatan, seperti yang
dikatakan Ical, adalah salah satu upaya untuk
meminimalkan ketergantungan lansia pada orang
sekitarnya.
Seperti kembali ke masa kanak-kanak, lansia kerap
mengalami keluhan mengompol atau inkontenensia urin
(IU). Prevalensinya, menurut data RSCM, terdapat pada
hampir 60 persen pasien di panti rawat usia lanjut, 2530 persen pasien yang baru pulang dari perawatan
penyakit akut. Hasil survey Poliklinik Geriatri tahun
2006 menempatkan perempuan menduduki porsi lebih

besar, yaitu 55,6 persen dam laki-laki 44,4 persen.


IU yang kedengarannya sepele, dapat berdampak serius
bagi lansia tersebut maupun orang sekitarnya.
Lingkungan menjadi kotor, berbau, meningkatkan risiko
jatuh, dan lain sebagainya. Secara langsung maupun
tidak langsung dapat menimbulkan masalah medis,
psikologis, sosial, dan ekonomi, ujar Dr. Edy Rizal
Wahyudi, SpPD. Karena itu, IU harus dapat dideteksi
dan disembuhkan. Jika tidak, IU selalu dapat ditangani
hingga tetap membuat pasien nyaman, memudahkan
pramurawat, dan meminimalkan biaya, ujar Edy lagi.
IU

Akut
Penanganan IU akut pada usia lanjut berbeda
tergantung kondisi yang dialami pasien. Penyebab IU
akut antara lain terkait dengan gangguan di saluran
kemih bagian bawah, efek obat-obatan, produksi urin
meningkat atau adanya gangguan kemampuan/keinginan
ke
toilet.
Gangguan saluran kemih bagian bawah bisa karena
infeksi. Jika terjadi infeksi saluran kemih, maka
tatalaksananya adalah terapi antibiotika, ujar Edy.
Apabila vaginistis atau uretritis atrofi penyebabnya,
maka dilakukan tertapi estrogen topical. Terapi perilaku
harus
dilakukan
jika
pasien
baru
menjalani
prostatektomi. Pembedahan harus dihindari sampai
dipastikan kondisi tersebut tidak akan membaik. Dan,
bila terjadi impaksi feses, maka harus dihilangkan
misalnya dengan makanan kaya serat, mobilitas, asupan
cairan yang adekuat, atau jika perlu penggunaan
laksatif.

IU akut juga bisa terjadi karena produksi urin


berlebih karena berbagai sebab. Misalnya gangguan
metabolik, seperti diabetes melitus, yang harus terus
dipantau. Sebab lain adalah asupan cairan yang
berlebihan yang bisa diatasi dengan mengurangi asupan
cairan yang bersifat diuretika seperti kafein. Gagal
jantung kongestif juga bisa menjadi faktor penyebab
produksi urin meningkat dan harus dilakukan terapi
medis
yang
sesuai.
Gangguan kemampuan ke toilet bisa disebabkan oleh
penyakit kronik, trauma, atau gangguan mobilitas. Untuk
mengatasinya penderita harus diupayakan ke toilet
secara teratur atau menggunakan substitusi toilet.
Apabila penyebabnya adalah masalah psikologis, maka
hal
itu
harus
disingkirkan
dengan
terapi
nonfarmakologik atau farmakologik yang tepat.
Pasien lansia, kerap mengonsumsi obat-obatan
tertentu karena penyakit yang dideritanya. Nah, obatobatan ini bisa sebagai biang keladi mengompol pada
orang-orang tua. Jika kondisi ini yang terjadi, maka
Hentikan atau ganti obat jika memungkinkan, turunkan
dosis atau modifikasi jadwal pemberian obat, kata Edy.
Ia lebih lanjut memaparkan golongan obat yang
berkontribusi pada IU, yaitu diuretika, antikolinergik,
analgesik, narkotik, antagonis adrenergic alfa, agonic
adrenergic alfa, ACE inhibitor, dan kalsium antagonik.
Golongan psikotropika seperti antidepresi, antipsikotik,
dan sedatif hipnotik juga memiliki andil dalam IU.
Kafein dan alcohol juga berperan dalam terjadinya
mengompol.

IU
Persisten
Mengompol juga ada yang bersifat menetap dan tidak
terkait dengan penyakit akut, disebut IU persisten.
stress, urgensi, overflow, dan gangguan fungsional
adalah faktor penyebabnya. Tipe stress didefinisikan
sebagai keluarnya urin involunter tatkala terdapat
peningkatan tekanan intraabdomen, seperti batuk,
tertawa, olahraga, dan lain-lain. Sedangkan urgensi
adalah keluarnya urin akibat ketidakmampuan menunda
berkemih tatkala timbul sensasi keinginan untuk
berkemih. Overflow adalah keluarnya urin akibat
kekuatan mekanik pada kandung kemih yang
overdidtensi atau factor lain yang berfek pada retensi
urin
dan
fungsi
sfingter.
Edy memaparkan terapi inkontinensia urin untuk lini
pertama hingga ketiga berdasarkan tipe inkontinensia
yang
disebutkan
di
atas
lihat
table
1.
Beberapa pilihan terapi farmakologi untuk inkontinensia
urin pada pasien usia lanjut meliputi obat-obatan
antikolinergik dan antispamodik (bladder relaxant) atau
agonis
kolinergik.
Deteksi
dan
Identifikasi
Edy mengingatkan, harapan untuk mendapatkan
keluhan masalah IU dari pasien atau keluarga akan
kecil. Pasien usia lanjut sering datang dengan keluhan
dan masalah lain yang berhubungan langsung mamupun
tidak langsung dengan IU, ujar Edy. Keluhan tersebut
seperti infeksi saluran kemih, jatuh dengan semua
akibatnya, sindrom delirium akut atau bahkan sangat
tidak berhubungan dengan IU, mengingat adanya

karakteristik multi patologi pada pasien geriatri.


Masalah IU masih kurang mendapat perhatian dari
pasien dan keluarga. Hanya kurang dari 50 persen
pasien dengan IU yang melaporkan masalahnya ke
dokter,
ujar
Edy.
Ada atau tidak ada keluhan yang dilaporkan oleh
pasien dan keluarganya, deteksi atau identifikasi harus
dilakukan melalui observasi langsung atau menanyakan
pertanyaan-pertanyaan penapisan IU. Selanjutnya
dilakukan evaluasi dasar dengan pengkajian paripurna,
dengan anamnesis yang teliti, pemeriksaan fisik lengkap
dan penunjang lainnya yang bertujuan mengidentifikasi
penyebab inkontinensia yang bersifat sementara.
Berdasarkan evaluasi dasar tersebut akan ditegakkan
diagnosis presumtif dan diberikan terapi percobaan.
Jika diagnosis presumtif tidak dapat dibuat atau
terapi percobaan tidak efektif, pasien harus menjalani
evaluasi lanjutan yang lebih kompleks, kata Edy.

ASKEP INKONTINENSIA PADA LANSIA


A. PENDAHULUAN
Sistem renal dan urinaria terdiri dari ginjal, ureter,
kandung kemih, dan uretra . Ureter , kandung
kemih, dan uretra terutama sebagai system
penyimpanan dan transportasi untuk pengeluaran
urine dari dalam tubuh ketika telah dibentuk oleh
ginjal. Ginjal secara fisiologis lebih kompleks dan
secara vital terlibat dalam penampilan fungsi
homeostasis yang sangat penting.
B. PERUBAHAN STRUKTUR DAN FUNGSI PADA
SISTEM RENAL DAN URINARIA
Peubahan struktur Perubahan fungsi
Membarn basalis glomerulus menebal GFR sering
menurun.
Total permukaan glomerular berkurang
Kemampuan konsentrasi menurun
Panjang dan volume tubulus proksimal menurun
Nokturia sering terjadi
Pada tubulus distal berkembang divertikula Serum
kreatinin tetap sama
Sirkulasi renal berubah atau berkurang
Kecenderungan h\kehilangan garam tidak
diketahui.
Kapasitas kandung kemih menurun Metabolisme
kalsium dan vitamin D mungkin terpengaruhi
Volume residual meningkat Mekanism homeostasis
berubah dan menjadi lebih sulit
Terjadi kontraksi kandung kemih secara involunter.
Frekuensi meningkat,interval antara keinginan dan
berkemih menurun.
C. PERUBAHAN NORMAL PADA SISTEM RENAKL DAN
URINARIA AKIBAT PENUAAN
PERUBAHAN NORMAL TERKAIT USIA IMPLIKASI
KLINIS

Penebalan dasar membran Filtrasi darah kurang


efisien
Penurunan area permukaan glomerulus
Penurunan panjang dan volume tubulus proksimal
Penurunan aliran darah vaskular
Penurunan massa otot yang tidak berlemak
Penurunan total cairan tubuh
Peningkatan total lemak tubuh Resiko dehidrasi
Penurunan cairan intrasel
Penurunan sensasi haus
Penurunan kemampuan untuk memekatakan urine
Penurunan hormon yang penting absorbsi kalsium
dari saluran gastrointestinal Peningkatan resiko
osteoporosis
Penurunan kapasitas kandung kemih Peningkatan
resiko inkontinensia
Peningkatan residu
Peningkatan kontraksi kandung kemih yang tidak
disadari
Atropi otot kandung kemih secara umum
D. ASKEP PADA PASIEN DENGAN INKONTINENSIA
Temuan fisik pada pengkajian head to toe
Sistem Temuan pemeriksaan fisik
Integument Lemak subkutan menyusut
Kulit kering dan tipis, rentan terhadap trauma dan
iritasi, serta lambat sembuh
Mata Arcus senilis, penurunan visus
Telinga Pendengaran berkurang yang selanjutnya
dapat berakibat gangguan bicara
Kardiopulmonari Curah jantung berkurang serta
elastisitas jantung dan pembuluh darah bekurang.
Terdengar bunyi jantung IV (S4) dan bising sistolik.
Kapasitas vital paru, volume ekspirasi, serta
elastisitas paru-paru berkurang.

Walaupun tak ada kelainan paru dapat terdengar


ronki basal
Musculoskeletal Massa tulang berkurang , lebih
jelas pada wanita . jumlah dan ukuran otot
berkurang.
Massa tubuh banyak yang tergantikan oleh
jaringan lemak yang disertai pula oleh kehilangan
cairan
Gastrointestinal Mobilitas dan absorpsi saluran
cerna berkurang , daya pengecap produksi saliva
menurun
Neurologi Rasa raba juga berkurang , arm-swing,
langkah menyempit, dan pada pria agak melebar.
Selain itu,terdapat potensi perubahan pada status
mental.
Inkontinensia dapat berupa inkontinensia fekal dan
inkontinensia urine.
INKONTINENSIA FEKAL
Inkontinensia fekal biasanya akibat daristatis fekal
dan impaksi yang disretai penurunan aktivitas ,
diet yang tidak tepat , penyakit anal yang nyeri
yang tidak diobati, atau konstipasi kronis.
Inkontinensia fekal juga dapat disebabkan oleh
penggunaan laksatif yang kronis, penurunan
asupan cairan, defisit nuerologis, pembedahan
pelvik, prostat, atau rektum serta obat-obatan
seperti antihistamin, psikotropik, dan preparat besi.
a. Tanda dan gejala
Pembesaran feses yang terus menerus dari
rektum
Ketidakmampuan megenali kebutuhan defekasi
Kram abdomen dan distensi
Kemungkinan impaksi fekal
b. Pemeriksaan Diagnostik
Pemeriksaan rektum digital dapat meyingkirkan
kemumgkinan impaksi fekal.

Kolonoskopi mungkin diperlikan untuk


mendeteksi gangguan usus lainnya.
c. Penanganan
Pasien yang menderita inkontinensia fekal harus
dikaji penyebab masalah yang mendasari
penyakitnya dengan cermat. Jika masalahnya
adalah tonus sfingter anal yang buruk, latihan otototot panggul dapat membantu mengoreksinya.
Lansia dapat diajarkan untuk mengontraksikan dan
merilekskan sfingteranal dalam program latihan
yang teratur untuk mengustksn otot-otot tersebut.
Jika penyebabnya karena impaksi, sumbatan harus
dihilangkan dengan enema atau secara manual.
Enema dan supositoria dapat digunakan secara
berulang untuk mendapatkan evakuasi feses yang
tuntas. Jika penyebabnya karena proktitis, enema
kortikosteroid yang diresepkan dapat bermanfaat.
d. DIAGNOSIS KEPERAWATAN UTAMA DAN KRITERIA
HASIL
Inkotinensia fekal berhubuhan dengan kerusakan
neuromuskuler, diare, impaksi felal, atau kerusalan
kognitif
Kriteria hasil:
Pasien akan dapat mengendalika defekasi
setelahlatihan kembali defekasi.
Ansietas berhubungan dengan inkontinensia
fekal
Kriteria hasil :
Pasien akan mengungkapkan perasaannya
mengenai kecemasan dan mengetahui
maekanisme koping.
Resiko kerusakan integritas kulit berhubungan
dengan inkontinensia fekal
Kriteria hasil :
Pasien akan mempertahankan integritas kulit.
e. Intervensi keperawatan
Jadwalkan waktu tambahan untuk mendorong

dan memberi dukungan pada pasien serta untuk


mengurangi perasaan malu, memelukan , atu tidak
berdaya akibat kehilangan pengendalian. Puji
keberhasilan upaya pasien.
Mulai program toileting terjadwal dengan
mengkaji pasien agar mengetahui kapan waktu
defekasi rutinnya ( seg\bagai contoh,setelah
sarapan pagi atau setelah minum hangat lainnya).
Ingatkan pasien dan bantu
menggunakanya.Pastikan ia mengetahui letak
toilet dan temani pasien untuk memastikan ia telah
berdefekasi secara sempurna.
Pertahankan perawatan higiene yag efektif untuk
meningkatkan kenyamanan pasien dan mencegah
kerusakan kulit dan infeksi.
Dorong pasien untuk makan diet kaya serat
dengan sayur-sayuran berdaun kasar(seperti
wortel dan selada ), buah tidak dikupas ( apel ),
dan gandum utuh ( seperti gandum atau roti
gandum dan sereal ), kulit padi merupakan sumber
serat terbaik.
Anjurkan asupan cairan yang adekuat (8 sampai
10 gelas air per hari jika kondiri pasien
memungkinkan )
Tingkatkan latihan yang teratur dengan
menjelaskan cara latihan untuk menggunakan
defekasi yang teratur, bahkan pasien yang
melakukan ambulasi dapat melakukan latihan
sambil duduk atau berbaring di tempat tidur.
f. Penyuluhan Pasien
Ajarkan pasien untuk secara bertahap
menghilangkan penggunaan laksatif jika perlu.
Tekankan bahwa penggunaan laksatif yang dijual
bebas untuk meningkatkan defekasi teratur dapat
meyebabkan efek berlawanan dan menyebabkan
konstipasi atau inkkontinensia sepanjang waktu.
Anjurkan penggunaan laksatif alami, seperti buah

prem atau jus buah prem.


INKONTINENSIA URINE
a. DEFINISI
Inkontinensia urine adalah
pengeluaran urine tanpa disadari dalam jumlah
yang banyak dan frekwensi yang cukup yang
menyebabkan gangguan kesehatan dan sosial.
Inkontinensia urine bukan merupakan tanda-tanda
normal penuaan. Jutaan lansia mengalami
beberapa kehilangan kendali volunter. Masalah
kontinensia urinarius dibagi menjadi akut atau
persisten dan inkontinensia total. Inkontinensia
akut terjadi secara tiba-tiba dan biasanya akibat
dari penyakit akut. Inkontinensia akut juga dapat
akibat dari obat, terapi, dan faktor
lingkungan.Inkontinensia persisten diklasifikasikan
menjadi inkontinensia urgensi, inkontinensia Stres,
inkontinensia Overflow, dan inkontinensia
fungsional.
Inkontinensia urgensi adalah keinginan kuat yang
tiba-tiba untuk berkemih disertai keluarnya urine.
Inkontinensia stres adalah keluarnya urine dengan
tiba tiba akibat aktivitas tertawa, bersin, batuk,
mengangkat beban, melompat, atau membungkuk.
Inkontinensia overflow adalah sering keluarnya
urine atau kadang konstan akibat kandung kemih
yang penuh. Inkontinensia fungsional terjadi akibat
imobilitas atau kerusakan kognitif dengan saluran
kemih bawah tetap utuh.
b. ETIOLOGI
Penyebab inkiontinensia akut mencakup konfusi,
dehidrasi, obat yang diresepkan, ureteritis, dan
vaginitis atrofik. Infeksi, khususnya infeksi saluran
kemih (ISK) simtomatik, juga dapat meyebabkan
inkontinensia. Inkontinensia urine juga dapat
disebabkan oleh ketidakseimbangan endokrin,

seperti hiperkalsemia dan hiperglikemia.


Keterbatasan mobilitas atau penyakit yang
menyebabkan retensi urine dapat mencetuskan
inkontinensia urine atau akibat dari depresi pada
lansia.
Inkontinensia urgensi akibat dari kontraksi kandung
kemih volunter. Iritasi otot detrusor ( oto luar yang
meyelubungi kandung kemih ) yang disebabkan
oleh faktor menyebabkan iritasi likal sepertiinfeksi,
batu, tumor, atau obstruksi dapat menyebabkan
inkontinensia urgensi, seperti hiperaktivitas otot
detrusor yang dapat akibat dari cedera
serebrovaskuler, penyakit spina suprasakral,
penyakit parkinson,demensia, dan penyakit
demieliniasi.
Inkontinensia stres disebabkan oleh kelemahan
anatomik pada dasar panggul. Trauma
perineal,kelemahan jaringan terkait dengan
penuaan, kekurangan estrogen, kerusakan saraf
pudendal, dan traumaginekologik akibat
pembedahandapat mentebabkan klemahan dasar
panggul.
Inkontinensia overflow terjadi ketika kandung
kemih menjadi terlalu tegang akibat pengosongan
yang tidak sempurna.lansia sering tidak mampu
merasakan kandung kemih yang penuh. Diabetes
dan obat- obatan yang mentebabkan retensi urine
seperti analgesik, psikotropik, agonis beta
adrenergik, penyakit salurankalsium, dan agens
antikolinergik seperti sklerosis multiple atau lesi
suprasakral.
Inkontinensia fungsional disebabkan oleh
gangguan pada runititas kontinensia individu
tersebut. Imobilitas dan kerusakan kognitif
merupakan dua penyebab umum. Pemakaian
restrei fisik atau kimia atau pembatasan
lingkungan seperti sisi pengamanan dapat

menyebabkan inkontinensia fungsional pada


lansia. Masalah psikologis, seperti depresi, atau
gangguan bipolar, merupakan penyebab lainnya.
c. TANDA DAN GEJALA
Melaporkan merasa desakan berkemih, disertai
ketidakmampuan mencapai kamar mandi karena
telah mulai berkemih.
Desakan, frekwensi, dan nokturia
Inkontinensia stres, dicirikan dengan keluarnya
sejumlah kecil urine ketika tertawa, bersin,
melompat, batuk, membungkuk
Inkontinensia overflow, dicirikan dengan aliran
urine yang buruk atau lambat dan merasa
menunda atau mengejan
Inkontinensia fungsional, dicirikan dengan
volume dan aliran urine yang adekuat
Higiene buruk atau tanda tanda infeksi
Kandung kemih terletak di atas simfisis pubis
c. PEMERIKSAAN DIAGNOSTIK
Urinalisis digunakan untuk melihat apakah ada
bakteri, darah, dan glukosa dalam urine.
Uroflowmetri digunakan untuk mengevaluasi pola
berkemih dan menunjukkan obstruksi pintu bawah
kandung kemih denan mengukur laju aliran kitika
pasien berkemih.
Cysometri digunakan untuk mengkaji fungsi
neuromuskuler kandung kemih denagn efisiensi
reflek otot detrusor, tekanan dan kapasitas
intravesikal, dan reaksi kandung kemih terhadap
rangsangan panas.
Urografi ekskretorik, disebut juga pielografi
intravena, digunakan untuk untuk
mengevaluasistruktur dan fungsi ginjal
Kateterasi residu pascakemih digunakan untuk
mementukan luasnya pengosongan kandung
kemih dan jumlah dan jumlah urine yang tersisa

dalam kandung kemih setelah pasien berkemih.


d. PENANGANAN
Terapi obat dengan penyebab inkontinensia.
Antibiotik deresepkan jika inkontinensia akibat
inflamasi yang disebabkan oleh infeksi bakteri.
Obat antukolinergik digunakan untuk memperbaiki
fungsi kandung kemih jika dicurigai ada
ketidakstabilan pada otot detrusor. Obat
antispasmodik diresepkan untuk hiperrefleksia
detrusor untuk menekan aktivitas otot polos
kandung kemih. inkontinensia kadang diterapi
dengan obat antidepresan.
Terapi perilaku meliputi latihan berkemih, latihan
kebiasaan dan wqaktu berkemih, penyegaran
berkemih, dan latihan otot panggul. Latihan otot
panggul sangat baik digunakan oleh pasien dengan
fungsi kognitif yang utuh yang mengalami
inkontinensia stres. Latihan kebiasaan , bermanfaat
bagi pasien yang mengalami demensia atau
kerusakan kognitif, mencakup menjaga jadwal
berkemih yang tetap, biasanya setiap 2 sampai 4
jam. Tujuannya adalah pasien berkemih sebelum
secara tidak sengaja berkemih. Latihan kembali
berkemih dapat bermanfaat bagi pasien dengan
fungsi kognitif yang utuh. Latihan ini mengajarkan
pasien menahan desakan berkemih.
Spiral dapat diressepkan untuk pasien wanita yang
mengalami kelainan anatomi, seperti prolaps
uterus berat atau relaksasi pelvik.penngunaan
kondom jangka pendek dapat diresepkan bagi
pasien pria untuk membantunya mencegah
berkemih secara tidak sengaja dengan efektif.
Penggunaan kondom secara terus menerus harus
dihindari, karena dapat menyebabkan ISK dan
iritasi kulit.pada pria yang mengalami
inkontinensia akibat hipertrofi prostat, penanganan
dapat mencakup reseksi transurenal prostat atau

prostatektomi terbuka. pembedahn dapat


digunakan untuk menghilangkan lesi yang
menyumbat yang menyebabkan inkontinensia atau
overflow.
Obat- obatan untuk klian dengan inkontinensia:
a) Bila penyebab inkontinensia adalah stres, maka
obat yang diberikan adalah phenylpropanolamine,
estrogen/ progestin.
b) Bila penyebab inkontinensianya akibat urgensi,
maka beri obat propantheline, imipramie, dan
dicyclomine.
c) Bila penyebab akibat retensi, maka diberi obat
bethanecol.
d) Dan bila akibat retensi, maka diberi obat
phenoxybenzamine.
DIAGNOSIS KEPERAWATAN UTAMA DAN KRITERIA
HASIL
Gangguan eliminasi urine yang berhubungan
dengan penyebab yang mendasari inkontinensia
urine
kriteria hasil :
pasien akan mencapai kontinensia
Resiko gangguan integritas kulit yang berhubungan
dengan inkontinensia urine
kriteria hasil :
Pasien akan mempertahankan integritas kulit.
Gangguan citra tubuh yang berhubungan dengan
inkontinensia
kriteria hasil :
Pasien akan mengkomunikasikan perasaan positif
mengenai perubahan citra tubuh.

INTERVENSI KEPERAWATAN
Jelaskan semua pemeriksaan dan prosedur kepada
pasien anda. Fasilitasi pasien untuk mengajukan
pertanyaan, dan jawaban dengan jujur. Berikan
privasi untuk diskusi apapun.
Berikan antibiotik dan obat lainnya,sesuai
program.
Orientasikan pada pasien ke lokasi kamar mandi
dan alat panggil. Berikan pencahayaan yang
adekuat di dalam kamar mandi untuk membantu
pasien terhindar dari kecelakaan selama malam
hari. Jika ia membutuhkan bantuan ke kamar
mandi , tawarkan padanya setiap 2 jam atau ketika
ia terjaga.
Jelaskan rutinitas latihan berkemih dan pasang
jadwal tersebut. Bantu pasien yang mendapat
latihan berkemih untuk latihan napas guna
menunda desakan berkemih.Berikan penguatan
positif yang cukup untuk semua upaya ke arah
inkontinensia.
Berikan perawatan perineal yang sering, dan
perhatikan lansia apakah ada kerusakan kulit.
Cuci dengan sabun ringan dan air , dan keringkan
kulit dengan menepuk nepuknya. Cudi dari arah
depan kebelakang untuk menghindari penyebaran
kontaminasi.
Bantu pasien memasukkan spiral, sesuai program.
Jika katerisasi intermiten diprogramkan, lakukan
tepat waktu dan dokumentasikan jumlah urine
yang kembali tertampung.
Untuk pasien pasca operasi, catat pengukuran
asupan dan haluaran yang akurat . Berikan
perawatan kateter dan ambulansikan pasien
sesegera mungkin.
Penyesuian faktor lingkungan selaku tindakan

pencegahan bagi klien inkontinensia:


a. Perhatikan pencahayaan dan faktor serupa
mengenai akses ke toilet.
b. lengkapi toilet dengan pegangan dan
semacamnya.
PEYULUHAN PASIEN
Ajarkan lansia mengenai cara kerja dan efek
merugikan obat yang diresepkan. Jika pemberian
antibiotik diprogramkan , tekankan pentingnya
meminum semua pil yang diresepkan.
Jelaskan semua prosedur dan alat yang digunakan
untuk memperbaiki atau mengatasi inkontinensia
urine. Jika latihan kebiasaan termasuk dalam
rencana terapi, pastikan untuk melibatkan anggota
keluarga pasien dan pemberi perawatan lainnya
dalam rencana penyuluhan.
Jika pasien mengikuti latihan berkemih, tunjukkan
cara menekan desakan berkemih dengan
bernapas lambat dan dalam. Anjurkan pada pasien
mempraktikan prosedur ini.
Ajarkan pada pasien pria cara memasang dan
memeakai kateter kondom, dan tunjukkan cara
menghindari komplikasi seperti dermatitis kontak
dan maserasi penis, iskemia,serta obstruksi.
AKTIVITAS PEYULUHAN KESEHATAN
a) Minta bantuan kolaboratif dari pihak yang
berkompeten.
b) Minum air 8-10 gelas per hari , tapi kurang di
malam hari.
c) Jangan berpatokan pada rasa haus, tapi
minumlah sesuai anjuran di atas.
d) Hindari minuman yang mengandung alkohol dan

kafein, apalagi di malam hari.


e) Cegah hal- hal yang dapat berakibat konstipasi
f) Minumlah 1-2 gelas air sebelum atau selama
melakukan kegiatan yang menguras keringat.
PANDUAN PENGAJARAN UNTUK LATIHAN KEGEL
DAN BLADDER TRAINING
Latihan Pelvis Kegel:
1. Anda harus melakukan latihan ini minimal
selama 6 minngu sebelum Anda mengetahui
apakah latihan tersebut dapat membantu. Otot
otot akan mengalami kekuatan penuh setelah 3
bulan.
2. Otot-otot ynag terlibat adalah otot-otot yang
digunakan untuk menahan urine ketika Anda
merasa harus ke kamar kecil. Cobalah untuk ke
kamar kecil dan kemudian hentikan aliran urine
tanpa mengencangkan oto perut Anda. Hal ini
adalah cara untuk melakukan latihan.
3. Kontraksi dan relaksasikan otot-otot ini 4 kali per
hari dan lakukan pengulangan sebanyak 15 kali
setiap kali latihan. Secara keseluruhan , berarti 60
kali setiap harinya.Suatu cara yang mudah untuk
mengingatnya adalah dengan melakukan latihan
tersebut sebelum makan dan pada saat akan tidur.
BLADDER TRAINING
1. Pertama buat catatan harian selama 5 hari
untuk mencatat waktu berkemih Anda. masukkan
semua, baik saat Anda melakukannya ke toilet
atau tidak.
2. Lihat catatan harian Anda dan temukan interval
terpendek yang Anda miliki di antara waktu
waktu tersebut.
3. Tambahan 30 menit terhadap interval tersebut.

Sebagai contoh, jika interval terpendek yang Anda


miliki di antara berkemih dengan berkemih
selanjutnya adalah 20 menit, kemudian anda
menambahkan 30 menit sehingga menjadi 50
menit.
4. Untuk berikutnya, pergilah ke kamar kecil setaap
50 menit, Apakah Anda merasa perlu atau
tidak.Jika anda merasa harus pergi ke kamar kecil
lebih cepat, coba tahan dan alihkan perhatian anda
dengan cara menonton Tv,berbicara telepon atau
apapun yang dapat anda pikirkan.
5. Setelah minggu pertama, tambahkan 30 menit
lagi(anda sekarang akan menahan urine selama 1
jam 20 menit misalnya )
6. Tambahkan 30 menit setiap minggu sampai
anda dapat berkemih dengan jarak waktu 3-4
jam.Hal ini adalah yang sebagaian besar orang
lakukan , sehingga anda kembali normal.Pastikan
untuk memeriksa interval Anda sejak sekarang dan
kemudian pastikan bahwa anda tetap mengikuti
jadwal seperti ini.

Inkontinensiaurinmerupakansalahsatumanifestasipenyakit
yangseringditemukanpadapasiengeriatri.Diperkirakan
prevalensiinkontinensiaurinberkisarantara1530%usialanjut
dimasyarakatdan2030%pasiengeriatriyangdirawatdirumah
sakitmengalamiinkontinensiaurin
INKONTINENSIAURIN
Inkontinensiaurinmerupakansalahsatumanifestasipenyakit
yangseringditemukanpadapasiengeriatri.Diperkirakan
prevalensiinkontinensiaurinberkisarantara1530%usialanjut
dimasyarakatdan2030%pasiengeriatriyangdirawatdirumah
sakitmengalamiinkontinensiaurin,dankemungkinan
bertambahberatinkontinensiaurinnya2530%saatberumur65
74tahun.Masalahinkontinensiaurininiangkakejadiannya
meningkatduakalilebihtinggipadawanitadibandingkanpria.
Perubahanperubahanakibatprosesmenuamempengaruhi
salurankemihbagianbawah.Perubahantersebutmerupakan
predisposisibagilansiauntukmengalamiinkontinensia,tetapi
tidakmenyebabkaninkontinensia.Jadiinkontinensiabukan
bagiannormalprosesmenua.
KlasifikasiInkontinensiaUrin
Inkontinensiaurindiklasifikasikan:
1.InkontinensiaUrinAkutReversibel
Pasiendeliriummungkintidaksadarsaatmengompolatautak
dapatpergiketoiletsehinggaberkemihtidakpadatempatnya.
Biladeliriumteratasimakainkontinensiaurinumumnyajuga
akanteratasi.Setiapkondisiyangmenghambatmobilisasi
pasiendapatmemicutimbulnyainkontinensiaurinfungsional
ataumemburuknyainkontinensiapersisten,sepertifraktur
tulangpinggul,stroke,arthritisdansebagainya.

Resistensiurinkarenaobatobatan,atauobstruksianatomis
dapatpulamenyebabkaninkontinensiaurin.Keadaaninflamasi
padavaginadanurethra(vaginitisdanurethritis)mungkinakan
memicuinkontinensiaurin.Konstipasijugasering

menyebabkaninkontinensiaakut.

Berbagaikondisiyangmenyebabkanpoliuriadapatmemicu
terjadinyainkontinensiaurin,sepertiglukosuriaataukalsiuria.
Gagaljantungdaninsufisiensivenadapatmenyebabkanedema
dannokturiayangkemudianmencetuskanterjadinya
inkontinensiaurinnokturnal.Berbagaimacamobatjugadapat
mencetuskanterjadinyainkontinensiaurinsepertiCalcium
ChannelBlocker,agonistadrenergicalfa,analgesicnarcotic,
psikotropik,antikolinergikdandiuretic.

Untukmempermudahmengingatpenyebabinkontinensiaurin
akutreversibledapatdilihatakronimdibawahini:
DDelirium
RRestriksimobilitas,retensiurin
IInfeksi,inflamasi,Impaksi
PPoliuria,pharmasi
2.InkontinensiaUrinPersisten
Inkontinensiaurinpersistendapatdiklasifikasikandalam
berbagaicara,meliputianatomi,patofisiologidanklinis.Untuk
kepentinganpraktekklinis,klasifikasiklinislebihbermanfaat
karenadapatmembantuevaluasidanintervensiklinis.
Kategoriklinismeliputi:
Inkontinensiaurinstress:
Takterkendalinyaaliranurinakibatmeningkatnyatekanan
intraabdominal,sepertipadasaatbatuk,bersinatauberolah
raga.Umumnyadisebabkanolehmelemahnyaototdasar
panggul,merupakanpenyebabterseringinkontinensiaurinpada
lansiadibawah75tahun.Lebihseringterjadipadawanitatetapi
mungkinterjadipadalakilakiakibatkerusakanpadasfingter
urethrasetelahpembedahantransurethraldanradiasi.Pasien
mengeluhmengeluarkanurinpadasaattertawa,batuk,atau
berdiri.Jumlahurinyangkeluardapatsedikitataubanyak.
Inkontinensiaurinurgensi:
Keluarnyaurinsecaratakterkendalidikaitkandengansensasi
keinginanberkemih.Inkontinensiaurinjenisiniumumnya

dikaitkandengankontraksidetrusortakterkendali(detrusor
overactivity).Masalahmasalahneurologisseringdikaitkan
denganinkontinensiaurinurgensiini,meliputistroke,penyakit
Parkinson,demensiadancederamedulaspinalis.Pasien
mengeluhtakcukupwaktuuntuksampaiditoiletsetelahtimbul
keinginanuntukberkemihsehinggatimbulperistiwa
inkontinensiaurin.Inkontinensiatipeurgensiinimerupakan
penyebabterseringinkontinensiapadalansiadiatas75tahun.
Satuvariasiinkontinensiaurgensiadalahhiperaktifitasdetrusor
dengankontraktilitasyangterganggu.Pasienmengalami
kontraksiinvoluntertetapitidakdapatmengosongkankandung
kemihsamasekali.Merekamemilikigejalaseperti
inkontinensiaurinstress,overflowdanobstruksi.Olehkarena
ituperluuntukmengenalikondisitersebutkarenadapat
menyerupaiikontinensiaurintipelainsehinggapenanganannya
tidaktepat.
Inkontinensiaurinoverflow:
Tidakterkendalinyapengeluaranurindikaitkandengandistensi
kandungkemihyangberlebihan.Halinidisebabkanoleh
obstruksianatomis,sepertipembesaranprostat,faktor
neurogenikpadadiabetesmelitusatausclerosismultiple,yang
menyebabkanberkurangatautidakberkontraksinyakandung
kemih,danfaktorfaktorobatobatan.Pasienumumnya
mengeluhkeluarnyasedikiturintanpaadanyasensasibahwa
kandungkemihsudahpenuh.
Inkontinensiaurinfungsional:
Memerlukanidentifikasisemuakomponentidakterkendalinya
pengeluaranurinakibatfaktorfaktordiluarsalurankemih.
Penyebabterseringadalahdemensiaberat,masalah
muskuloskeletalberat,faktorlingkunganyangmenyebabkan
kesulitanunutkpergikekamarmandi,danfaktorpsikologis.
Seringkaliinkontinensiaurinpadalansiamunculdengan
berbagaigejaladangambaranurodinamiklebihdarisatutipe
inkontinensiaurin.Penatalaksanaanyangtepatmemerlukan
identifikasisemuakomponen.
EvaluasiInkontinensiaUrin

Tujuanevaluasiawaladalahuntukmemastikanadanya
inkontinensiaurindanmengenalipenyebabpenyebabyang
bersifatsementara,pasienyangperludievaluasilebihlanjut,dan
pasienyangbisamemulaipengobatantanpamemerlukanujiuji
yangcanggih.
RiwayatPenyakit
Riwayatpenyakitharusmenekankanpadagejalayangmuncul
secararinciagardapatditentukantipeinkontinensia,
patofisiologidanfaktorfaktorpemicu.
Lamadankarakteristikinkontinensiaurin
Waktudanjumlahurinpadasaatmengalamiinkontinensiaurin
dansaatkering(kontinen)
Asupancairan,jenis(kopi,cola,teh)danjumlahnya.
Gejalalainsepertinokturia,disuria,frekwensi,hematuriadan
nyeri.
Kejadianyangmenyertaisepertibatuk,operasi,diabetes,obat
obatan.
Perubahanfungsiususbesarataukandungkemih.
PenggunaanPadatauModalitaslainnya.
Pengobataninkontinensiaurinsebelumnyadanhasilnya
Riwayatmedisharusmemperhatikanmasalahmasalahseperti
diabetes,gagaljantung,insufisiensivena,kanker,masalah
neurologis,strokedanpenyakitParkinson.Termasukdi
dalamnyariwayatsistemurogenitalsepertipembedahan
abdominaldanpelvis,melahirkan,atauinfeksisalurankemih.
Evaluasiobatobatanbaikyangdibelidenganresepmaupun
dibelibebasjugapentingdilakukan.Beragamobatdikaitkan
denganinkontinensiaurinsepertihipnotiksedatif,diuretik,
antikolinergik,adrenergikdancalciumchannelblocker.
Biasanyaadahubungandenganwaktuantarapenggunaanobat
obatandenganawitaninkontinensiaurinataumemburuknya
inkontinensiayangsudahkronik.
PemeriksaanFisik
Tujuanpemeriksaanfisikadalahmengenalipemicu
inkontinensiaurindanmembantumenetapkanpatofisiologinya.
Selainpemeriksaanfisikumumyangselaluharusdilakukan,

pemeriksaanterhadapabdomen,genitalia,rectum,fungsi
neurologis,danpelvis(padawanita)sangatdiperlukan.
Pemeriksaanabdomenharusmengenaliadanyakandungkemih
yangpenuh,rasanyeri,massa,atauriwayatpembedahan.
Kondisikulitdanabnormalitasanatomisharusdiidentifikasi
ketikamemeriksagenitalia.Pemeriksaanrectumterutama
dilakukanuntukmedapatkanadanyaobstipasiatauskibala,dan
evaluasitonussfingter,sensasiperineal,danrefleks
bulbokavernosus.Nodulprostatdapatdikenalipadasaat
pemeriksaanrectum.Pemeriksaanpelvismengevaluasiadanya
atrofimukosa,vaginitisatrofi,massa,tonusotot,prolapspelvis,
danadanyasistokelataurektokel.Evaluasineurologissebagian
diperolehsaatpemeriksaanrectumketikapemeriksansensasi
perineum,tonusanus,danreflesbulbokavernosus.Pemeriksaan
neurologisjugaperlumengevaluasipenyakitpenyakityang
dapatdiobatisepertikompresimedulaspinalisdanpenyakit
parkinson.Pemeriksaanfisikseyogyanyajugameliputi
pengkajiantehadapstatusfungsionaldankognitif,
memperhatikanapakahpasienmenyadarikeinginanuntuk
berkemihdanmengunakantoilet.
PemeriksaanPadaInkontinensiaUrin
Tesdiagnostikpadainkontinensiaurin
MenurutOuslander,tesdiagnostikpadainkontinensiaperlu
dilakukanuntukmengidentifikasifaktoryangpotensial
mengakibatkaninkontinensia,mengidentifikasikebutuhanklien
danmenentukantipeinkontinensia.
Mengukursisaurinsetelahberkemih,dilakukandengancara:
Setelahbuangairkecil,pasangkateter,urinyangkeluarmelalui
kateterdiukurataumenggunakanpemeriksaanultrasonikpelvis,
bilasisaurin>100ccberartipengosongankandungkemihtidak
adekuat.
Urinalisis
Dilakukanterhadapspesimenurinyangbersihuntukmendeteksi
adanyafaktoryangberperanterhadapterjadinyainkontinensia
urinsepertihematuri,piouri,bakteriuri,glukosuria,dan
proteinuria.Tesdiagnostiklanjutanperludilanjutkanbila

evaluasiawaldidiagnosisbelumjelas.Teslanjutantersebut
adalah:
Teslaboratoriumtambahansepertikultururin,bloodurea
nitrogen,creatinin,kalsiumglukosasitologi.
Tesurodinamikuntukmengetahuianatomidanfungsisaluran
kemihbagianbawah
Testekananurethramengukurtekanandidalamurethrasaat
istirahatdansaatdianmis.
Imagingtesterhadapsaluranperkemihanbagianatasdan
bawah.
2.Pemeriksaanpenunjang
Ujiurodinamiksederhanadapatdilakukantanpamenggunakan
alatalatmahal.Sisasisaurinpascaberkemihperludiperkirakan
padapemeriksaanfisis.Pengukuranyangspesifikdapat
dilakukandenganultrasoundataukateterisasiurin.
Merembesnyaurinpadasaatdilakukanpenekanandapatjuga
dilakukan.Evaluasitersebutjugaharusdikerjakanketika
kandungkemihpenuhdanadadesakankeinginanuntuk
berkemih.Dimintauntukbatukketikasedangdiperiksadalam
posisilitotomiatauberdiri.Merembesnyaurinseringkalidapat
dilihat.Informasiyangdapatdiperolehantaralainsaatpertama
adakeinginanberkemih,adaatautidakadanyakontraksi
kandungkemihtakterkendali,dankapasitaskandungkemih.
3.Laboratorium
Elektrolit,ureum,creatinin,glukosa,dankalsiumserumdikaji
untukmenentukanfungsiginjaldankondisiyangmenyebabkan
poliuria.
4.Catatanberkemih(voidingrecord)
Catatanberkemihdilakukanuntukmengetahuipolaberkemih.
Catataninidigunakanuntukmencatatwaktudanjumlahurin
saatmengalamiinkontinensiaurindantidakinkontinensiaurin,
dangejalaberkaitandenganinkontinensiaurin.Pencatatanpola
berkemihtersebutdilakukanselama13hari.Catatantersebut
dapatdigunakanuntukmemantauresponterapidanjugadapat
dipakaisebagaiintervensiterapeutikkarenadapatmenyadarkan

pasienfaktorfaktoryangmemicuterjadinyainkontinensiaurin
padadirinya.
Penatalaksanaan
PenatalaksanaaninkontinensiaurinmenurutMulleradalah
mengurangifaktorresiko,mempertahankanhomeostasis,
mengontrolinkontinensiaurin,modifikasilingkungan,
medikasi,latihanototpelvisdanpembedahan.
Daribeberapahaltersebutdiatas,dapatdilakukansebagai
berikut:
1.Pemanfaatankartucatatanberkemih
Yangdicatatpadakartutersebutmisalnyawaktuberkemihdan
jumlahurinyangkeluar,baikyangkeluarsecaranormal,
maupunyangkeluarkarenataktertahan,selainitudicatatpula
waktu,jumlahdanjenisminumanyangdiminum.
2.Terapinonfarmakologi
Dilakukandenganmengoreksipenyebabyangmendasari
timbulnyainkontinensiaurin,sepertihiperplasiaprostat,infeksi
salurankemih,diuretik,guladarahtinggi,danlainlain.Adapun
terapiyangdapatdilakukanadalah:
Melakukanlatihanmenahankemih(memperpanjanginterval
waktuberkemih)denganteknikrelaksasidandistraksisehingga
frekwensiberkemih67x/hari.Lansiadiharapkandapat
menahankeinginanuntukberkemihbilabelumwaktunya.
Lansiadianjurkanuntukberkemihpadaintervalwaktutertentu,
mulamulasetiapjam,selanjutnyadiperpanjangsecarabertahap
sampailansiainginberkemihsetiap23jam.
Membiasakanberkemihpadawaktuwaktuyangtelah
ditentukansesuaidengankebiasaanlansia.
Promtedvoidingdilakukandengancaramengajarilansia
mengenalkondisiberkemihmerekasertadapatmemberitahukan
petugasataupengasuhnyabilainginberkemih.Teknikini
dilakukanpadalansiadengangangguanfungsikognitif
(berpikir).
Melakukanlatihanototdasarpangguldenganmengkontraksikan
ototdasarpanggulsecaraberulangulang.Adapuncaracara
mengkontraksikanototdasarpanggultersebutadalahdengan

cara:
Berdiridilantaidengankeduakakidiletakkandalamkeadaan
terbuka,kemudianpingguldigoyangkankekanandankekiri
10kali,kedepankebelakang10kali,danberputarsearahdan
berlawanandenganjarumjam10kali.
Gerakanseolaholahmemotongfesespadasaatkitabuangair
besardilakukan10kali.
Halinidilakukanagarototdasarpanggulmenjadilebihkuatdan
urethradapattertutupdenganbaik.
3.Terapifarmakologi
Obatobatyangdapatdiberikanpadainkontinensiaurgenadalah
antikolinergiksepertiOxybutinin,Propantteine,Dicylomine,
flavoxate,Imipramine.
Padainkontinensiastressdiberikanalfaadrenergicagonis,yaitu
pseudoephedrineuntukmeningkatkanretensiurethra.
Padasfingterrelaxdiberikankolinergikagonisseperti
Bethanecholataualfakolinergikantagonissepertiprazosinuntuk
stimulasikontraksi,danterapidiberikansecarasingkat.
4.Terapipembedahan
Terapiinidapatdipertimbangkanpadainkontinensiatipestress
danurgensi,bilaterapinonfarmakologisdanfarmakologistidak
berhasil.Inkontinensiatipeoverflowumumnyamemerlukan
tindakanpembedahanuntukmenghilangkanretensiurin.Terapi
inidilakukanterhadaptumor,batu,divertikulum,hiperplasia
prostat,danprolapspelvic(padawanita).
5.Modalitaslain
Sambilmelakukanterapidanmengobatimasalahmedikyang
menyebabkaninkontinensiaurin,dapatpuladigunakan
beberapaalatbantubagilansiayangmengalamiinkontinensia
urin,diantaranyaadalahpampers,kateter,danalatbantutoilet
sepertiurinal,komoddanbedpan.
Pampers
Dapatdigunakanpadakondisiakutmaupunpadakondisi
dimanapengobatansudahtidakberhasilmengatasi
inkontinensiaurin.
Namunpemasanganpampersjugadapatmenimbulkanmasalah

sepertilukalecetbilajumlahairsenimelebihidayatampung
pamperssehinggaairsenikeluardanakibatnyakulitmenjadi
lembab,selainitudapatmenyebabkankemerahanpadakulit,
gatal,danalergi.
Kateter
Katetermenetaptidakdianjurkanuntukdigunakansecararutin
karenadapatmenyebabkaninfeksisalurankemih,danjuga
terjadipembentukanbatu.Selainkatetermenetap,terdapat
katetersementarayangmerupakanalatyangsecararutin
digunakanuntukmengosongkankandungkemih.Teknikini
digunakanpadapasienyangtidakdapatmengosongkan
kandungkemih.Namunteknikinijugaberesikomenimbulkan
infeksipadasalurankemih.
Alatbantutoilet
Sepertiurinal,komoddanbedpanyangdigunakanolehorang
usialanjutyangtidakmampubergerakdanmenjalanitirah
baring.Alatbantutersebutakanmenolonglansiaterhindardari
jatuhsertamembantumemberikankemandirianpadalansia
dalammenggunakantoilet.

Batasaninkontinensiaadalahpengeluaranurin(ataufeses)tanpa
disadari, dalam jumlah dan frekuensi yang cukup sehingga

mengakibatkanmasalahgangguankesehatanatausosial(Kane
dkk.,1989dalamPranarka,2000).
InkontinensiaUrin
Inkontinensia urin didefinisikan sebagai keluarnya urin yang
tidak terkendali pada waktu yang tidak dikehendaki tanpa
memperhatikanfrekuensidanjumlahnya,yangmengakibatkan
masalah sosial dan higienis penderitanya (Setiati dan
Pramantara,2007).
Fisiologidanpatofisiologidiuresis
Proses berkemih berlangsung dibawah control dan
koordinasi sistem saraf pusat (SSP) dan sistem saraf tepi di
daerah sakrum. Sensasi pertama ingin berkemih timbul saat
volume kandung kemih atau vesica urinaria (VU) mencapai
antara150350ml.KapasitasVUnormalbervariasisekitar300
600ml(Pranarka,2000).Bilaprosesberkemihterjadi,otototot
detrusor VU berkontraksi, diikuti relaksasi dari sfingter dan
uretra.Tekanandariototdetrusormeningkatmelebihitahanan
dari muara uretra dan urin akan memancar keluar (Van der
Cammen dkk, Reuben dkk dalam Pranarka, 2000). Sfingter
uretraeksternaldanototdasarpanggulberadadibawahcontrol
volunter dan disuplai oleh saraf pudendal, sedangkan otot
detrusorkandungkemihdansfingteruretrainternalberadadi

bawahkontrolsistemsarafotonom,yangmungkindimodulasi
olehkorteksotak(SetiatidanPramantara,2007).
Proses berkemih diatur oleh pusat refleks kemih di
daerah sakrum. Jaras aferen lewat persarafan somatik dan
otonommembawainformasitentangisiVUkemedullaspinalis
sesuaipengisianVU(Pranarka,2000).KetikaVUmulaiterisi
urin,rangsangsarafditeruskanmelaluisarafpelvisdanmedulla
spinalis ke pusat saraf kortikal dan subkortikal. Pusat
subkortikal(padagangliabasaldancerebellum)menyebabkan
VU relaksasi sehingga dapat mengisi tanpa menyebabkan
seseorangmengalamidesakanuntukberkemih.Ketikapengisian
VU berlanjut, rasa penggembungan VU disadari, dan pusat
kortikal(padalobusfrontalis)bekerjamenghambatpengeluaran
urin.Gangguanpadapusatkortikaldansubkortikalkarenaobat
atau penyakit dapat mengurangi kemampuan menunda
pengeluaranurin(SetiatidanPramantara,2007).
Ketika terjadi desakan berkemih, rangsang dari
korteksdisalurkanmelaluimedullaspinalisdansarafpelviske
otot detrusor. Aksi kolinergik dari saraf pelvis kemudian
menyebabkanototdetrusorberkontraksi.Kontraksiototdetrusor
tidak hanya tergantung pada inervasi kolinergik, namun juga
mengandungreseptorprostaglandin.Karenaitu,prostaglandin
inhibiting drugs dapat mengganggu kontraksi detrusor.

Kontraksi VU juga calciumchannel dependent, karena itu


calciumchannel blockers dapat mengganggu kontraksi VU.
Interferensi aktivitas kolinergik saraf pelvis menyebabkan
pengurangankontraktilitasotot(SetiatidanPramantara,2007).
Aktivitasadrenergikalfamenyebabkansfingteruretra
berkontraksi.Karenaitu,pengobatandenganagonisadrenergik
alfa (pseudoefedrin) dapat memperkuat kontraksi sfingter,
sedangkan zat alphablocking dapat mengganggu penutupan
sfingter. Inervasi adrenergikbeta merelaksasi sfingter uretra.
Karena itu zat betaadrenergic blocking (propanolol) dapat
mengganggu dengan menyebabkan relaksasi uretra dan
melepaskan aktifitas kontraktil adrenergicalpha (Setiati dan
Pramantara,2007).
Mekanisme sfingter berkemih memerlukan angulasi
yangtepatantarauretradanVU.Fungsisfingteruretranormal
juga tergantung pada posisi yang tepat dari uretra sehingga
dapat meningkatkan tekanan intraabdomen secara efektif
ditransmisikankeuretra.Bilauretradiposisiyangtepat,urin
tidak akan pada saat terdapat tekanan atau batuk yang
meningkatkantekananintraabdomen(SetiatidanPramantara,
2007).
Mekanisme dasar proses berkemih diatur oleh
berbagai refleks pada pusat berkemih. Pada fase pengisian,

terjadi peningkatan aktivitas saraf otonom simpatis yang


mengakibatkanpenutupanleherVU,relaksasidindingVU,serta
penghambatan aktivitas parasimpatis dan mempertahankan
inervasi somatik pada otot dasar panggul. Pada fase
pengosongan, aktivitas simpatis dan somatik menurun,
sedangkan parasimpatis meningkat sehingga terjadi kontraksi
otot detrusor dan pembukaan leher VU. Proses refleks ini
dipengaruhi oleh sistem saraf yang lebih tinggi yaitu batang
otak, korteks serebri dan serebelum. Peranan korteks serebri
adalah menghambat, sedangkan batak otak dan supra spinal
memfalisitasi(SetiatidanPramantara,2007).
Prosesmenuadaninkontinensiaurin
Usialanjutbukansebagaipenyebabinkontinensiaurin,namun
prevalensi inkontinensia urin meningkat seiring dengan
peningkatan usia karena semakin banyak munculnya faktor
risiko(SetiatidanPramantara,2007).Faktorfaktorrisikoyang
mendukung terjadinya inkontinensia terkait dengan
pertambahanusiaadalah(Pranarka,2000):
Mobilitassistemyanglebihterbataskarenamenurunnya
pancaindera,kemunduransistemlokomosi.
Kondisikondisimedikyangpatologikdanberhubungan
denganpengaturanurinmisalnyadiabetesmellitus,gagal
jantungkongestif.
Etiologiinkontinensiaurin

Penyebab inkontinensia urin dibedakan menjadi (Pranarka,


2000):
1. Kelainanurologik;misalnyaradang,batu,tumor,
divertikel.
2. Kelainanneurologik;misalnyastroke,traumapada
medullaspinalis,demensiadanlainlain.
3. Lainlain;misalnyahambatanmotilitas,situasitempat
berkemihyangtidakmemadai/jauh,dansebagainya.
Menurutonsetnya,inkontinensiadibagimenjadi(Kane,Reuben
dalamPranarka,2000):
1. Inkontinensiaakut,biasanyareversibel,terkaitdengan
sakityangsedangdideritaataumasalahobatobatanyang
digunakan(iatrogenik).Inkontinensiaakanmembaikbila
penyakitakutyangdideritasembuhataujikaobatobatan
dihentikan.
2. Inkontinensiapersisten/kronik/menetap,tidakterkait
penyakitakutatauobatobatan.Inkontinensiaini
berlangsunglama.
Inkontinensiaurinakut
PenyebabinkontinensiaakutdisingkatdenganakronimDRIP,
yangmerupakankependekandari(Kanedkk.dalamPranarka,
2000):
D:Delirium
R:Retriksi,mobilitas,retensi
I:Infeksi,inflamasi,impaksifeses
P:Pharmacy(obatobatan),poliuri

Golonganobatyangmenjadipenyebabinkontinensiaurinakut
termasuk diantaranya adalah obatobatan hipnotiksedatif,
diuretik,antikolinergik,agonisdanantagonisalfaadrenergik,
dancalciumchannelblockers.Inkontinensiaurinakutterutama
pada lakilaki sering berkaitan dengan retensi urin akibat
hipertrofi prostat. Skibala dapat mengakibatkan obstruksi
mekanikpadabagiandistalVU,yangselanjutnyamenstimulasi
kontraksi otot detrusor involunter (Setiati dan Pramantara,
2007).
Inkontinensiaurinpersisten
Inkontinensiapersistendibagimenjadibeberapatipe,masing
masing dapat terjadi pada satu penderita secara bersamaan.
Inkontinensiapersistendibagimenjadi4tipe,yaitu(Pranarka,
2000):
1.

Tipestress

Keluarnya urin diluar pengaturan berkemih, biasanya dalam


jumlahsedikit,akibatpeningkatantekananintraabdominal.Hal
initerjadikarenaterdapatkelemahanjaringansekitarmuaraVU
dan uretra. Sering pada wanita, jarang pada pria karena
predisposisihilangnyapengaruhestrogendanseringmelahirkan
disertaitindakanpembedahan.
2.

Tipeurgensi

Pengeluaran urin diluar pengaturan berkemih yang normal,


biasanya jumlah banyak, tidak mampu menunda berkemih

begitu sensasi penuhnya VU diterima oleh pusat berkemih.


Terdapat gangguan pengaturan rangsang dan instabilitas dari
otot detrusor VU. Inkontinensia tipe ini didapatkan pada
gangguanSSPmisalnyastroke,demensia,sindromParkinson,
dankerusakanmedullaspinalis.
3.

Tipeluapan(overflow)

Ditandai dengan kebocoran/keluarnya urin, biasanya jumlah


sedikit,karenadesakanmekanikakibatVUyangsudahsangat
teregang.Penyebabumuminkontinensiatipeiniantaralain:

Sumbatanakibathipertrofiprostat,atauadanyacystoceledan
penyempitanjalankeluarurin.

Gangguan kontraksi VU akibat gangguan persarafan


misalnyapadadiabetesmellitus.

4.

Tipefungsional

Keluarnya urin secara dini, akibat ketidakmampuan mencapai


tempatberkemihkarenagangguanfisikataukognitifmaupun
bermacamhambatansituasi/lingkunganyanglain,sebelumsiap
untukberkemih.Faktorpsikologiksepertimarah,depresijuga
dapatmenyebabkaninkontinensiatipeini.
Terapi
Pengelolaan inkontinensia pada penderita lanjut usia, secara
garisbesardapatdikerjakansebagaiberikut:
a.

Programrehabilitasiantaralain
MelatihresponsVUagarbaiklagi

Melatihperilakuberkemih

Latihanototototdasarpanggul

Modifikasitempatuntukberkemih(urinal,komodo)

b.

Kateterisasi, baik secara berkala (intermitten) atau

menetap(indwelling)
c.
d.

Obatobatan,antaralainuntukrelaksasiVU,estrogen
Pembedahan, misalnya untuk mengangkat penyebab

sumbatan atau keadaan patologik lain, pembuatan sfingter


artefisiildanlainlain
e.

Lainlain, misalnya penyesuaian lingkungan yang

mendukung untuk kemudahan berkemih, penggunaan pakaian


dalam dan bahanbahan penyerap khusus untuk mengurangi
dampakinkontinensia.
InkontinensiaAlvi
Pengaturandefekasinormal
Defekasi merupakan proses fisiologis yang melibatkan
(Pranarka,2000):

KoordinasiSSPdanperifersertasistemrefleks
Kontraksi yang baik dari otototot polos dan seran

lintangyangterlibat

Kesadaran dan kemampuan untuk mencapai tempat

buangairbesar

Halpentinguntukmekanismepengaturanbuangairbesar,yang
bertugas mempertahankan penutupan yang baik dari saluran
anus,yaitu(Brocklehurst,1987dalamPranarka,2000):
a.

Sudutanorektal,yangdipertahankanpadaposisipaling

ideal,dibawah100olehposisiototototpuborektal.
b.

Sfingteranuseksternayangmelindungiterutamaterhadap

kenaikan mendadak dari tekanan intra abdominal, misalnya


batuk,bersin,olahraga,dansebagainya.
c.

Bentukanussendiriyangseakanmenguncupberbentuk

katup,denganototototsertalipatamlipatanmukosayangsaling
mendukung.
Gambaranklinis
Klinisinkontinensiaalvitampakdalamduakeadaan(Pranarka,
2000):
1.

Feses yang cair atau belum berbentuk, sering bahkan

selalukeluarmerembes.
2.

Keluarnyafesesyangsudahberbentuk,sekaliataudua

kaliperhari,dipakaianatauditempattidur.
Perbedaandaripenampilankliniskeduamacaminkontinensia
alviinidapatmengarahkanpadapenyebabyangberbedadan
merupakanpetunjukuntukdiagnosis.
Jenisjenisinkontinensiaalvidanpengelolaannya
Berdasarkan etiologinya, inkontinensia alvi dapat dibagi
menjadi4kelompok(Pranarka,2000):

1.

Inkontinensiaalviakibatkonstipasi
Konstipasi bila berlangsung lama menyebabkan

sumbatan/impaksidarimassafesesyangkeras(skibala).Skibala
akan menyumbat lubang bawah anus dan menyebabkan
perubahan besar sudut anorektal. Kemampuan sensor
menumpul,tidakdapatmembedakanantaraflatus,cairanatau
feses.Akibatnyafesesyangcairakanmerembeskeluar.Skibala
juga mengiritasi mukosa rectum, kemudian terjadi produksi
cairandanmukus,yangkeluarmelaluiselaseladarifesesyang
impaksi,yangmenyebabkaninkontinensiaalvi.
Langkah pertama penatalaksanaan adalah pemberian diit
tinggi serat dengan cairan yang cukup dan meningkatkan
aktivitas/mobilitas. Saat yang teratur untuk buang air besar
denganmenyesuaikandenganrefleksgasterkolonyangtimbul
beberapa menit setelah selesai makan harus dimanfaatkan,
denganmengatur posisibuangair besarpadawaktutersebut.
Tempat buang air besar yang tenang dan pribadi juga akan
mendukung.
2.

Inkontinensiaalvisimtomatik
Dapatmerupakanpenampilanklinisdariberbagaikelainan

patologikyangdapatmenyebabkandiare.Beberapapenyebab
diare yang mengakibatkan inkontinensia alvi simtomatik ini
antara lain gastroenteritis, diverticulitis, proktitis, kolitis
iskemik, kolitis ulseratif, karsinoma kolon/rectum. Penyebab

lainmisalnyakelainanmetabolik,contohnyadiabetesmellitus,
kelainanendokrin,sepertitirotoksikosis,kerusakansfingteranus
sebagaikomplikasioperasihaemorrhoidyangkurangberhasil,
danprolapsisrekti.
Pengobatan inkontinensia alvi simtomatik adalah
terhadap kelainan penyebabnya, dan bila tidak dapat diobati
dengancaratersebut,makadiusahakanterkontroldenganobat
obatanyangmenyebabkankonstipasi.
3.

Inkontinensiaalvineurogenik
Terjadiakibatgangguanfungsimenghambatdarikorteks

serebri saat terjadi regangan/distensi rectum. Distensi rectum,


akan diikuti relaksasi sfingter interna. Pada orang dewasa
normal,tidakterjadikontraksiintrinsikdarirectumkarenaada
hambatan/inhibisidaripusatdikorteksserebri.Bilabuangair
besartidakmemungkinkan,halinitetapditundadenganinhibisi
yang disadari terhadap kontraksi rectum dan sfingter
eksternanya.Padalanjutusia,kemampuanuntukmenghambat
prosesdefekasiinidapatterganggubahkanhilang.
Karakteristiktipeinitampakpadapenderitadenganinfark
serebrimultiple,ataupenderitademensia.Gambaranklinisnya
ditemukansatuduapotongfesesyangsudahterbentukditempat
tidur,danbiasanyasetelahminumpanasataumakan.
Pengelolaan inkontinensia alvi neurogenik, dengan
menyiapkan penderita pada suatu komodo (commode), duduk

santai dengan ditutup kain sebatas lutut, kemudian diberi


minumanhangat,relaks,dandijagaketenangannyasampaifeses
keluar.
4.

Inkontinensiaalviakibathilangnyarefleksanal
Terjadiakibathilangnyarefleksanal,disertaikelemahan

ototototseranlintang.Padatipeini,terjadipenguranganunit
unityangberfungsimotorikpadaototototdaerahhsfingterdan
puborektal.Keadaaninimenyebabkanhilangnyarefleksanal,
berkurangnya sensasi pada anus disertai menurunnya tonus
anus. Hal ini berakibat inkontinensia alvi pada peningkatan
tekanan intraabdomen dan prolaps dari rectum. Pengelolaan
tipe ini sebaiknya diserahkan pada ahli proktologi untuk
pengobatannya.

Betapa sulitnya mengendalikan dan mengontrol


keluarnya urin sehingga menimbulkan gangguan
higiene dan sosial, memang banyak dikeluhkan
para lansia. Tak heran, menurut Dr Siti Setiati SpPD
dari Subbagian Geriatri Bagian Ilmu Penyakit
Dalam FKUI/RSUPNCM, inkontinensia urin atau
biasa disebut mengompol agaknya akan menjadi
masalah besar di masa datang, seiring dengan
makin banyaknya jumlah orang lansia di Indonesia.
Data di luar negeri menunjukkan, 15 persen
hingga 30 persen lansia yang tinggal di
masyarakat dan 50 persen lansia yang dirawat,
menderita inkontinensia urin. Sedangkan pada
1999, dari semua pasien geriatri yang dirawat di
ruang rawat geriatri penyakit dalam RSCM
didapatkan angka kejadian inkontinensia urin
sebesar 10 persen, tutur Dr Siti Setiati pada
Simposium Diagnosis dan penatalaksanaan
Mutakhir Inkontinensia Urin, Sabtu (19/8), di
Jakarta.
Tragisnya, pasien inkontinensia urin seringkali
mengalami masalah sosial, psikologis, fisik, dan
seksual meliputi depresi, gangguan tidur,
berkurangnya interaksi sosial, pekerjaan, dan
aktivitas fisik. Selain itu, tambah Dr Siti,
inkontinensia urin secara tidak langsung juga
menyebabkan dekubitus, infeksi saluran kemih
berulang, jatuh, dan tidak kalah pentingnya adalah
biaya perawatan yang tinggi.
Dapat Dikurangi dan Dikontrol

Inkontinensia urin dapat terjadi karena penyebab


akut dan penyebab kronik. Penyebab akut biasanya
dapat diatasi sehingga inkontinensia urin dapat
dihilangkan, namun penyebab kronik tidak dapat
dihilangkan seratus persen, tetapi dapat dikurangi
dan dikontrol dengan beberapa modalitas
nonfarmakologis dan terapi farmakologis.
Menurut Dr Siti, inkontinensia urin akut disebabkan
oleh delirium (kesadaran turun atau terganggu),
restricted mobility (gangguan bergerak akibat
penyakit atau hendaya), infeksi pada saluran
kemih, dan pharmaceutical (obat-obatan seperti
diuretik, antidepresan). Sedangkan inkontinensia
urin kronik antara lain disebabkan oleh kelemahan
otot dasar panggul atau instabilitas otot kandung
kemih yang juga sudah berat. Selain itu, adanya
gangguan neurologis seperti stroke, penyakit
Parkinson, dan demensia.
Sayangnya, banyak penderita inkontinensia urin
tidak berobat atau mencari pertolongan. Dr Siti
mengungkapkan, rasa malu atau pemahaman
yang keliru mungkin sebagai penyebabnya. Sering
pula, masalah ini dianggap sesuatu yang lumrah
terjadi pada lansia sehingga tidak mendapat
perhatian dan penanganan yang baik.
Padahal, inkontinensia urin tentu saja bukan
bagian dari proses menua yang dapat dimaklumi.
Selalu ada masalah bio-psiko-sosial yang
mendasarinya dan ada jalan keluar yang dapat
diupayakan untuk mengatasinya, tegas Dr Siti.
Lalu, bagaimana mengatasi masalah ini? Menurut
Dr Siti, pengelolaan inkontinensia urin terdiri atas

intervensi perilaku, terapi farmakologis, dan


pembedahan. Aturan yang disepakati adalah
menentukan pilihan yang paling tidak invasif dan
tidak berbahaya untuk penderita. Bila diperlukan,
dapat dilakukan pemeriksaan canggih seperti
urodynamic study.

Inkontinensia urine adalah keluarnya urine tanpa disadari, tidak


bisa ditahan yang menimbulkan masalah kesehatan, sosial,
higine dan ekonomi, biasanya orang Jawa menyebutnya dengan
istilah Beser. Inkontinensia urine merupakan masalah
kesehatan yang sering terjadi pada laki-laki maupun perempuan,
baik anak-anak, dewasa, maupun orang tua.( 17,22,28) Pada wanita
lebih banyak dibandingkan laki-laki, terutama pada wanita yang
sudah tua, banyak anak, pernah mengalami operasi di daerah
panggul, yang menderita penyakit kencing manis atau penyakit

saraf. Inkontinensia urine jarang dikeluhkan oleh pasien atau


keluarga karena dianggap sesuatu yang biasa, malu atau tabu
untuk diceritakan pada orang lain maupun pada dokter, dianggap
sesuatu yang wajar tidak perlu diobati. Inkontinensia Urine
bukan penyakit, tetapi merupakan gejala yang menimbulkan
gangguan kesehatan, sosial, psikologi serta dapat menurunkan
kualitas hidup. Dampak negatif dari Inkontinensia Urine adalah
dijahui orang lain karena berbau pesing, minder, tidak percaya
diri, timbul infeksi didaerah kemaluan, pemborosan uang untuk
pemeliharaan kesehatan, tidak bisa beraktifitas dengan baik
sehingga pendapatan menurun, tidak nyaman dalam hubungan
seksual akhirnya dapat menurunkan kualitas hidupnya. Banyak
pasien Inkontinensia Urine yang datang terlambat ke dokter
sehingga pada umumnya sudah dalam kondisi yang
memprihatinkan, perlu penanganan yang baik dari multidisiplin
untuk meningkatkan kualitas hidup. Terdapat banyak penyebab
dan jenis terjadinya Inkontinensia Urine. Oleh karena itu, dokter
dari multidisiplin ilmu perlu mengetahui penyebab dan jenis
Inkontinensia Urine tersebut supaya dapat melakukan
penatalaksanaan dan tindakan yang benar.
Prevalensi Inkontinensia urine pada wanita di dunia berkisar
antara 10 - 58%, sedang di Eropa dan Amerika berkisar antara
29,4%. Menurut APCAB (Asia Pacific Continence Advisor
Board) tahun 1998 menetapkan prevalensi Inkontinensia Urine
14,6% pada Wanita Asia, sedangkan Wanita Indonesia 5,8%
(gambar 1). Prevalensi pada Pria Asia berdasar survei dari
APCAB (Asia Pacific Continence Advisor Board) sekitar 6,8%,
sedangkan untuk Pria Indonesia 5% (gambar 2). Secara umum,
prevalensi Inkontinensia Urine pada pria hanya separuh dari
wanita, prevalensi di Asia relative rendah karena pandangan
orang Asia bahwa Inkontinensia Urine merupakan hal yang
memalukan, dianggap tabu oleh beberapa orang, sehingga tidak
dikeluhkan pada dokter. Prevalensi Inkontinensia Urine pada
wanita manula 35-45%. Survei Inkontinensia Urine yang
dilakukan oleh Departemen Urologi FK Unair-RSU Dr.
Soetomo tahun 2008 terhadap 793 penderita, prevalensi
Inkontinensia Urine pada Pria 3,02% sedangkan pada Wanita

6,79%. Di sini menunjukkan bahwa prevalensi Inkontinensia


Urine pada wanita lebih tinggi daripada pria.(7) Sedangkan
prevalensi Inkontinensia Urine berdasarkan usia, menunjukkan
bahwa usia 5-12 tahun = 0,13%, sedangkan pada usia 70-80
tahun = 1,64%, artinya bahwa prevalensi inkontinensia urine
cenderung meningkat seiring meningkatnya usia, dapat dilihat
pada gambar 3. Gambar 3. Prevalensi Inkontinensia Urine
berdasar Interval UsiaSedang survei yang dilakukan Divisi
Geriatri Bagian Penyakit Dalam RSUP
Dr.
Ciptomangunkusumo pada 208 Manula di Lingkungan Pusat
Santunan Keluarga di Jakarta (2002), mendapatkan angka
kejadian Inkontinensia Urine tipe stress sebesar 32,3%,(22,23,24)
sedang survei yang dilakukan di Poliklinik Geriatri RSUP Dr.
Ciptomangunkusumo (2003) terhadap 179 penderita didapatkan
angka kejadian Inkontinensia Urine tipe stress pada laki-laki
sebesar 20,5% dan pada wanita sebesar 32,5%. Untuk di
Departemen Urologi FK Unair-RSU Dr. Soetomo tahun 2008
didapatkan prevalensi Inkontinensia Urine tipe urge pada pria
11,93%, dan pada wanita 25,7%, di sini menunjukkan bahwa
inkontinensia urine type stress dan urge, pada wanita juga lebih
banyak daripada laki-laki. (5,7)Faktor resiko terjadinya
Inkontinensia Urine antara lain: jenis kelamin wanita, usia tua,
paritas tinggi, menopause, pernah dilakukan histerektomi,
menggunakan toilet duduk, gangguan neurologis, trauma pada
pelvis, pernah dilakukan radiasi, difisit nutrisi, obesitas,
perokok, minum alkohol, intake cairan berlebihan atau
kurangnya aktifitas. Pada wanita mempunyai resiko lebih tinggi
untuk terkena Inkontinensia Urine, bila dibandingkan pada pria.
(1,19)
Pada penuaan berkaitan dengan banyak perubahan pada
fisiologis seperti hilangnya kemampuan otot lurik pada daerah
urethra serta berkurangnya kapasitas dalam kandung kemih
yang mengarah terjadinya Inkontinensia Urine. Kehamilan,
melahirkan banyak anak, dan mengejan sewaktu melahirkan
bersama-sama dengan laserasi dan episiotomi pada waktu
melahirkan menyebabkan hipermobilitas urethra, trauma pada
persarafan dan disfungsi dasar panggul. Ini yang
melatarbelakangi hubungan korelasi antara banyaknya

melahirkan anak dengan resiko terjadinya Inkontinensia Urine


pada wanita. (19) Juga perubahan hormonal pada menopause
sangat mempengaruhi kedap air pada lapisan submukosa
urethra, dengan demikian wanita menopause lebih rentan
terhadap Inkontinensia Urine bila dibandingkan wanita sebelum
menopause. Pada obesitas, juga merupakan salah satu faktor
terjadinya Inkontinensia Urine karena beban kerja dasar panggul
pada orang-orang kelebihan berat badan, lebih besar daripada
orang yang kurus. Pada orang orang yang menggunakan toilet
jongkok juga lebih rendah kemungkinan terjadinya
Inkontinensia Urine daripada orang yang menggunakan toilet
duduk. Hal ini mungkin bisa disebabkan karena adanya latihan
pada dasar panggul, sehingga otot dasar panggul menjadi lebih
kuat.(21)Berbagai komplikasi dapat menyertai Inkontinensia
Urine seperti infeksi saluran kencing, infeksi kulit daerah
kemaluan, gangguan tidur, masalah psiko sosial seperti depresi,
mudah marah, dan rasa terisolasi, secara tidak langsung masalah
tersebut dapat menyebabkan dehidrasi, karena umumnya pasien
mengurangi minum, karena kawatir terjadi Inkontinensia Urine,
pada pasien yang kurang aktifitas hanya berbaring di tempat
tidur dapat menyebabkan ulkus dikubitus dan dapat
meningkatkan resiko infeksi lokal termasuk osteomyelitis dan
sepsis. Berbagai cara dapat dilakukan untuk mengatasi masalah
Inkontinensia Urine, berupa medikamentosa, fisioterapi,
maupun pembedahan, jika dapat diketahui dengan tepat jenis
dan penyebab Inkontinensia Urine.

Batasaninkontinensiaadalahpengeluaranurin(ataufeses)tanpa
disadari, dalam jumlah dan frekuensi yang cukup sehingga
mengakibatkanmasalahgangguankesehatanatausosial(Kane
dkk.,1989dalamPranarka,2000).
InkontinensiaUrin
Inkontinensia urin didefinisikan sebagai keluarnya urin yang
tidak terkendali pada waktu yang tidak dikehendaki tanpa
memperhatikanfrekuensidanjumlahnya,yangmengakibatkan
masalah sosial dan higienis penderitanya (Setiati dan
Pramantara,2007).
Fisiologidanpatofisiologidiuresis
Proses berkemih berlangsung dibawah control dan
koordinasi sistem saraf pusat (SSP) dan sistem saraf tepi di

daerah sakrum. Sensasi pertama ingin berkemih timbul saat


volume kandung kemih atau vesica urinaria (VU) mencapai
antara150350ml.KapasitasVUnormalbervariasisekitar300
600ml(Pranarka,2000).Bilaprosesberkemihterjadi,otototot
detrusor VU berkontraksi, diikuti relaksasi dari sfingter dan
uretra.Tekanandariototdetrusormeningkatmelebihitahanan
dari muara uretra dan urin akan memancar keluar (Van der
Cammen dkk, Reuben dkk dalam Pranarka, 2000). Sfingter
uretraeksternaldanototdasarpanggulberadadibawahcontrol
volunter dan disuplai oleh saraf pudendal, sedangkan otot
detrusorkandungkemihdansfingteruretrainternalberadadi
bawahkontrolsistemsarafotonom,yangmungkindimodulasi
olehkorteksotak(SetiatidanPramantara,2007).
Proses berkemih diatur oleh pusat refleks kemih di
daerah sakrum. Jaras aferen lewat persarafan somatik dan
otonommembawainformasitentangisiVUkemedullaspinalis
sesuaipengisianVU(Pranarka,2000).KetikaVUmulaiterisi
urin,rangsangsarafditeruskanmelaluisarafpelvisdanmedulla
spinalis ke pusat saraf kortikal dan subkortikal. Pusat
subkortikal(padagangliabasaldancerebellum)menyebabkan
VU relaksasi sehingga dapat mengisi tanpa menyebabkan
seseorangmengalamidesakanuntukberkemih.Ketikapengisian
VU berlanjut, rasa penggembungan VU disadari, dan pusat
kortikal(padalobusfrontalis)bekerjamenghambatpengeluaran

urin.Gangguanpadapusatkortikaldansubkortikalkarenaobat
atau penyakit dapat mengurangi kemampuan menunda
pengeluaranurin(SetiatidanPramantara,2007).
Ketika terjadi desakan berkemih, rangsang dari
korteksdisalurkanmelaluimedullaspinalisdansarafpelviske
otot detrusor. Aksi kolinergik dari saraf pelvis kemudian
menyebabkanototdetrusorberkontraksi.Kontraksiototdetrusor
tidak hanya tergantung pada inervasi kolinergik, namun juga
mengandungreseptorprostaglandin.Karenaitu,prostaglandin
inhibiting drugs dapat mengganggu kontraksi detrusor.
Kontraksi VU juga calciumchannel dependent, karena itu
calciumchannel blockers dapat mengganggu kontraksi VU.
Interferensi aktivitas kolinergik saraf pelvis menyebabkan
pengurangankontraktilitasotot(SetiatidanPramantara,2007).
Aktivitasadrenergikalfamenyebabkansfingteruretra
berkontraksi.Karenaitu,pengobatandenganagonisadrenergik
alfa (pseudoefedrin) dapat memperkuat kontraksi sfingter,
sedangkan zat alphablocking dapat mengganggu penutupan
sfingter. Inervasi adrenergikbeta merelaksasi sfingter uretra.
Karena itu zat betaadrenergic blocking (propanolol) dapat
mengganggu dengan menyebabkan relaksasi uretra dan
melepaskan aktifitas kontraktil adrenergicalpha (Setiati dan
Pramantara,2007).

Mekanisme sfingter berkemih memerlukan angulasi


yangtepatantarauretradanVU.Fungsisfingteruretranormal
juga tergantung pada posisi yang tepat dari uretra sehingga
dapat meningkatkan tekanan intraabdomen secara efektif
ditransmisikankeuretra.Bilauretradiposisiyangtepat,urin
tidak akan pada saat terdapat tekanan atau batuk yang
meningkatkantekananintraabdomen(SetiatidanPramantara,
2007).
Mekanisme dasar proses berkemih diatur oleh
berbagai refleks pada pusat berkemih. Pada fase pengisian,
terjadi peningkatan aktivitas saraf otonom simpatis yang
mengakibatkanpenutupanleherVU,relaksasidindingVU,serta
penghambatan aktivitas parasimpatis dan mempertahankan
inervasi somatik pada otot dasar panggul. Pada fase
pengosongan, aktivitas simpatis dan somatik menurun,
sedangkan parasimpatis meningkat sehingga terjadi kontraksi
otot detrusor dan pembukaan leher VU. Proses refleks ini
dipengaruhi oleh sistem saraf yang lebih tinggi yaitu batang
otak, korteks serebri dan serebelum. Peranan korteks serebri
adalah menghambat, sedangkan batak otak dan supra spinal
memfalisitasi(SetiatidanPramantara,2007).
Prosesmenuadaninkontinensiaurin

Usialanjutbukansebagaipenyebabinkontinensiaurin,namun
prevalensi inkontinensia urin meningkat seiring dengan
peningkatan usia karena semakin banyak munculnya faktor
risiko(SetiatidanPramantara,2007).Faktorfaktorrisikoyang
mendukung terjadinya inkontinensia terkait dengan
pertambahanusiaadalah(Pranarka,2000):
Mobilitassistemyanglebihterbataskarenamenurunnya
pancaindera,kemunduransistemlokomosi.
Kondisikondisimedikyangpatologikdanberhubungan
denganpengaturanurinmisalnyadiabetesmellitus,gagal
jantungkongestif.
Etiologiinkontinensiaurin
Penyebab inkontinensia urin dibedakan menjadi (Pranarka,
2000):
1. Kelainanurologik;misalnyaradang,batu,tumor,
divertikel.
2. Kelainanneurologik;misalnyastroke,traumapada
medullaspinalis,demensiadanlainlain.
3. Lainlain;misalnyahambatanmotilitas,situasitempat
berkemihyangtidakmemadai/jauh,dansebagainya.
Menurutonsetnya,inkontinensiadibagimenjadi(Kane,Reuben
dalamPranarka,2000):
1. Inkontinensiaakut,biasanyareversibel,terkaitdengan
sakityangsedangdideritaataumasalahobatobatanyang
digunakan(iatrogenik).Inkontinensiaakanmembaikbila
penyakitakutyangdideritasembuhataujikaobatobatan
dihentikan.

2. Inkontinensiapersisten/kronik/menetap,tidakterkait
penyakitakutatauobatobatan.Inkontinensiaini
berlangsunglama.
Inkontinensiaurinakut
PenyebabinkontinensiaakutdisingkatdenganakronimDRIP,
yangmerupakankependekandari(Kanedkk.dalamPranarka,
2000):
D:Delirium
R:Retriksi,mobilitas,retensi
I:Infeksi,inflamasi,impaksifeses
P:Pharmacy(obatobatan),poliuri
Golonganobatyangmenjadipenyebabinkontinensiaurinakut
termasuk diantaranya adalah obatobatan hipnotiksedatif,
diuretik,antikolinergik,agonisdanantagonisalfaadrenergik,
dancalciumchannelblockers.Inkontinensiaurinakutterutama
pada lakilaki sering berkaitan dengan retensi urin akibat
hipertrofi prostat. Skibala dapat mengakibatkan obstruksi
mekanikpadabagiandistalVU,yangselanjutnyamenstimulasi
kontraksi otot detrusor involunter (Setiati dan Pramantara,
2007).
Inkontinensiaurinpersisten
Inkontinensiapersistendibagimenjadibeberapatipe,masing
masing dapat terjadi pada satu penderita secara bersamaan.

Inkontinensiapersistendibagimenjadi4tipe,yaitu(Pranarka,
2000):
1.

Tipestress

Keluarnya urin diluar pengaturan berkemih, biasanya dalam


jumlahsedikit,akibatpeningkatantekananintraabdominal.Hal
initerjadikarenaterdapatkelemahanjaringansekitarmuaraVU
dan uretra. Sering pada wanita, jarang pada pria karena
predisposisihilangnyapengaruhestrogendanseringmelahirkan
disertaitindakanpembedahan.
2.

Tipeurgensi

Pengeluaran urin diluar pengaturan berkemih yang normal,


biasanya jumlah banyak, tidak mampu menunda berkemih
begitu sensasi penuhnya VU diterima oleh pusat berkemih.
Terdapat gangguan pengaturan rangsang dan instabilitas dari
otot detrusor VU. Inkontinensia tipe ini didapatkan pada
gangguanSSPmisalnyastroke,demensia,sindromParkinson,
dankerusakanmedullaspinalis.
3.

Tipeluapan(overflow)

Ditandai dengan kebocoran/keluarnya urin, biasanya jumlah


sedikit,karenadesakanmekanikakibatVUyangsudahsangat
teregang.Penyebabumuminkontinensiatipeiniantaralain:

Sumbatanakibathipertrofiprostat,atauadanyacystoceledan
penyempitanjalankeluarurin.

Gangguan kontraksi VU akibat gangguan persarafan


misalnyapadadiabetesmellitus.

4.

Tipefungsional

Keluarnya urin secara dini, akibat ketidakmampuan mencapai


tempatberkemihkarenagangguanfisikataukognitifmaupun
bermacamhambatansituasi/lingkunganyanglain,sebelumsiap
untukberkemih.Faktorpsikologiksepertimarah,depresijuga
dapatmenyebabkaninkontinensiatipeini.
Terapi
Pengelolaan inkontinensia pada penderita lanjut usia, secara
garisbesardapatdikerjakansebagaiberikut:
a.

Programrehabilitasiantaralain

MelatihresponsVUagarbaiklagi

Melatihperilakuberkemih

Latihanototototdasarpanggul

Modifikasitempatuntukberkemih(urinal,komodo)

b.

Kateterisasi, baik secara berkala (intermitten) atau

menetap(indwelling)
c.
d.

Obatobatan,antaralainuntukrelaksasiVU,estrogen
Pembedahan, misalnya untuk mengangkat penyebab

sumbatan atau keadaan patologik lain, pembuatan sfingter


artefisiildanlainlain
e.

Lainlain, misalnya penyesuaian lingkungan yang

mendukung untuk kemudahan berkemih, penggunaan pakaian

dalam dan bahanbahan penyerap khusus untuk mengurangi


dampakinkontinensia.
InkontinensiaAlvi
Pengaturandefekasinormal
Defekasi merupakan proses fisiologis yang melibatkan
(Pranarka,2000):

KoordinasiSSPdanperifersertasistemrefleks
Kontraksi yang baik dari otototot polos dan seran

lintangyangterlibat

Kesadaran dan kemampuan untuk mencapai tempat

buangairbesar
Halpentinguntukmekanismepengaturanbuangairbesar,yang
bertugas mempertahankan penutupan yang baik dari saluran
anus,yaitu(Brocklehurst,1987dalamPranarka,2000):
a.

Sudutanorektal,yangdipertahankanpadaposisipaling

ideal,dibawah100olehposisiototototpuborektal.
b.

Sfingteranuseksternayangmelindungiterutamaterhadap

kenaikan mendadak dari tekanan intra abdominal, misalnya


batuk,bersin,olahraga,dansebagainya.
c.

Bentukanussendiriyangseakanmenguncupberbentuk

katup,denganototototsertalipatamlipatanmukosayangsaling
mendukung.
Gambaranklinis

Klinisinkontinensiaalvitampakdalamduakeadaan(Pranarka,
2000):
1.

Feses yang cair atau belum berbentuk, sering bahkan

selalukeluarmerembes.
2.

Keluarnyafesesyangsudahberbentuk,sekaliataudua

kaliperhari,dipakaianatauditempattidur.
Perbedaandaripenampilankliniskeduamacaminkontinensia
alviinidapatmengarahkanpadapenyebabyangberbedadan
merupakanpetunjukuntukdiagnosis.
Jenisjenisinkontinensiaalvidanpengelolaannya
Berdasarkan etiologinya, inkontinensia alvi dapat dibagi
menjadi4kelompok(Pranarka,2000):
1.

Inkontinensiaalviakibatkonstipasi
Konstipasi bila berlangsung lama menyebabkan

sumbatan/impaksidarimassafesesyangkeras(skibala).Skibala
akan menyumbat lubang bawah anus dan menyebabkan
perubahan besar sudut anorektal. Kemampuan sensor
menumpul,tidakdapatmembedakanantaraflatus,cairanatau
feses.Akibatnyafesesyangcairakanmerembeskeluar.Skibala
juga mengiritasi mukosa rectum, kemudian terjadi produksi
cairandanmukus,yangkeluarmelaluiselaseladarifesesyang
impaksi,yangmenyebabkaninkontinensiaalvi.
Langkah pertama penatalaksanaan adalah pemberian diit
tinggi serat dengan cairan yang cukup dan meningkatkan

aktivitas/mobilitas. Saat yang teratur untuk buang air besar


denganmenyesuaikandenganrefleksgasterkolonyangtimbul
beberapa menit setelah selesai makan harus dimanfaatkan,
denganmengatur posisibuangair besarpadawaktutersebut.
Tempat buang air besar yang tenang dan pribadi juga akan
mendukung.
2.

Inkontinensiaalvisimtomatik
Dapatmerupakanpenampilanklinisdariberbagaikelainan

patologikyangdapatmenyebabkandiare.Beberapapenyebab
diare yang mengakibatkan inkontinensia alvi simtomatik ini
antara lain gastroenteritis, diverticulitis, proktitis, kolitis
iskemik, kolitis ulseratif, karsinoma kolon/rectum. Penyebab
lainmisalnyakelainanmetabolik,contohnyadiabetesmellitus,
kelainanendokrin,sepertitirotoksikosis,kerusakansfingteranus
sebagaikomplikasioperasihaemorrhoidyangkurangberhasil,
danprolapsisrekti.
Pengobatan inkontinensia alvi simtomatik adalah
terhadap kelainan penyebabnya, dan bila tidak dapat diobati
dengancaratersebut,makadiusahakanterkontroldenganobat
obatanyangmenyebabkankonstipasi.
3.

Inkontinensiaalvineurogenik
Terjadiakibatgangguanfungsimenghambatdarikorteks

serebri saat terjadi regangan/distensi rectum. Distensi rectum,


akan diikuti relaksasi sfingter interna. Pada orang dewasa

normal,tidakterjadikontraksiintrinsikdarirectumkarenaada
hambatan/inhibisidaripusatdikorteksserebri.Bilabuangair
besartidakmemungkinkan,halinitetapditundadenganinhibisi
yang disadari terhadap kontraksi rectum dan sfingter
eksternanya.Padalanjutusia,kemampuanuntukmenghambat
prosesdefekasiinidapatterganggubahkanhilang.
Karakteristiktipeinitampakpadapenderitadenganinfark
serebrimultiple,ataupenderitademensia.Gambaranklinisnya
ditemukansatuduapotongfesesyangsudahterbentukditempat
tidur,danbiasanyasetelahminumpanasataumakan.
Pengelolaan inkontinensia alvi neurogenik, dengan
menyiapkan penderita pada suatu komodo (commode), duduk
santai dengan ditutup kain sebatas lutut, kemudian diberi
minumanhangat,relaks,dandijagaketenangannyasampaifeses
keluar.
4.

Inkontinensiaalviakibathilangnyarefleksanal
Terjadiakibathilangnyarefleksanal,disertaikelemahan

ototototseranlintang.Padatipeini,terjadipenguranganunit
unityangberfungsimotorikpadaototototdaerahhsfingterdan
puborektal.Keadaaninimenyebabkanhilangnyarefleksanal,
berkurangnya sensasi pada anus disertai menurunnya tonus
anus. Hal ini berakibat inkontinensia alvi pada peningkatan
tekanan intraabdomen dan prolaps dari rectum. Pengelolaan

tipe ini sebaiknya diserahkan pada ahli proktologi untuk


pengobatannya.

DeteksiPenyebabdanTatalaksanaInkontinensiaUrin
Inkontinensia Urin kerap dianggap hal normal dalam
penuaan dan tidak bisa diatasi. Padahal, ada penanganan
yang tepat hingga pasien dapat hidup lebih nyaman dan
meminimalkan
biaya
perawatan
kesehatan
Jumat, 25 Mei lalu, bukan tanpa sebab jika Aburizal

Bakrie terlihat dalam keramaian acara Temu Ilmiah


Geriatri 2007 di Hotel Borobudur. Bidang yang
mengurusi orang-orang tua ini, sangat berkaitan dengan
kapasitasnya sebagai Menteri Koordinator Bidang
Kesejahteraan Rakyat. Sebagai bagian dari masyarakat
bangsa ini, lansia perlu mendapat perhatian. Kelompok
usia yang tidak lagi produktif ini, jumlahnya akan
semakin bertambah seiring meningkatnya usia harapan
hidup. Padahal, Meningkatnya jumlah penduduk yang
kurang atau tidak produktif, akan meningkat rasio
ketergantungan, ujar menteri yang akrab dipanggil Ical
ini dalam sambutannya. Kebutuhan pemeliharaan
kesehatan bagi lansia menjadi tantangan tersendiri.
Meski proses menua dianggap sebuah kewajaran,
namun ada konsekuensi penurunan fungsi tubuh pada
lansia. Orang tua, akan mengalami perubahan baik fisik,
kognitif, sosial, dan psikologis akibat regenerasi sel
yang menurun, atau tingkat hormon yang berkurang.
Perubahan segala sisi itu akan menyebabkan
ketergantungan lansia pada keluarga atau orang
terdekat mereka. Pemeliharaan kesehatan, seperti yang
dikatakan Ical, adalah salah satu upaya untuk
meminimalkan ketergantungan lansia pada orang
sekitarnya.
Seperti kembali ke masa kanak-kanak, lansia kerap
mengalami keluhan mengompol atau inkontenensia urin
(IU). Prevalensinya, menurut data RSCM, terdapat pada
hampir 60 persen pasien di panti rawat usia lanjut, 2530 persen pasien yang baru pulang dari perawatan
penyakit akut. Hasil survey Poliklinik Geriatri tahun
2006 menempatkan perempuan menduduki porsi lebih

besar, yaitu 55,6 persen dam laki-laki 44,4 persen.


IU yang kedengarannya sepele, dapat berdampak serius
bagi lansia tersebut maupun orang sekitarnya.
Lingkungan menjadi kotor, berbau, meningkatkan risiko
jatuh, dan lain sebagainya. Secara langsung maupun
tidak langsung dapat menimbulkan masalah medis,
psikologis, sosial, dan ekonomi, ujar Dr. Edy Rizal
Wahyudi, SpPD. Karena itu, IU harus dapat dideteksi
dan disembuhkan. Jika tidak, IU selalu dapat ditangani
hingga tetap membuat pasien nyaman, memudahkan
pramurawat, dan meminimalkan biaya, ujar Edy lagi.
IU

Akut
Penanganan IU akut pada usia lanjut berbeda
tergantung kondisi yang dialami pasien. Penyebab IU
akut antara lain terkait dengan gangguan di saluran
kemih bagian bawah, efek obat-obatan, produksi urin
meningkat atau adanya gangguan kemampuan/keinginan
ke
toilet.
Gangguan saluran kemih bagian bawah bisa karena
infeksi. Jika terjadi infeksi saluran kemih, maka
tatalaksananya adalah terapi antibiotika, ujar Edy.
Apabila vaginistis atau uretritis atrofi penyebabnya,
maka dilakukan tertapi estrogen topical. Terapi perilaku
harus
dilakukan
jika
pasien
baru
menjalani
prostatektomi. Pembedahan harus dihindari sampai
dipastikan kondisi tersebut tidak akan membaik. Dan,
bila terjadi impaksi feses, maka harus dihilangkan
misalnya dengan makanan kaya serat, mobilitas, asupan
cairan yang adekuat, atau jika perlu penggunaan
laksatif.

IU akut juga bisa terjadi karena produksi urin


berlebih karena berbagai sebab. Misalnya gangguan
metabolik, seperti diabetes melitus, yang harus terus
dipantau. Sebab lain adalah asupan cairan yang
berlebihan yang bisa diatasi dengan mengurangi asupan
cairan yang bersifat diuretika seperti kafein. Gagal
jantung kongestif juga bisa menjadi faktor penyebab
produksi urin meningkat dan harus dilakukan terapi
medis
yang
sesuai.
Gangguan kemampuan ke toilet bisa disebabkan oleh
penyakit kronik, trauma, atau gangguan mobilitas. Untuk
mengatasinya penderita harus diupayakan ke toilet
secara teratur atau menggunakan substitusi toilet.
Apabila penyebabnya adalah masalah psikologis, maka
hal
itu
harus
disingkirkan
dengan
terapi
nonfarmakologik atau farmakologik yang tepat.
Pasien lansia, kerap mengonsumsi obat-obatan
tertentu karena penyakit yang dideritanya. Nah, obatobatan ini bisa sebagai biang keladi mengompol pada
orang-orang tua. Jika kondisi ini yang terjadi, maka
Hentikan atau ganti obat jika memungkinkan, turunkan
dosis atau modifikasi jadwal pemberian obat, kata Edy.
Ia lebih lanjut memaparkan golongan obat yang
berkontribusi pada IU, yaitu diuretika, antikolinergik,
analgesik, narkotik, antagonis adrenergic alfa, agonic
adrenergic alfa, ACE inhibitor, dan kalsium antagonik.
Golongan psikotropika seperti antidepresi, antipsikotik,
dan sedatif hipnotik juga memiliki andil dalam IU.
Kafein dan alcohol juga berperan dalam terjadinya
mengompol.

IU
Persisten
Mengompol juga ada yang bersifat menetap dan tidak
terkait dengan penyakit akut, disebut IU persisten.
stress, urgensi, overflow, dan gangguan fungsional
adalah faktor penyebabnya. Tipe stress didefinisikan
sebagai keluarnya urin involunter tatkala terdapat
peningkatan tekanan intraabdomen, seperti batuk,
tertawa, olahraga, dan lain-lain. Sedangkan urgensi
adalah keluarnya urin akibat ketidakmampuan menunda
berkemih tatkala timbul sensasi keinginan untuk
berkemih. Overflow adalah keluarnya urin akibat
kekuatan mekanik pada kandung kemih yang
overdidtensi atau factor lain yang berfek pada retensi
urin
dan
fungsi
sfingter.
Edy memaparkan terapi inkontinensia urin untuk lini
pertama hingga ketiga berdasarkan tipe inkontinensia
yang
disebutkan
di
atas
lihat
table
1.
Beberapa pilihan terapi farmakologi untuk inkontinensia
urin pada pasien usia lanjut meliputi obat-obatan
antikolinergik dan antispamodik (bladder relaxant) atau
agonis
kolinergik.
Deteksi
dan
Identifikasi
Edy mengingatkan, harapan untuk mendapatkan
keluhan masalah IU dari pasien atau keluarga akan
kecil. Pasien usia lanjut sering datang dengan keluhan
dan masalah lain yang berhubungan langsung mamupun
tidak langsung dengan IU, ujar Edy. Keluhan tersebut
seperti infeksi saluran kemih, jatuh dengan semua
akibatnya, sindrom delirium akut atau bahkan sangat
tidak berhubungan dengan IU, mengingat adanya

karakteristik multi patologi pada pasien geriatri.


Masalah IU masih kurang mendapat perhatian dari
pasien dan keluarga. Hanya kurang dari 50 persen
pasien dengan IU yang melaporkan masalahnya ke
dokter,
ujar
Edy.
Ada atau tidak ada keluhan yang dilaporkan oleh
pasien dan keluarganya, deteksi atau identifikasi harus
dilakukan melalui observasi langsung atau menanyakan
pertanyaan-pertanyaan penapisan IU. Selanjutnya
dilakukan evaluasi dasar dengan pengkajian paripurna,
dengan anamnesis yang teliti, pemeriksaan fisik lengkap
dan penunjang lainnya yang bertujuan mengidentifikasi
penyebab inkontinensia yang bersifat sementara.
Berdasarkan evaluasi dasar tersebut akan ditegakkan
diagnosis presumtif dan diberikan terapi percobaan.
Jika diagnosis presumtif tidak dapat dibuat atau
terapi percobaan tidak efektif, pasien harus menjalani
evaluasi lanjutan yang lebih kompleks, kata
Edy.
PostedbyGERIATRIin04:52:55|Permalink|NoComments

MengatasiKonstipasipadaUsiaLanjut
BAPAK Alam ternyata tidak sendirian. Apa yang
dialaminya ternyata banyak dirasakan orang lanjut
usia. Menurut dr Kris Pranarka SpPD KGer dari
Subbagian Geriatri Bagian Ilmu Penyakit Dalam
Fakultas Kedokteran Universitas Diponegoro/RSUP
dr Kariadi Semarang dalam Temu Ilmiah Geriatri
2003 yang berlangsung pekan lalu, sembelit atau
konstipasi merupakan keluhan saluran cerna
terbanyak pada usia lanjut. Sekitar 3040 persen
orang di atas usia 65 tahun mengeluh konstipasi.

Di Inggris, 30 persen penduduk di atas usia 60


tahun
merupakan
konsumen
yang
teratur
menggunakan obat pencahar. Di Australia, sekitar
20 persen populasi di atas 65 tahun mengeluh
menderita konstipasi. Suatu penelitian melibatkan
3.000 orang usia lanjut di atas 65 tahun
menunjukkan, 34 persen wanita dan 26 persen pria
mengeluhkan konstipasi.
Menurut dr Siti Setiati SpPD KGer dari Subbagian
Geriatri Bagian Ilmu Penyakit Dalam Fakultas
Kedokteran Universitas Indonesia/RSUP dr Cipto
Mangunkusumo, survei yang dilakukan di poliklinik
usia lanjut RSCM tahun 2003 pada 127 pasien
geriatri mendapatkan angka kekerapan konstipasi
sebesar 12,6 persen.
Konstipasi dialami semua umur. Sekitar 80 persen
manusia pernah menderita konstipasi dalam
hidupnya dan konstipasi berlangsung singkat
adalah normal. Menurut National Institute of
Diabetes and Digestive and Kidney Diseases
(NIDDK) berdasarkan National Health Interview
Survey tahun 1991, sekitar 4,5 juta penduduk
Amerika mengeluh menderita konstipasi terutama
anak-anak, wanita, dan orang usia di atas 65
tahun. Hal ini menyebabkan kunjungan ke dokter
sebanyak
2,5
juta
kali
per
tahun
dan
menghabiskan dana sekitar 725 juta dollar AS
untuk obat-obatan pencahar.
Menurut situs National Institute on Aging, AS,
konstipasi adalah suatu gejala, bukan penyakit.
Konstipasi didefinisikan sebagai frekuensi buang air
besar kurang dari normal dengan waktu yang lama
serta kesulitan dan rasa sakit dalam mengeluarkan
tinja.

Konstipasi memang lebih banyak dialami usia


lanjut dibanding usia muda. Di sisi lain orang usia
lanjut sering terpancang dengan kebiasaan buang
air besar sejak masa kanak-kanak dan masa muda.
Padahal, seiring pertambahan usia, fungsi tubuh
bisa menurun.
Namun, orang usia lanjut tidak perlu terlalu
khawatir, belum ada batasan mengenai periode
normal dari buang air besar. Ada orang yang buang
air besar duatiga kali sehari, ada yang dua kali
seminggu.
Pedoman untuk menentukan seseorang menderita
konstipasi adalah buang air besar kurang dari dua
kali seminggu, sulit mengeluarkan tinja, ada rasa
nyeri serta masalah lain seperti tinja disertai
darah. Jika tak ada gejala itu, bukan konstipasi.
Penyebab
Ada sejumlah sebab yang mendasari konstipasi,
dari kurang gerak, kurang minum, kurang serat,
sering menunda buang air besar, kebiasaan
menggunakan obat pencahar, efek samping obatobatan tertentu sampai adanya gangguan seperti
usus terbelit, usus tersumbat sampai kanker usus
besar.
Menurut Kris, defekasi atau buang air besar seperti
halnya berkemih adalah suatu proses fisiologik
yang melibatkan kerja otot polos dan serat lintang,
persarafan sentral dan perifer, koordinasi sistem
refleks, kesadaran yang baik dan kemampuan fisik
untuk mencapai tempat buang air besar. Karena
banyaknya mekanisme yang terlibat, konstipasi
menjadi sulit didiagnosis dan dikelola/diobati.
Proses buang air besar dimulai dari gerakan
peristaltik usus besar yang mengantarkan tinja ke

rektum (poros usus) untuk dikeluarkan. Tinja


masuk dan meregangkan pipa poros usus diikuti
relaksasi otot lingkar dubur dan kontraksi otot
dasar panggul. Poros usus akan mengeluarkan
isinya dengan bantuan kontraksi otot dinding
perut. Pengukuran aktivitas motorik usus besar
pada penderita konstipasi dengan elektrofisiologik
menunjukkan pengurangan respons motorik usus
besar akibat degenerasi jaringan saraf otonom di
selaput lendir usus. Ditemukan pula pengurangan
rangsang saraf pada otot polos sirkuler yang
menyebabkan memanjangnya waktu gerakan usus.
Selain itu, ada kecenderungan menurunnya
tegangan jaringan otot lingkar dubur dan kekuatan
otot polos berkaitan dengan usia, terutama pada
wanita.
Pemeriksaan
Pemeriksaan fisik pada konstipasi sebagian besar
tidak mendapatkan kelainan yang jelas.
Namun demikian, papar Kris, pemeriksaan fisik
yang teliti dan menyeluruh diperlukan untuk
menemukan
kelainan
yang
berpotensi
mempengaruhi fungsi usus besar. Pemeriksaan
dimulai pada rongga mulut meliputi gigi geligi,
adanya luka pada selaput lendir mulut dan tumor
yang dapat mengganggu rasa pengecap dan
proses menelan.
Daerah perut diperiksa apakah ada pembesaran
perut, peregangan atau tonjolan. Perabaan
permukaan perut untuk menilai kekuatan otot
perut. Perabaan lebih dalam dapat mengetahui
massa tinja di usus besar, adanya tumor atau
pelebaran batang nadi.

Pada pemeriksaan ketuk dicari pengumpulan gas


berlebihan, pembesaran organ, cairan dalam
rongga
perut
atau
adanya
massa
tinja.
Pemeriksaan dengan stetoskop digunakan untuk
mendengarkan suara gerakan usus besar serta
mengetahui adanya sumbatan usus.
Sedang pemeriksaan dubur untuk mengetahui
adanya wasir, hernia, fissura (retakan) atau fistula
(hubungan abnormal pada saluran cerna), juga
kemungkinan
tumor
di
dubur
yang
bisa
mengganggu proses buang air besar. Colok dubur
memberi informasi tentang tegangan otot, dubur,
adanya timbunan tinja, atau adanya darah.
Pemeriksaan laboratorium dikaitkan dengan upaya
mendeteksi faktor risiko konstipasi seperti gula
darah, kadar hormon tiroid, elektrolit, anemia
akibat keluarnya darah dari dubur. Anoskopi
dianjurkan untuk menemukan hubungan abnormal
pada saluran cerna, tukak, wasir, dan tumor.
Foto polos perut harus dikerjakan pada penderita
konstipasi untuk mendeteksi adanya pemadatan
tinja atau tinja keras yang menyumbat bahkan
melubangi usus. Jika ada penurunan berat badan,
anemia, keluarnya darah dari dubur atau riwayat
keluarga dengan kanker usus besar perlu dilakukan
kolonoskopi.
Bagi sebagian orang konstipasi hanya sekadar
mengganggu. Tapi, bagi sebagian kecil dapat
menimbulkan komplikasi serius. Tinja dapat
mengeras sekeras batu di poros usus (70 persen),
usus besar (20 persen), dan pangkal usus besar
(10 persen). Hal ini menyebabkan kesakitan dan
meningkatkan risiko perawatan di rumah sakit dan
berpotensi menimbulkan akibat yang fatal.

Pada konstipasi kronis kadang-kadang terjadi


demam sampai 39,5 derajat celcius, delirium
(kebingungan dan penurunan kesadaran), perut
tegang, bunyi usus melemah, penyimpangan irama
jantung, pernapasan cepat karena peregangan
sekat rongga badan.
Pemadatan dan pengerasan tinja berat di muara
usus besar bisa menekan kandung kemih
menyebabkan retensi urine bahkan gagal ginjal
serta hilangnya kendali otot lingkar dubur,
sehingga keluar tinja tak terkontrol. Sering
mengejan berlebihan menyebabkan turunnya
poros usus.
Terapi
Menurut Siti Setiati, penatalaksanaan konstipasi
tergantung penyebab yang mendasari.
Penatalaksanaan
nonfarmakologik
yang
merupakan kombinasi pengaturan makanan (tinggi
serat dan cairan), pengaturan jadwal buang air
besar dan latihan jasmani, merupakan fase awal
yang harus dilakukan pada pasien konstipasi
sebelum
melakukan
penatalaksanaan
farmakologik.
Penderita perlu diperbaiki konsepnya tentang
konstipasi. Penderita akan tenang jika diberitahu
bahwa buang air besar tiga kali seminggu sampai
tiga kali per hari adalah normal. Penderita perlu
didorong ke jamban setengah jam setelah sarapan
pagi untuk memanfaatkan refleks gastrokolik.
Kekurangan air bisa berakibat konstipasi. Karena
itu, orang perlu minum enam sampai delapan
gelas (1,5 liter cairan) per hari.

Serat yang berasal dari biji-bijian, beras, buah


sayuran, kacang-kacangan akan memfasilitasi
gerakan usus dengan meningkatkan massa tinja
dan mengurangi waktu transit usus. Serat juga
menyediakan substrat untuk bakteri usus besar
memproduksi gas dan asam lemak rantai pendek
yang meningkatkan gumpalan tinja. Serat tidak
efektif tanpa cairan cukup.
Tomotari Mitsuoka DVM PhD dalam publikasinya di
Asia Pacific Journal of Clinical Nutrition Vol 5 tahun
1996 melaporkan, pemberian bakteri asam laktat
seperti lactobacillus dan bifidobacteria, yang paling
mudah dalam bentuk yogurt atau yakult, selain
menyeimbangkan flora usus juga menekan
pembusukan sisa makanan di usus, mengurangi
konstipasi serta penyakit geriatri lain, mencegah
dan mengobati diare, meningkatkan sistem
kekebalan tubuh untuk melawan infeksi.
Penting pula membuat jadwal buang air besar,
pada pagi atau malam hari setelah makan. Selain
itu, perlu dilakukan olahraga, misalnya jalan kaki
tiap pagi.
Penggunaan
obat
perlu
dievaluasi
dengan
mengurangi dosis atau mengganti obat yang
berefek samping menimbulkan konstipasi. Misalnya
obat
antidepresan,
obat
parkinson,
obat
mengandung zat besi, antihipertensi serta
antikolinergik dan jenis narkotik.
Jika cara itu tidak mempan, baru diobati pencahar.
Pemilihan pencahar yang tepat sangat penting
dihubungkan dengan penyebab konstipasi serta
kondisi penderita agar efektif dan aman. (ATK)
Sunber: Kompas, 10 Juni 2003

PostedbyGERIATRIin04:44:30|Permalink|NoComments

PerhatianterhadapLansiaBelumOptimal
Jakarta, Kompas Jumlah orang lanjut usia (di atas
60 tahun) di Indonesia hingga tahun 2020
diperkirakan meningkat 414 persen dibandingkan
dengan tahun 1990 dan tertinggi di dunia. Namun,
peningkatan jumlah ini tidak diikuti perhatian
optimal, seperti penanganan kesehatan mereka di
rumah sakit atau di rumah.
Akibatnya,
jumlah
lansia
dengan
masalah
kesehatan terus meningkat. Padahal, mereka ini
tidak harus identik dengan tidak sehat, bila
memperoleh perawatan yang khas bagi mereka.
Faktanya, penanganan kesehatan lansia lebih
banyak menggunakan prosedur umum. Padahal,
konsumsi obat dalam jumlah banyak dengan
penurunan fungsi berbagai sistem organ tubuh
berakibat serius.
Mereka yang berusia lanjut itu bukan orang
dewasa yang bertambah umur. Mereka punya hak
menerima pelayanan khusus, tidak cukup sembuh
lalu pulang karena lebih kompleks, kata internis
sekaligus konsultan geriatri Dr Czeresna H Soejono
SpPD KGer dalam jumpa pers menjelang Temu
Ilmiah Geriatri bertema Continuum of Care of
Healthy
Elderly
and
Geriatric
Patient
memperingati Hari Usia Lanjut Nasional, Selasa
(18/5).
Perhatian pemerintah, dunia kedokteran, dan
keluarga terhadap lansia yang belum optimal,
salah satunya ditunjukkan dengan ketidaktahuan
penanganan khusus yang harus diterapkan. Rumah
sakit di Indonesia pun sebagian besar belum
memberikan tempat khusus, sedangkan keluarga

belum memahami cara memperlakukan lansia


secara tepat.
Bahkan, lanjut Czeresna, tidak banyak dokter
Indonesia yang memahami bagaimana menangani
lansia sakit dan keluarga tidak dilatih menangani
lansia pasca-pengobatan. Di seluruh Indonesia,
tidak lebih dari 20 dokter dengan spesialisasi
kedokteran geriatri (kedokteran usia lanjut).
Padahal, ada 22 juta lansia yang membutuhkan
penanganan khusus.
Seiring dengan pertambahan usia, kemampuan
fungsi tubuh manusia akan menurun. Gejala
penyakit yang diderita lansia pun tidak lazim,
seperti influenza tanpa disertai batuk, gangguan
fungsi paru-paru tanpa gejala sesak napas, dan
infeksi tanpa demam.
Pemahaman dokter dan keluarga yang cukup
dalam memperlakukan lansia akan mengurangi
jumlah lansia yang dirawat di rumah sakit. Salah
satu contoh, orang tua yang menunda-nunda
makan sebenarnya indikasi sakit yang perlu segera
ditangani. Jangan tunggu sampai kesadaran
menurun, baru panggil dokter, urai Czeresna.
Dampak penurunan kesadaran lansia, yang
berawal dari sulit makan, bisa menyebabkan
gangguan pembuluh darah yang berujung pada
stroke. Karena itu, pemahaman penanganan
lansia dari keluarga amat penting untuk mencegah
dampak buruk yang mungkin timbul, katanya.
Sehubungan dengan upaya memasyarakatkan
pentingnya
perhatian
terhadap
lansia,
Perhimpunan Gerontologi Medik Indonesia Jakarta
(Pergemi Jaya) akan mengadakan temu ilmiah.
Tujuannya, menularkan prosedur perawatan lansia

yang tepat dan memberi acuan yang bisa


diterapkan di sekolah-sekolah kedokteran. Ilmu
kedokteran geriatri di Indonesia baru berkembang
pertengahan tahun 1990-an.

Karsinomaprostatmerupakansuatutumorganasyangtumbuh
didalamkelenjarprostat.3Karsinomaprostatmerupakan
keganasansalurankemihkeduapalingseringdijumpaisesudah
keganasankandungkemih.195%diantarakankerprostatadalah
adenokarsinoma.5
Tumorinimenyerangpasienyangberusiadiatas50tahun,di
antaranya30%menyerangpriaberusia7080tahundan75%
padausialebihdari80tahun.Kankerinijarangmenyerangpria
sebelumberusia45tahun.2kankerprostatmerupakanpenyebab
kematiannomortigaakibatkankerpadapriadanmerupakan
penyebabutamakematianakibatkankerpadapriadiatas74
tahun.3
Insidenskarsinomaprostatakhirakhirinimengalami
peningkatankarenameningkatnyausiaharapanhidup,
penegakandiagnosisyangmenjadilebihbaik,dankewaspadaan

tiaptiapindividumengenaiadanyakeganasanprostatmakin
meningkatkarenainformasidarimajalah,mediaelektronikatau
internet.2
ETIOLOGIDANPATOGENESIS
Penyebabnyabelumdiketahuisecarapasti.Namun,ada
beberapafaktoryangdidugasebagaipenyebabtimbulnya
adenokarsinomaprostat,yaitupredisposisigenetik,pengaruh
hormonal,diet,pengaruhlingkungandaninfeksi.2Kemungkinan
untukmenderitakankerprostatmenjadiduakalijikasaudara
lakilakinyamenderitapenyakitini.Kemungkinannyanaik
menjadilimakalijikaayahdansaudaranyajugamenderita.Hal
inimenunjukkanadanyafaktorgenetikyangmelandasi
terjadinyakankerprostat.2
Priayangmemilikiresikolebihtinggiuntukmenderitakanker
prostatadalahpriakulithitamyangberusiadiatas60tahun,
petani,pelukisdanpemaparankadmium.3Kankerprostat
ternyatalebihbanyakdideritaolehbangsaAfrikaAmerikayang
berkulithitamdaripadabangsakulitputih.Padapenelitianlain
didapatkanbahwabangsaAsialebihsedikitmenderitapenyakit
ini.NamunmerekayangpindahkeAmerikamendapatkan
kemungkinanlebihbesarmenderitakankerinidaripadamereka
yangtetaptinggaldinegaraasalnya.Inimenunjukkanbahwa
pengaruhlingkungandankebiasaanhidupsehariharijuga
berperandalampatogenesispenyakitini.Pemaparankadmium
(Cd)yangbanyakterdapatpadaalatlistrikdanbaterai
berhubunganeratdengantimulnyakankerprostat.2
Pertumbuhandanperkembangankeganasanprostatbergantung
padahormonandrogen.Halinitidakberartibahwakarsinoma
prostatdisebabkanolehhormonandrogen.Banyakkeganasan
prostatyangsensitifterhadaphormon.1Selainitu,perlu
diketahuibahwatidakadahubunganantarahiperplasiaprostat
jinakdenganperkembangankearahkeganasan.5
Beberapapenelitianmenunjukkanadanyahubunganantaradiet
tinggilemakdanpeningkatankadarhormontestosteron.3Diet
yangbanyakmengandunglemak,sepertisusuyangberasaldari

binatang,dagingmerah,danhatididugameningkatkankejadian
kankerprostat.2
Kankerprostatdikelompokkanmenjadi:3
StadiumA:benjolan/tumortidakdapatdirabapada
pemeriksaanfisis,biasanyaditemukansecaratidaksengaja
setelahpembedahanprostatkarenapenyakitlain.
StadiumB:tumorterbataspadaprostatdanbiasanya
ditemukanpadapemeriksaanfisikatautesPSA.
StadiumC:tumortelahmenyebarkeluardarikapsul
prostattetapibelumsampaimenyebarkekelenjargetahbening.
StadiumD:Kankertelahmenyebar(metastase)ke
kelenjargetahbeningregionalmaupunbagiantubuhlainnya
(misalnyatulangdanparuparu).
GAMBARANKLINIS
Padakankerprostatstadiumdiniseringkalitidakmenunjukkan
gejalaatautandatandaklinis.Tandatandaitubiasanyamuncul
setelahkankerberadapadastadiumlanjut.1,2,3Kebanyakan
penderitabarudatangpadastadiumlanjutdengankeluhan
obstruksiatautandatandametastasisketulangatauorganlain.1
Adapunkeluhanobstruksialirankemihantaralain,disuri(nyeri
saatmiksi),dankadanggejalanyamenyerupaiBPH(Beningn
ProstateHypertrophy)yaituberupakesulitandalamberkemih
danseringberkemihdimanasegerasetelahberkemih,biasanya
airkemihmasihmenetesnetes.Gejalatersebuttimbulkarena
kankermenyebabkanpenyumbatanparsialpadaalirankemih
melaluiuretra.Kankerprostatjugamenyebabkanairkemih
berwarnamerah(hematuri)yangmenandakanbahwakanker
telahmenekanuretra.2,3Selainitu,kankerprostatjuga
menyebabkanterjadinyapenahananairkemihmendadak.Gejala
lainnyaadalahnyeripunggungbagianbawah,nyeriketika
buangairbesar,nokturia,inkontinensiauri,nyeriperutdan
penurunanberatbadan.3
Kankerprostatyangsudahmengadakanmetastasisketulang
memberikangejalaberupanyeritulang,frakturpadatempat
metastasis,ataukelainanneurologisakibatlesimedullaspinalis

jikametastasisterjadipadatulangvertebra.1,2Namun,didalam
referensilaindikatakanbahwakadangmetastasistulangpun
tidakmemberikeluhanyangjelas.1Akantetapi,padabeberapa
kasus,kankerprostatbaruterdiagnosissetelahmenyebarke
tulang(terutamatulangpanggul,costadanvertebra)atauke
ginjal(menyebabkangagalginjal).3
Kankerprostatjugabisamenyebarkeotakdanmenyebabkan
kejangsertagejalamentalatauneurologislainnya.3
PEMERIKSAANTAMBAHAN
Pemeriksaanfisisyangpentingadalahpemeriksaandengan
melakukancolokdubur(rectaltoucher).2Padakarsinoma
prostat,prostatterabakerasatauterababenjolanyang
konsistensinyalebihkerasdarisekitarnyaatauadaprostatyang
asimetridenganbagianyanglebihkerasdanbentuknyatidak
beraturan.1,3
Padapemeriksaandarahdilakukanpengukurankadarantigen
prostatspesifik(PSA).Antigenspesifikprostat(PSA)inihanya
diproduksiolehprostat,baikolehepitelkelenjaryangnormal
maupunyangganas.PSAbiasanyameningkatpadakanker
prostat,tetapijugabisameningkat(walaupuntidakterlalu
tinggi)padapenderitaBPH.3,4
Padastadiumdini,seringkalisulituntukmendeteksikanker
prostatmelaluicolokdubursehinggaharusdibantudengan
pemeriksaanUSGtransrektal(TRUS).KemampuanTRUS
dalammendeteksikankerprostatduakalileihbaikdaripada
colokduburdimanaterdapatareahipoekoikpada60%
karsinomaprostat,yangmerupakansalahsatutandaadanya
kankerprostatdansekaligusmengetahuikemungkinanekstensi
tumorkeekstrakapsuler.Namun,MRIlebihakuratdalam
menentukanluasekstensitumorkeekstrakapsuleratauke
vesikulaseminalis.2
Pemeriksaansintigrafi(Bonescan)padatulangdilakukanuntuk
mencarimetastasishematogenpadatulang.Meskipun
pemeriksaaninicukupsensitif,tetapibeberapakelainantulang
jugadapatmemberikanhasilpositifpalsu,antaralain:artritis

degeneratifpadatulangbelakang,penyakitPaget,danpenyakit
tulanglainnya.2
PENATALAKSANAAN
Carapenangananadenokarsinomaprostatditujukanuntuk
meingkatkanumurharapanhidupdanmempertahankankualitas
hidup.Metodenyaberbedabedatergantungdariumurpasien
danstadiumpenyakitnya.5
PenderitadenganstadiumA1dimanagejaladantandaklinis
tidakada,sebaiknyadiobservasiseumurhidupkarenasebagian
besartidakakanberkembangmenjadistadiumlanjutatau
invasif.Kelangsunganhiduppenderitapadastadiuminitidak
berbedadariorangtanpakarsinomaprostat.1
PadapasienyangberadapadastadiumA2danB,dilakukan
prostatektomiradikalyaituberupapengangkatankelenjar
prostatbersamadenganvesikulaseminalis.Hanyasajaoperasi
inidapatmenimbulkanpenyulitantaralainperdarahan,
disfungsiereksi,daninkontinensia.2
Terapiradiasiditujukanpadapasienusiatuaataupasiendengan
tumorlokoinvasifdantumoryangtelahmengadakan
metastasis.Pemberianradiasieksternabiasanyadidahului
denganlimfadenektomi.Diseksikelenjarlimfesaatinidapat
dikerjakanmelaluibedahlaparoskopikdisampingoperasi
terbuka.2
Terapidenganmanipulasihormonalbertujuanuntuk
mengurangikadartestosteron.Penurunankadartestosteron
seringkalisangatefektifdalammencegahpertumbuhandan
penyebarankanker.Manipulasihormonalterutamadigunakan
untukmeringankangejalatanpamenyembuhkankankernya,
yaitumisalnyapadapenderitayangkankernyatelahmenyebar.3
Jikadihubungkandenganskenario,prioritaspenatalaksanaan
yangdapatdilakukanadalahmemasangkateter.Selanjutnya
melakukanpemeriksaancolokduburdanpemeriksaan
penunjanglainnyauntukmembedakankarsinomaprostat
denganhiperplasiaprostatjinak(BPH).

Para lanjut usia, dikhawatirkan akan menjadi persoalan besar


bagiIndonesia.Sebab,dilihatdarijumlahnyapadatahun2020
diperkirakan akan meningkat sebesar 414 persen(Biro Pusat
Statistik, 2006). Padahal upaya penyejahteraan termasuk
peningkatan kualitas kesehatan kelompok ini masih belum
memadai. Secara alamiah, proses menjadi tua mengakibatkan
kemundurankemampuanfisikdanmental.Secaraumum,lebih
banyak gangguan organ tubuh dikeluhkan oleh para warga
senior baik pria maupun wanita, lebih banyak pula yang
menderitapenyakitkronis(AstawanM,2007)
Seiringdenganperjalananusia,khususnyabagipriausialanjut
harus meningkatkankewaspadaan pada kondisi kesehatan
tubuhnya. Sebab, semakin bertambahnya usia, fungsi organ
organtubuhterusmenurun.Salahsatugangguankesehatanyang
kerapdialamipriaberusialanjutadalahgangguanprostat.Yang
lebih parah adalah kanker prostat karena kanker prostat
merupakan kanker pembunuh nomor dua pada pria setelah
kanker paruparu (Jar, 2004). Baik gangguan prostat maupun
kanker prostat harus samasama diwaspadai karena dampak
negatif yang ditimbulkannya cukup mengerikan. Pria yang
terkenagangguanprostatmisalnya,dapatmengalamigangguan
seksual,sedangkankankerprostatdapatmenyebabkankematian
(Siswono,2003).
TINJAUANPUTAKA
Prostat adalah organ lakilaki yang bertugas memproduksi
semen (madhi) suatu cairan yang berfungsi memberi makan
spermadanmembuatjalanbagispermasaatmenujuseltelur.
Prostatterletakdipangkalkemaluanlakilaki.Selainberfungsi
sepertidiatas,prostatadalahpenunjangutamakekuatanereksi
seorang lakilaki. Kanker prostat terjadi ketika sel prostat
mengalamimutasidanmulaiberkembangdiluarkendali.Selini
dapatmenyebarsecarametastasisdariprostatkebagiantubuh
lainnya,terutamatulangdanlymphnode.Kankerprostatdapa
menimbulkan rasa sakit, kesulitan buang air kecil, disfungsi
erektildangejalalainnya.

Kankerprostatjarangmenyerangpriadibawah45tahunkecuali
ada di antara keluarga anda yang demikian. Penyakit ini
biasanyadapat disembuhkan bila terdeteksi dalam tahapdini,
kataDr.Stanisic.Kankerprostatadalahkankerpalingumumdi
kalanganpriaselewat50tahundanmenjadipembunuhterbesar
keduadiantarakankerkankeryangmenyerangpriadiAmerika
Serikat.Lebihdariseparuhpriadiatas70tahundisanatelah
mendapatkannya,kataDr.Stanisic.
TINJAUANEPIDEMIOLOGI
Kankerprostatjarangmenyerangpriadibawah45tahunkecuali
ada di antara keluarga anda yang demikian. Penyakit ini
biasanyadapat disembuhkan bila terdeteksi dalam tahapdini,
kataDr.Stanisic.
Kankerprostatseringtumbuhsecaradiamdiamdalamkelenjar
prostattanpagejalaapapunsampaisetelahmenyebarketulang
danjaringandisekitarnya.Itusebabnyapentingsekalibagipria
usia 50 tahun untuk menjalani uji rektal digital yang
memungkinkan dokter menemukan benjolan atau pembesaran
padaprostat,danprostatespecificantigenbloodtest,ujidarah
untuk mendeteksi sejenis protein yang keluar dari prostat
apabilaadatumor.
Apabila dokter menemukan kanker, pengobatannya akan
bergantung pada beberapa faktor, termasuk ukuran tumor,
kecepatan pertumbuhannya dan apakah penyakit itu telah
menyebar ke luar prostat. Pengobatan untuk ini antara lain
adalahradiasi,pengangkatanprostatmelaluipembedahan,dan
terapihormonuntukmenurunkankadartestosteron.
Usia di atas 50 tahun memang merupakan salah satu faktor
resikountukkankerprostat.Lebihdari65persendariseseorang
yangbaru didiagnosa kankerprostat berusia 65tahunkeatas.
sebagaitambahan90persendarikematiankarenakankerprostat
terdaptpadausiapriadiatas65,4tahun.
Pembesaranprostatjinak,infeksivirus,riwayatkankerprostat
dalam keluarga, polahidup, dan pola makan (Widjojo, 2007).
Salah satu faktor risiko tersebut yaitu pola makan, menurut
Umbas Rainy (2002) diet tinggi lemak dan pola makan

berkalsium tinggi (Notrou P, 2007) merupakan faktor yang


mempunyai kaitan erat dengan meningkatnya risiko kanker
prostat. Para usia lanjut akan kehilangan kandungan kalsium
tubuhsebanyak30%setelahusia50tahundan80%setelah70
tahunyangdapatmeningkatkanrisikoterjadinyaosteoporosis
sehingga membutuhkan asupan kalsium yang lebih banyak
daripada usia dewasa (Donatelle, 2005). Hal ini menciptakan
paradigmadikalanganusialanjutuntukmengkonsumsikalsium
dalam jumlah banyak, padahal konsumsi kalsium berlebih
khususnya pada pria usia lanjut dapat meningkatkan risiko
terkenakankerprostat(AstawanM,2007).Perankalsiumdalam
meningkatkanrisikokankerprostatadalahdenganmekanisme
penurunanregulasi1,25(OH)2vitaminD,suatuvitaminDaktif
yangdapatmenghambatproliferasiselkankerprostat(Kristall
A, dkk, 2002). Salah satu alternatif untuk menghambat
pertumbuhandanproliferasiselkankerprostatadalahmelalui
intraprostatic conversion dari 25(OH)vitamin D menjadi 1,25
(OH)vitaminD(ChanJdanGiovannucciE,2001).
FAKTORRISIKOKANKERPROSTAT
Genetik
Risiko jadi semakin tinggi jika terbukti ada kerabat yang
terdiagnosis kanker prostat. Jika ayah atau saudara lakilaki
menderita kanker prostat, berarti risiko yang dihadapi cukup
tinggi.
Polakonsumsi
Dari berbagai riset diungkapkan, pola makan memengaruhi
peningkatan kemungkinan seseorang dapat menderita kanker,
apa pun jenisnya. Bahkan, para ahli gizi menyatakan, 8090
persen kasus kanker berkaitan erat dengan makanan yang
dikonsumsi. Berbagai penelitian mengatakan, risiko akan
meningkat bila seseorang sehariharinya mengonsumsi diet
tinggilemak.
Gayahidup
Merokok dan minum alkohol ditengarai menjadi pemicu
munculnya kanker prostat. Selain itu, sering bergantiganti

pasangan juga membuka kesempatan terjadinya infeksi virus


penyebabkankeryangditularkanmelaluihubungankelamin.
Lingkungan
Pekerjaindustriyangberkontaklamadenganlogamkadmium
(bahanpembuatbatere),jugabahanbahankimialainberisiko
tinggimengidapkankerprostat.
Kadarhormone
Kadar hormon testosteron yang tinggi berhubungan dengan
peningkatan resiko kanker prostat. Testosteron akan diubah
menjadi androgen yang lebih poten yaitu dihydrotestosteron
(DHT) oleh enzim 5 alphareductase, yang memegang peran
pentingdalamprosespertumbuhanselselprostate
PEMBAHASAN
Kelenjarprostatmenghasilkansitratdanglukosayangpenting
bagi kehidupan sperma. Selain itu, kelenjar prostat juga
menghasilkancairanyangkeluarbersamaspermaketikaterjadi
ejakulasi.Sebenarnya,seiringbertambahnyausia,seorangpria
akan mengalami pembesaran kelenjar prostat. Tetapi, tidak
selalu pembesaran kelenjar prostat mengakibatkan
pembengkakan.
Karena letaknya yang mengelilingi pangkal saluran kemih
(uretra) yang terletak di bawah kandung kemih, maka jika
kelenjarprostatmembengkak,kelenjarprostatdapatmenekan
salurankemihsehinggaairkencingmenjaditidaklancaratau
bahkantersumbat.Gejalayangditimbulkanolehpembengkakan
kelenjar prostat hampir mirip dengan gejala kanker prostat.
Karena itu, seorang pria dianjurkan untuk segera melakukan
pemeriksaanbilamengalamigejalatersebut,untukmemastikan
apakah hanya karena pembesaran kelenjar prostat atau gejala
adanya kanker prostat. Untuk mengetahui secara dini adanya
kanker prostat,pria dianjurkanuntuk melakukan pemeriksaan
secarateratursetahunsekaliberupa:
1. Pemeriksaan fisik: Digital Rectal Examination (DRE) atau
pemeriksaancolokdubur.
2.PemeriksaanUSG(Ultrasonografi)kelenjarprostat.

3. Pemeriksaan kadar PSA (Prostat Spesific Antigen) dalam


darah.
PENCEGAHAN
Makanlah lebih banyak makanan rendah lemak, tinggi serat,
ataumakananyangmengandungasamlemakomega3,seperti
produk kacang kacangan contohnya tahu sutra dan kacang
kedelai, tomat dan makanan yang mengandung saus tomat,
sayursayuransepertibrokoli,kembangkoldankolsertaikan
salmon,tunadansarden.Konsumsimakananyangmengandung
lemakjenuhyangtinggi(terutamalemakhewani)dankurang
mengandung serat akan meningkatkan resiko terkena kanker
prostat.
Beberapafaktorberikutiniyangbisamengurangiresikoterkena
kankerprostat:
1.Memperbaikikeadaankesehatanumum.
JagaagarberatbadanAndaberadapadaberatidealuntuktinggi
Anda.JikaAndamenderitaobesitasmakatemuiahligiziuntuk
mengatur diet yang seimbang. Kombinasikan juga dengan
kegiatanolahraga.
2.Minumbanyakair.Airsangatlahesensialuntukkesehatan
karenamembantumengurangiracunracundaridalamtubuh.
Konsumsiairyangidealsetiaphariadalah68gelassehari.
Kopidantehtidaktermasukdalamkonsumsiair.
3.Kurangiminumalkohol.
4. Makan makanan yang banyak mengandung likopen,
contohnyatomatdanbuahbit.
5. Makan makanan yang mengandung asam lemak omega3
seperti kacang kedelai dan produknya seperti tofu, atau susu
kacangkedelai,salmon,tunadansarden.
6. Makan makanan yang mengandung beta karoten seperti
wortel
7.Kurangikonsumsidagingdagingandanlemak
8.PastikanAndamendapatcukupasupanseleniumdanvitamin
E
9.Terakhir,kurangistresdandepresi.Carilahkesibukanatau
olahragademimembantumenenangkanpikiran.

GEJALAKANKERPROSTAT
1.Sulitberkemih
Bisaberupaperasaaninginberkemihtapitidakadayangkeluar,
berhenti saat sedang berkemih, ada perasaan masih ingin
berkemih atau harus sering ke toilet untuk berkemih karena
keluarnya sedikit sedikit. Gejala ini akibat membesarnya
kelenjarprostatyangadadisekitarsalurankemihkarenaada
tumor di dalamnya sehingga mengganggu proses berkemih.
Kelenjar prostat akan makin besar seiring bertambahnya usia
seseorang.Karenaitu,periksadirikedokteruntukmembedakan
apakahhanyapembesaranprostatataukahkanker.
2.Nyerisaatberkemih
Problem ini juga akibat adanya tumor prostat yang menekan
saluran kemih. Namun, nyeri ini juga bisa merupakan gejala
infeksi prostat yang disebut prostatitis. Bisa juga tanda
hiperplasiaprostatyangbukanmerupakankanker.
3.Keluardarahsaatberkemih
Gejala ini jarang terjadi, namun jangan diabaikan. Segeralah
periksakedoktermeskidarahyangdikeluarkanhanyasedikit,
samarsamaratauhanyaberwarnamerahmuda.Kadangkala
infeksisalurankemihjugabisamenyebabkangejalaini.
4.Sulitereksiataumenahanereksi
Tumorprostatbisasajamenyebabkanalirandarahkepenisyang
seharusnyameningkatsaatterjadinyaereksimenjaditerhalang
sehingga susah ereksi. Bisa juga menyebabkan tidak bisa
ejakulasi setelah ereksi. Tapi sekali lagi, pembesaran prostat
bisasajamenyebabkanmunculnyagejalaini.
5.Darahpadasperma
Gejalaini,sepertidarahpadaurin,bisatimbultidakterlalujelas.
Darah tidak dalam jumlah banyak dan hanya menyebabkan
warnanya berubah menjadi merah muda. Meski begitu patut
diwaspadai
6. Sulit Buang Air Besar (BAB) dan ada masalah saluran
pencernaanlainnya
Kelenjarprostatterletakdibawahkandungkemihdandidepan
rektum.Akibatnya,bilaadatumorpencernaanakanterganggu.

Namunperludiingat,sulitBAByangterusmenerusterjadijuga
bisa menyebabkan pembesaran prostat karena terjadi tekanan
padakelenjarsecaraterusmenerus.SulitnyaBABdangangguan
salurancernabisajugamengindikasikankankerususbesar.
7.Nyeriterusmenerusdipunggungbawah,panggulataupaha
dalambagianatas
Sering,kankerprostatmenyebardiwilayahwilayahini,yaitu
pada punggung bawah, panggul dan pinggul sehingga nyeri
yangsulitdijelaskandibagianinibisamenjaditandaadanya
gangguan.
8.Seringberkemihdimalamhari
Jika Anda sering terbangun di malam hari lebih dari sekali
hanyauntukberkemih,periksalahsegerakedokter.
9.Urinyangmenetesatautidakcukupkuat
Gejalainimiripinkontinensiaurin(ngompol).Urintidakdapat
ditahan hingga perlahan keluar dan menetes. Atau kalau pun
keluaralirantidakcukupkuat.
10.Usiadiatas50danmempunyaifaktorresiko
Karena tidak menimbulkan gejala maka pria yang memiliki
faktorrisikosebaiknyamemeriksakandirisecararutin.Faktor
risiko ini termasuk adanya anggota keluarga yang menderita
kanker terutama jika itu sang ayah, obesitas/kegemukan dan
merokok.

Dalamkeadaannormal,manusiamemiliki2ginjal.Setiapginjal
memilikisebuahureter,yangmengalirkanairkemihdaripelvis
renalis(bagianginjalyangmerupakanpusatpengumpulanair
kemih)kedalamkandungkemih.

Darikandungkemih,airkemihmengalirmelaluiuretra,
meninggalkantubuhmelaluipenis(pria)danvulva(wanita).

Fungsiginjaladalahuntuk:

Menyaringlimbahmetabolik
Menyaringkelebihannatriumdanairdaridarah
Membantumembuanglimbahmetaboliksertanatriumdan
airyangberlebihandaritubuh
Membantumengaturtekanandarah
Membantumengaturpembentukanseldarah.
Setiapginjalterdiridarisekitar1jutaunitpenyaring(nefron).
Sebuahnefronmerupakansuatustrukturyangmenyerupai
mangkukdengandindingyangberlubang(kapsulaBowman),
yangmengandungseberkaspembuluhdarah(glomerulus).
KapsulaBowmandanglomerulusmembentukkorpuskulum
renalis.
Darahyangmasukkedalamglomerulusmemilikitekananyang
tinggi.Sebagianbesarbagiandarahyangberupacairandisaring
melaluilubanglubangkecilpadadindingpembuluhdarahdi
dalamglomerulusdanpadalapisandalamkapsulaBowman;
sehinggayangtersisahanyaselseldarahdanmolekulmolekul
yangbesar(misalnyaprotein).
Cairanyangtelahdisaring(filtrat)masukkedalamrongga
Bowman(daerahyangerletakdiantaralapisandalamdanlapisan
luarkapsulaBowman)danmengalirkedalamtubuluskontortus
proksimal(tabung/salurandibagianhuluyangberasaldari
kapsulaBowman);natrium,air,glukosadanbahanlainnyayang
ikuttersaringdiserapkembalidandikembalikankedarah.
Ginjaljugamenggunakanenergiyangsecaraselektif
menggerakkanmolekulmolekulyangbesar(termasukobat
obatan,misalnyapenicillin)kedalamtubulus.Molekultersebut
dibuangkedalamairkemihmeskipunukurannyacukupbesar
untukdapatmelewatilubanglubangpadapenyaring
glomerulus.
BagianberikutnyadarinefronadalahansaHenle.

KetikacairanmelewatiansaHenle,natriumdanbeberapa
elektrolitlainnyadipompakeluarsehinggacairanyangtersisa
menjadisemakinpekat.
Cairanyangpekatiniakanmengalirkedalamtubuluskontortus
distal.Didalamtubulusdistal,semakinbanyakjumlahnatrium
yangdipompakeluar.
Cairandaribeberapanefronmengalirkedalamsuatusaluran
pengumpul(duktuskolektivus).Didalamduktuskolektivus,
cairanterusmelewatiginjalsebagaicairanyangpekat,ataujika
masihencer,makaairakandiserapdariairkemihdan
dikembalikankedalamdarah,sehinggaairkemihmenjadilebih
pekat.
Tubuhmengendalikankonsentrasiairkemihberdasarkan
kebutuhannyaterhadapairmelaluihormonhormonyang
kerjanyamempengaruhifungsiginjal.
Airkemihyangterbentukdiginjalmengalirkebawahmelalui
uretermenujukekandungkemih;alirantersebutbukan
merupakanaliranyangpasif.Ureteradalahpipa/tabungberotot
yangmendorongsejumlahairkemihdalamgerakan
bergelombang(kontraksi).
Setiapureterakanmasukkedalamkandungkemihmelalui
suatusfingter.Sfingteradalahsuatustrukturmuskuler(berotot)
yangbisamembuka(sehinggaairkemihbisalewat)dan
menutup.
Airkemihyangsecarateraturmengalirdariureterakan
terkumpuldidalamkandungkemih.
Kandungkemihinibisamengembang,dimanaukurannyasecara
bertahapmembesaruntukmenampungjumlahairkemihyang
semakinbertambah.
Jikakandungkemihtelahpenuh,makaakandikirimsinyalsaraf
keotak,yangmenyampaikanpesanuntukberkemih.
Selamaberkemih,sfingterlainnyayangterletakdiantara

kandungkemihdanuretraakanmembukasehinggaairkemih
mengalirkeluar.Secarabersamaan,dindingkandungkemih
berkontraksisehinggaterjaditekananyangmendorongair
kemihmenujukeuretra.Tekananinidapatdiperbesardengan
caramengencangkanototototperut.
Sfingerpadapintumasukkandungkemihtetapmenutuprapat
untukmencegahaliranbalikairkemihkeureter.

GEJALAGEJALAKELAINANGINJAL&SALURAN
KEMIH
Gejalayangdisebabkanolehkelainanginjaldansalurankemih
sangatbervariasi,tergantungkepadabagianginjalatausaluran
kemihyangterkena.

Demamdanmalaise(perasaantidakenakbadan)merupakan
gejalayangumum,tetapiinfeksikandungkemih(sistitis)
biasanyatidakmenyebabkandemam.
Suatuinfeksibakteripadaginjal(pielonefritis)biasanya
menyebabkandemamtinggi.
Kankerginjalkadangmenyebabkandemam.
Sebagianbesarorangmelakukanbuangairkecilsebanyak46
kali/hari,terutamapadasianghari.
Frekuensi(seringberkemih)tanpadisertaipeningkatandalam
jumlahtotalairkemihdalamsehari,merupakansuatugejaladari
infeksikandungkemihatauiritasikandungkemih(misalnya
karenabendaasing,batuatautumor).
Tumorataumassalainnyayangmenekankandungkemihjuga
bisamenyebabkanpeningkatanfrekuensiberkemih.
Iritasikandungkemihjugabisamenyebabkandisuria(nyeri
ketikaberkemih)danurgensi(desakanuntukberkemih),yang
bisadirasakansebagaitenesmus(nyeriketikamengedanyang
hampirdirasakanterusmenerus).
Jumlahairkemihbiasanyasedikit,tetapijikapenderitatidak
segeraberkemih,airkemihbisakeluardengansendirinya
(kontrolterhadapberkemihhilang).
Nokturiaadalahseringberkemihpadamalamhari.
Nokturiabisatejadipadastadiumawalpenyakitginjal,tetapi
bisajugakarenasebelumtidurseseorangterlalubanyakminum,
terutamaalkohol,kopiatauteh.
Nokturiaterjadikarenaginjaltidakdapatmemekatkanairkemih
denganbaik.
Nokturiajugaterjadipadapenderitagagaljantung,gagalhati
ataudiabetes,meskipuntidakterdapatkelainanpadasaluran
kemihnya.
Nokturiadenganjumlahairkemihyangsangatsedikitbisa
terjadijikaairkemihmengalirbalikkekandungkemihkarena
adanyapenyumbatan;salahsatupenyebabnyayangpaling

seringditemukanpadaprialanjutusiaadalahpembesaran
kelenjarprostat.
Enuresis(ngompol)padausia23tahunmerupakanhalyang
normal.Enuresisyangterjadisetelahusia3tahun,menunjukkan
adanyasuatumasalah,misalnya:
tertundanyakematanganototdansarafpadasalurankemih
bagianbawah
infeksiataupenyempitanuretra
neurogenicbladder(tidakadekuatnyapengontrolansaraf
kandungkemih).
Gejalagejalayangseringditemukanpadapenyumbatanuretra
adalah:
keraguanuntukmemulaiberkemih
kebutuhanuntukmengedan
aliranyanglemahataumenetes
setelahselesaiberkemih,airkemihmasihmenetes.
Padapria,gejalatersebutpalingseringdisebabkanoleh
pembesaraanprostatdanpenyempitanuretra(striktururetra).
Gejalayangsamapadaanaklakilaki,bisamenunjukkanadanya
kelainanbawaanberupapenyempitanuretraataulubanguretra
yangsangatkecil.Lubanguretrayangkeciljugabisaditemukan
padawanita.
Inkontinensiauri(ketidakmampuanmenahanbuangairkecil)
bisaterjadipadaberbagaikeadaan.
Sistokel(herniasi/burutkandungkemihkedalamvagina),air
kemihbisakeluarketikapenderitatertawa,batuk,lariatau
mengangkatbebanberat.Sistokelbiasanyaterjadiakibat
peregangandanlemahnyaototpanggul(karenamelahirkan)
atauakibatadanyaperubahankadarhormonestrogenpadasaat
menopause.
Penyumbatanpadaalirandarikandungkemihbisa
menyebabkaninkontinensiajikatekanandidalamkandung
kemihmelebihitahanandaripenyumbatan,meskipunkandung

kemihtidaksepenuhnyamenjadikosong.
Adanyagasdidalamairkemihmerupakangejalayangjarang
terjadi,yangbiasanyamenunjukkanadanyafistula(hubungan
yangabnormal)antarasalurankemihdanusus.
Suatufistulabisamerupakankomplikasidaridivertikulits,abses
maupunkanker.
Fistuladiantarakandungkemihdanvaginabisajuga
menyebabkanterdapatnyagasdidalamairkemih.Kadang
bakterididalamairkemihjugamembentukgas.
Dalamkeadaannormal,seorangdewasamembuangsekitar1
cangkirsampai0,9Lairkemih/hari.Berbagaipenyakitginjal
menyebabkanterganggunyakemampuanginjaluntuk
memekatkanairkemih,sehinggajumlahairkemihyang
dibuangmelebihi2,25L.
Jumlahairkemihyangsangatbanyakbiasanyamerupakan
akibatdari:
tingginyakadarguladarah
rendahnyakadarhormonantidiuretikyangdihasilkanoleh
kelenjarhipofisa(penyakitdiabetesinsipidus)
berkurangnyaresponterhadaphormonantidiuretik(diabetes
insipidusnefrogenik).
Penyakitginjalataupenyumbatanpadaureter,kandungkemih
atauuretrabisasecaramendadakmenyebabkanberkurangnya
produksiairkemihsampaikurangdari2cangkir/hari.
Jikaproduksiairkemihdenganjumlahkurangdari1
cangkir/hariterusberlanjut,bisaterjadipenimbunanlimbah
metabolikdidalamdarah(azotemia).Penurunanjumlahair
kemihinibisamenunjukkanadalahgagalginjalakutatau
memburuknyasuatukelainanginjalkronis.
Airkemih(urin)yangencerhampirtidakberwarna,sedangkan
urinyangpekatberwarnakuningtua.
Zatwarnapadamakananbisamenyebabkanurinberwarna

merah;sedangkanobatobatanbisamenyebabkanurinberwarna
coklat,hitam,biru,hijauataumerah.Selainkarenamakanan
atauobatobatan,urinyangtidakberwarnakuningadalah
abnormal.
Urincoklatmungkinmengandunghasilpemecahanhemoglobin
(proteinpengangkutoksigendidalamseldarahmerah)atau
proteinotot.
Urinyangmengandungzatwarnaakibatporfiriamenjadi
merah,sedangkanzatwarnaakibatmelanomamenyebabkan
urinmenjadihitam.
Urinyangkeruhmenunjukkanadanyananahakibatinfeksi
salurankemihataukristalgaramdariasamuratmaupunasam
fosfat.
Penyebabdariwarnaurinyangabnormalbisadiketahuidengan
melakukanpemeriksanmikroskopikterhadapsedimenurindan
analisakimiaurin.
Hematuria(darahdidalamurin)dapatmenyebabkanurin
berwarnamerahataucoklat,tergantungkepadajumlahdarah,
lamanyadarahberadadidalamurindankeasamanurin.
Hematuriatanpadisertainyeribisaterjadiakibatkanker
kandungkemihataukankerginjal.Hematuriainibiasanya
hilangtimbul,danperdarahanberhentisecaraspontanmeskipun
kankernyamasihada.
Penyebablaindarihematuriaadalah:
glomerulonefritis
batuginjal
kistaginjal
penyakitselsabit
hidronefrosis.
Nyeriakibatpenyakitginjalbiasanyadirasakandipunggung,
yaitudidaerahflank(diantaratulangrusukdanpinggulbagian
belakang).Kadangnyerinyamenjalarketengahtengahperut.
Penyebabnyaadalahperegangankapsularenalis(bagianluar
ginjal,yangpekaterhadapnyeri);halinibisaterjadipada

berbagaikeadaanyangmenyebabkanpembengkakanjaringan
ginjal.Jikaginjalditekan,seringkalitimbulrasanyeri.
Jikasebuahbatuginjalmelewatiureter,akantimbulnyeriyang
hebat.Sebagairesponterhadapbatu,ureterberkontraksi
sehinggaterjadinyerikramyanghebatdipunggungbagian
bawah,yangseringmenjalarkeselangkangan.Jikabatutelah
sampaikekandungkemih,makanyeriakanmenghilang.
Nyeripadakandungkemihpalingseringdisebabkanoleh
infeksibakteri.Nyeriinibiasanyadirasakandiatastulang
kemaluandanpadaujunguretraketikaberkemih.
Penyumbatanaliranurinjugamenyebabkannyeridiatastulang
kemaluan,tetapijikapenyumbatannyaterjadisecaralambat,
biasanyapelebarankandungkemihtidakdisertaidengannyeri.
Kankerdanpembesaranprostatbiasanyatidakmenimbulkan
nyeri,tetapiperadanganprostat(orostatitis)bisamenyebabkan
nyeriyangsamarsamarataurasapenuhdidaerahantaraanus
dankelamin.
Padasaatejakulasi,kadangkeluarsemenyangberdarah.Halini
bisaterjadipadapriayangmenderitakelainanpembekuan.
PROSEDURDIAGNOSTIK
Padapemeriksaanfisik,ginjalyangnormaltidakterabadari
luar,tetapiginjalyangmembengkakatautumorginjalbisa
terabadariluar.Kandungkemihyangmembengkakjugabisa
terabadariluar.
Pemeriksaancolokduburdilakukanuntukmerasakankelenjar
prostat.Pemeriksaandalamvaginabisamembantumemberi
keteranganmengenaikandungkemihdanuretra.

Prosedurtambahanyangdilakukanuntukmendiagnosis
kelainanginjaldansalurankemihadalah:
Analisaurin
Pemeriksaandarahuntukmenilaifungsiginjal
Prosedurimaging

Analisa

Contoh

sel

dan

jaringan.

urin

Analisaurinrutin(urinalisis)terdiridarianalisakimia(untuk
mendeteksi protein, gula dan keton) dan pemeriksaan
mikroskopik(untukmendeteksiseldarahmerahdanseldarah
putih).

Dengan pemeriksaan ini dapat diketahui dan diukur kadar


berbagaizatdidalamurin.Biasanyadigunakansehelaiplastik
tipis (dipstick) yang mengandung bahan kimia yang akan
bereaksidenganzatdidalamurindanmerubahwarnaurin.
Proteinuria (proteindidalamurin)bisaterjaditerusmenerus
atau hilang timbul, tergantung kepada penyebabnya.
Proteinuria biasanya merupakan pertanda dari suatu penyakit
ginjal,tetapibisajugaterjadisecaranormalsetelaholahraga
berat

(misalnya

maraton).

Proteinuriajugabisaterjadipadaproteinuriaortostatik,dimana

proteinbarumunculdidalamurinsetelahpenderitanyaberdiri
cukup lama, dan tidak akan ditemukan di dalam urin setelah
penderitanya

berbaring.

Glukosuria (gula di dalam urin) biasanya disebabkan oleh


diabetes.

Jikagulatetapditemukandidalamurinsetelahkadarguladarah
normal, maka penyebabnya adalah kelainan di ginjal.
Ketonuria(ketondidalamurin)bisadisebabkanolehkelaparan,
diabetes yang tidak terkontrol dan keracunan alkohol.
Keton merupakan hasil pemecahan lemak oleh tubuh.
Hematuria (darah di dalam urin) bisa diketahui melalui
pemeriksaanmikroskopikmaupundenganmatatelanjang(jika
darah sangat banyak, urin menjadi merah atau coklat).
Nitrituria (nitratdidalamurin)biasanyamenunjukkanadanya
infeksi, karena kadar nitrat meningkat jika terdapat bakteri.
Leukositesterase (enzimyangditemukanpadaseldarahputih
tertentu)didalamurinmerupakanpertandaadanyaperadangan,
yang paling sering disebabkan oleh infeksi bakteri.
Pemeriksaan ini mungkin merupakan negatif palsu jika urin

sangatpekatataumengandunggula,garamempedu,obatobatan
(misalnya

rifampcin,

vitamin

C).

Keasaman urin bisa meningkat karena makanan tertentu.


Osmolaritas (kepekatan urin) penting dalam mendiagnosis
kelainanfungsiginjal.Bisadilakukananalisaterhadapcontoh
urin acak atau dilakukan pemeriksaan untuk menilai
kemampuan ginjal dalam memekatkan urin.

Padasalahsatutes,seseorangtidakdiperbolehkanminumair
atau cairan lainnya selama 1214 jam; sedangkan pada tes
lainnya diberikan suntikan hormon vasopresin. Kemudian
kepekatan

urin

diukur.

Dalamkeadaannormal,keduatesseharusnyamenunjukkanurin
yang sangat pekat; tetapi pada penyakit ginjal tertentu, urin
menjadi

sangat

encer.

Dalamkeadaannormal,urinmengandungsejumlahkecilseldan
pecahanlainnyayangterlepasdarisalurankemihbagiandalam.
Padapenderitakelainansalurankemih,pecahandanseltersebut
terdapat dalam jumlah yang berlebihan, sehingga jika urin
disentrifugasi (diputar dalam alat khusus) akan terbentuk
sedimen (endapan). Sedimen ini dapat diperiksa dengan
mikroskop untuk mengetahui penyakit yang diderita.

Pembiakan urin adalah suatu proses untuk menumbuhkan


bakteri pada urin, yang dilakukan untuk mendiagnosis suatu
infeksi

saluran

kemih.

Contohurinyangbelumterkontaminasibisadiperolehmelalui:

metoda

cleancatch

kateter yangdimasukkanmelaluiuretrakekandungkemih
jarum yang ditusukkan melalui dinding perut ke kandung
kemih

Tes

(aspirasi

jarum

Fungsi

suprapubik).

Ginjal

Fungsi ginjal bisa dinilai melalui analisa darah dan urin.


Laju penyaringan ginjal bisa diperkirakan dengan cara
mengukur

kreatinin

serum.

Kadarureanitrogendarahjugabisamenunjukkanfungsiginjal.
Creatinine clearance adalah tes yang lebih akurat, yang
menggunakansuaturumusyangmenghubungkankadarserum
kreatinin dengan usia, berat badan dan jenis kelamin.
Prosedur

Imaging

Foto polos abdomen dapat memperlihatkan ukuran dan letak


ginjal,tetapikeduahaltersebutbiasanyaakanterlihatlebihbaik

pada

pemeriksaan

USG.

Urografiintravenaadalahsuatuteknikrontgenyangdigunakan
untuk menampilkan ginjaldansalurankemihbagian bawah.
Suatu zat radioopak disuntikkan melalui pembuluh vena. Zat
tersebut akan terdapat dalam ginjal biasanya dalam waktu
kurang dari 5 menit. Kemudian dilakukan pemotretan, yang
hasilnyaakanmenunjukkangambaranginjalsertaperjalananzat
radioopak

ke

dalam

kandung

kemih.

Jikaginjaltidakberfungsidenganbaik,makaurografiintravena
tidak akan memberikan hasil yang baik, karena ginjal tidak
dapat mengkonsentrasikan zat radioopak di dalam ginjal.
Sebagai efek samping dari penyuntikan zat radioopak, terjadi
gagal ginjal akut pada 1 dari 200 kasus. Penyebabnya tidak
diketahui, tetapi resikonya lebih tinggi pada:

usia lanjut atau memiliki riwayat gangguan ginjal

diabetes

melitus

multipel.

dehidrasi
mieloma

Kepada orangorang tersebut, sebelum zat radioopak


disuntikkan,diberikancairaninfusdandosisyangrendah.Atau
sebagai pilihan, kadang digunakan pemeriksaan CT scan.

Sistogramadalahsuatugambaranrontgendarikandungkemih,
yang diperoleh melalui urografi intravena.

Sistogram retrograd diperoleh dengan cara memasukkan zat


radioopakmelaluiuretra,sehinggadidapatgambaranyanglebih
jelas mengenai kandung kemih dan uretra.

Fotorontgendiambilsebelum,selamadansesudahberkemih.
Pada urografi retrograd, zat radioopak dimasukkan melalui
kateter ke dalam ureter. Dengan teknik ini akan diperoleh
gambaran yang jelas dari kandung kemih, ureter dan ginjal
bagian bawah, jika urografi intravena gagal.

Urografi retrograd juga bisa digunakan untuk menemukan


adanyapenyumbatanureteratauuntukmenilaiseseorangyang
alergi terhadap zat radioopak intravena.

Kerugian dari teknik ini adalah resiko terjadinya infeksi dan


perlu

dilakukan

pembiusan.

USG menggunakan gelombang suara untuk menghasilkan


gambaranstrukturanatomiginjal.Teknikinisederhana,tidak
menimbulkan
USG

bisa

nyeri

dan

digunakan

aman.

untuk:

Mempelajari ginjal, ureter dan kandung kemih; dengan


gambaran yang baik meskipun ginjal tidak berfungsi baik.
Mengukur laju pembentukan urin pada janin yang berumur

lebihdari20minggudengancaramengukurperubahanvolume
kandungkemih.Dengandemikianbisadiketahuifungsiginjal
janin.

Pada bayi baru lahir, USG merupakan cara terbaik untuk


mengetahuiadanyamassadidalamperut,infeksisalurankemih
dan kelainan bawaan pada sistem kemih.

Memperkirakan ukuran ginjal dan mendiagnosis sejumlah


kelainan ginjal, termasuk perdarahan ginjal.

Menentukan lokasi yang terbaik guna mengambil contoh


jaringan

untuk

keperluan

biopsi.

USG merupakan metode diagnostik terbaik untuk penderita


gagal ginjal stadium lanjut, yang ginjalnya tidak dapat
mengambil atau mentolerir zat radioopak.

Kandung kemih yang terisi dengan urin bisa terlihat dengan


jelaspadaUSG.USGjugadapatdigunakanuntukmendeteksi
tumorkandungkemih,tetapihasilnyalebihbaikjikadigunakan
CT

scan.

CT Scan merupakan pemeriksaan yang lebih mahal


dibandingkan dengan USG dan urografi intravena, tetapi
mempunyai

beberapa

keuntungan:

C T scan dapat membedakan struktur padat dengan cairan,


sehinggasangatbergunadalammenilaijenisdanluasnyatumor
ginjalataumassalainnyayangmenyebabkanperubahanpada

salurankemih.Untukmemberikangambaranyanglebihjelas,
bisa disuntikkan zat radioopak melalui pembuluh vena.
CTscandapatmembantumenentukanpenyebarantumorke
luar

ginjal.

Campuranairdanzatradioopakyangdimasukkankedalam
kandungkemihselamapemeriksaanCTscandapatdenganjelas
menggambarkan

tumor

kandung

kemih.

Pada angiografi disuntikkan zat radioopak ke dalam arteri.


Angiografi merupakan pemeriksaan yang paling invasif dan
hanyadilakukanpadakeadaantertentu,misalnyauntukmenilai
aliran

darah

ke

ginjal.

Komplikasidariangiografiadalahcederapadaarteridanorgan
disekitarnya,reaksiterhadapzatradioopaksertaperdarahan.
Venografi adalah suatu rontgen vena yang menggunakan zat
radioopak.

Jarang terjadi komplikasi dan biasanya hanya terbatas pada


perembesan darah serta zat radioopak di sekitar tempat
penyuntikan.Bisaterjadireaksialergiterhadapzatradioopak.
MRIscan dapatmemberikaninformasimengenaimassaginjal
yangtidakdapatditampilkanolehtekniklainnya.Bentuksuatu
tumordapatdigambarkansecara3dimensi.Massapadatdapat

dibedakandarimassaberrongga(kista),cairandidalamkista
bisa dibedakan antara perdarahan dengan infeksi.
MRIjugamemberikangambaranyangsempurnadaripembuluh
darahdanstrukturdisekitarginjal.Tetapiendapankalsiumdan
batu ginjal akan lebih jelas terlihat pada CT scan.
Contoh

Sel

&

Jaringan

Padabiopsiginjal,diambilcontohjaringanginjaldandiperiksa
dengan mikroskop. Biopsi dilakukan untuk memperkuat
diagnosis dan untuk menilai hasil pengobatan.

Biopsi jarum (memasukkan sebuah jarum melalui kulit)


seringkali merupakan bagian dari penilaian pada gagal ginjal
danbiopsiginjalyangdicangkokkanseringkalidilakukanuntuk
mencari

tandatanda

penolakan.

Sitologiurinmerupakanpemeriksaanmikroskopikterhadapsel
sel di dalam urin. Pemeriksaan ini dilakukan untuk
mendiagnosis

kanker

saluran

kemih.

Sitologi urin juga dilakukan sebagai skrining (penyaringan)


kanker pada orangorang berresiko tinggi (misalnya perokok,
pekerjapetrokimiadanpenderitaperdarahantanparasanyeri).
Untuk penderita yang telah menjalani pengangkatan tumor

kandungkemihataupuntumorginjal,sitologidilakukanuntuk
evaluasifollowup.

BPHadalahpembesaranprostatyangmengenaiuretradan
menyebabkangejalaurtikaria(Nursalam,2006)
BPHadalahpembesaranjinakkelenjarprostatdisebabkanoleh
karenahiperplasiabeberapaatausemuakomponenprostat
meliputijaringankelenjar/jaringanfibromuskuleryang
menyebabkanpenyumbatanuretraparsprostatika(Lab/UPF
ilmubedahRSUDdr.Sutomo,1994)
BPHadalahpembesaranprogresifdarikelenjarprostat(secara
umumpadaprialebihtuadari50tahun)menyebabkanberbagai
derajatobstruksiuretraldanpembatasanaliranurinarius(
Marilynn,Ed,2000)
B.ETIOLOGI
Penyebabkhususdaripenyakitinibelumdiketahuisecara
pasti,beberapahipotesismenyatakanbahwagangguaniniada
kaitannyadenganpeningkatankadardehidrotestosteron(DHT)
danprosespenuaan
Hipotesisyangdidugasebagaipenyebabtimbulnyahiperplasia
prostatadalah:
1.adanyaperubahankeseimbanganantarahormontestosteron
danekstrogenpadausialanjut
2.peranfaktorpertumbuhansebagaipemicupertumbuhan
stromakelenjarprostat
3.meningkatnyalamahidupselselprostatkarenakekurangan
selyangmati

4.teoriselstemmenerangkanbahwaterjadiproliferasi
abnormalselstemsehinggamenyebabkanproduksiselstroma
danselepitelkelenjarprostatmenjadiberlebihan
C.PATOFISIOLOGI
Pembesaranprostatmenyebabkanpenyempitanlumenuretra
prostatikadanakanmenghambataliranurine.Keadaanini
menyebabkantekananintravesikel.Untukdapatmengeluarkan
urine,bulibuliharusberkontraksilebihkuatgunamelawan
tahananini.Kontraksisecaraterusmenerusmenyebabkan
perubahananatomidaribulibuliberupahipertropiotot
destrussor,trabekulasi,terbentuknyaselulosa,sakuladan
divertikulibuli.Perubahanstrukturpadabulibulidirasakanoleh
pasiensebagaikeluhanpadasalurankemihsebelahbawahatau
lowerurinarytracksymptom(LUTS)yangduludikenal
dengangejalaprostatismus.tekanintravesikelyangtinggiakan
diteruskankeseluruhbagianbulibulitidakterkecualipada
keduamuaraureteriniakanmenimbulkanaliranbalikurinedari
bulibulikeureteratauterjadirefluksvesikoureter.Jika
keadaaniniberlangsungterusdapatmengakibatkanhidroureter,
hidronefrosis,dangagalginjal
D.MANIFESTASIKLINIS
ManifestasiklinisyangditimbulkanolehBPHdisebutsebagai
syndromaprostatisme.sindromprostatismeinidibagimenjadi
dua:
1.gejalaobstruktif
a.hesitansiyaitumemulaikencingyanglamadanseringkali
disertaidenganmengejanyangdisebabkanolehkarenaotot
destruksorbulibulimemerlukanwaktubeberapalama
meningkatkantekananintravesikelgunamengatasiadanya
tekanandalamuretraprostatika

b.intermitencyyaituterputusputusnyaalirankencingyang
disebabkanolehkarenaketidakmampuanototdestrussordalam
mempertahankantekananintravesikelsampaiberakhirnyamiksi
c.terminaldriblingyaitumenetesnyaurinepadaakhirkencing
d.pancaranlemah:kelemahankekuatandankaliberpancaran
destrussormemerlukanwaktuuntukdapatmelampauitekanan
diuretra
e.rasatidakpuassetelahberakhirnyabuangairkecildanterasa
belumpuas
2.gejalairitasi
a.urgencyyaituperasaaninginbuangairkecilyangsulit
ditahan
b.frequenyyaitupenderitamiksilebihseringdaribiasanya
dapatterjadipadamalamhari(nocturia)danpadasianghari
c.disuriayaitunyeripadawaktukencing
E.EPIDEMIOLOGI
Padausialanjut,beberapapriamengalamipembesaranprostat
benigna.Keadaaninidialamioleh50%priayangberusia60
tahundankuranglebih80%priayangberusia80tahun.
Pembesarankelenjarprostatmengakibatkanterganggunyaaliran
urinesehinggamenimbulkangangguanmiksi
F.KOMPLIKASI
1.retensiurineakutdaninvolusikontraksikandungkemih
2.reflukskandungkemih,hidroureterdanhidronefrosis
3.grosshematuriadanurinarytractinfection(UTI)
G.DIAGNOSISDANPEMERIKSAANPENUNJANG
UntukmenegakkandiagnosisBPHdilakukanbeberapacara
antaralain:

1.anamnesa
2.pemeriksaanfisikDilakukandenganpemeriksaanTD,nadi,
dansuhu.Nadidapatmeningkatpadakeadaankesakitanpada
retensiurineakut,dehidrasisampaisyolpadaretensiurineserta
urosepsissamapisyokseptik
3.pemeriksaanabdomendilakukandengantehnikbimanual
untukmengetahuiadanyahidronefrosisdanpyelonefrosis.pada
daerahsuprasymfisierpadakeadaanretensiakanmenonjol.
Saatpalpasiterasaadanyaballotemendanklienakanterasa
inginmiksi.Perkusidilakukanuntukmengetahuiadatidaknya
residualurin
4.penisdanuretradiperiksauntukmendeteksiadanya
kemungkinanstenosemeatus,striktururetra,batuuretra,
karsinomamaupunfimosis
5.pemeriksaanscrotumuntukmenentukanadanyaepididimitis
6.rectaltouche/pemeriksaancolokduburbertujuanuntuk
menentukankonsistensisistempersyarafanunitvesicaurinaria
danbesarnyaprostat
7.pemeriksaanlaboratorium:pemeriksaandarahlengkapfaal
ginjal,serumelektrolitdankadarguladigunakanuntuk
memperolehdatadasarkeadaanumumklien
8.pemeriksaanurinelengkapdankultur
9.PSA(ProstaticSpesificAntigen)pentingdiperiksasebagai
kewaspadaanadanyakeganasan
10.pemeriksaanuroflowmeter
11.pemeriksaanimagingdanrontgenologik
a.BOF(buihoverzich)untukmelihatadanyabatudan
metastasepadatulang

b.USG(UltraSonoGrafi)digunakanuntukmemeriksa
konsistensi,volumedanbesarprostatjugakeadaanbulibuli
termasukresidualurin
c.IVP(PyelografiIntraVena)digunakanuntukmelihatfungsi
ekskresiginjaldanadanyahidronefrosis
d.pemeriksaanpanendoskopuntukmengetahuikeadaanurethra
danbulibuli
H.PENATALAKSANAANMEDIS
1.penatalaksanaanterapi:
Penghalangadrenergiksepertidoksasosin(caradura),
prazozin(minipress),terazozin(hytrin),sertarelaksasi
ototkandungkemihdanprostat
Finasteride(proscara)efekantiandrogenpadaselprostat
danmencegahhyperplasia
2.dilatasibalonpadauretraprostatdalamwaktuyangsingkat
dapatmenghilangkangejala
3.bedahTURP,TIUP,atauopenprostatectomyuntukprostat
yangterlalubesarbiasanyamelaluisuprapubik
4.bedahlaser
5.mycrowavehipertermiatreatment
I.PENATALAKSANAANKEPERAWATAN
a.pengkajian
1.kajiriwayatadanyagejalameliputiserangan,frekuensi
urinariasetiaphari,berkemihpadamalamhari,seringberkemih,
perasaantidakdapatmengosongkanvesicaurinariadan
menurunnyapancaranurine
2.gunakanindeksgejalauntukmenentukangejalaberat,dan
dampakterhadapgayahiduppasien

3.lakukanpemeriksaanrectal(palpasiukuran,bentukdan
konsistensi)danpemeriksaanabdomenuntukmendeteksi
distensikandungkemihsertaderajatpembesaranprostat
4.lakukanpengukuranerodinamikyangsederhana,
uroflowmetridanpengukuranresidualprostat,jikadi
indikasikan
b.diagnosakeperawatan
1.gangguaneliminasiurineberhubungandenganobstruksi
uretraditandaidengan:
DS:melaporkanberkemihtidaklancarsertaurinemenetesdan
sering
DO:inkontinensia,berkemihmendadak,nokturiadanretensi
urine
2.Risikoinfeksiberhubungandenganinsisipembedahan,
imobilitasdanpemasangankateterurineditandaidengan:
DS:statuspembedahan
DO:imobilitas,terpasangkateterdanterdapatlukaoperasi
3.nyeriberhubungandenganprosedurpembedahanditandai
dengan:
DS:laporanadanyanyeripadalukaoperasi
DO:adanyalukaoperasisertaekspresiwajahmeringisdan
menahansakit
4.cemasberhubungandenganinkontinensiaurine,disfungsi
seksual,ditandaidengan:
DS:pasienbanyakbertanyamengenaikondisikesehatannya
DO:inkontinensiaurinedangangguanereksi
c.rencanakeperawatan

DiagnosaI
Tujuan:setelahdilakukanperawatanselama57haripasien
tidakmengalamiretensiurinedengankriteriapasiendapat
buangairkecilteraturdanbebasdaridistensikandungkemih
Intervensi:
1.aturkepatenanlokasikateteruretrasesudahpembedahan
dengancara:
Lakukanirigasimanual50mlcairanirigasidengan
menggunakantehnikaseptik
Rasional:untukmencegahsumbatanpadaselangkateter
Cegahoverdistensikandungkemih
Rasional:overdistensikandungkemihdapatmenyebabkan
perdarahan
Berikanantikolinergiksesuaianjuran
Rasional:antikolinergikberfungsiuntukmengurangispasme
kandungkemih
2.obsevasiadanyatandatandashock/hemoragi(hematuria
,dingin,kulitlembab,takikardia,dispnea)
Rasional:untukmemberikanpenanganandinibilatandatanda
shockmuncul
3.monitorurinesetiapjam(haripertamaoperasidansetiap2
jammulaiharikeduapostoperasi)
Rasional:memantaukepatenanhidrasikateter
4.berikancairaninfussesuaianjurandanberikancairanoral
jikadapatditoleransi
Rasional:untukhidrasidanpengeluaranurine
DiagnosaII

Tujuan:setelahdilakukanperawatanselama13haripasien
terbebasdariinfeksidengankriteria:
TTVdalambatasnormal
Tidakadabengkak,erytemadannyeri
Lukainsisisemakinsembuhdenganbaik
Intervensi:
1.aturbedrestdenganmonitoringTTV
Rasional:peningkatanTTVkhususnyasuhumengindikasikan
tandatandainfeksi
2.observasiwarnaurine(gelap)baudanevaluasiadanya
infeksi
Rasional:urineyanggelapmengindikasikanadanyainfeksi
padasalurankemih
3.lakukanperawatanlukainsisisecaraaseptikjugakulitsekitar
kateterdandrainase
Rasional:perawatanlukasecarateraturdengantehnikaseptik
dapatmencegahterjadinyaprosesinfeksi
4.berikanantibiotiksesuaidengananjuran
Rasional:antibiotikbersifatmelemahkanbakteripenyebab
infeksi
DiagnosaIII
Tujuan:setelahdilakukanperawatanselama35haripasien
mampumempertahankanderajatkenyamanansecaraadekuat
dengankriteria:
Secaraverbalpasienmengungkapkannyeriberkurangatau
hilang
Pasiendapatberistirahatdengantenang

Intervensi:
1.monitordancatatadanyarasanyeri,lokasidurasidanfaktor
pencetussertapenghilangrasanyeri
Rasional:untukmengetahuiderajatnyeriyangdirasakanklien
sehinggadapatmemilihtindakan/penangananyangsesuai
2.obsevasitandatandanonverbalnyeri(gelisah,kening
mengkerut,peningkatanTDdandenyutnadi)
Rasional:klienterkadangmenyembunyikanketidaknyamanan
yangdirasakansedangtandatandanonverbaldapat
mencerminkanketidaknyamananyangdialamiklien
3.aturposisipasiensenyamanmungkin,ajarkantehnikrelaksasi
danmintamelaporkanjikanyerimeningkat
Rasional:posisiyangnyamandantehnikrelaksasidapat
menguranginyeri
4.anjurkanpasienuntukmenghindaristimulan(kopi,teh,
merokok,abdomentegang)
Rasional:kopidantehdapatmenstimulasinyeri
5.berikompreshangatpadaabdomenterutamapadaperut
bagianbawah
Rasional:kompreshangatdapatmembantumeminimalisirnyeri
6.kolaborasi:pemberiananalgetik
Rasional:analgetikberkhasiatmemblokstimulasinyerikeSSP
DiagnosaIV
Tujuan:Setelahdilakukanintervensirasacemasklien
berkurang/hilangdengankriteria:TTVdalambatasnormal
Intervensi:

1.jelaskankeadaanyangsebenarnyatentangketidaknyamanan
pascabedah
Rasional:denganmengetahuiketidaknyamanan
pascabedahklienakanlebihtenang
2.beritahupasienbahwainkontinensiaurine,frekuensi
berkemihdandisuriadapatterjadisesudahkateterdilepas
Rasional:kecemasanbisamunculkarenaklientidaktahuhal
halyangberkaitandenganpenyakitnya
3.beritahukanresikopentingpascapembedahan
Rasional:denganmengetahuiresikoyangbisaterjadipasca
pembedahan,rasacemasklienakanberkurang
4.bantupasienuntukmengungkapkankecemasandanketakutan
yangdialaminya
Rasional:membantumengidentifikasirasacemasyangdialami
klien
e.evaluasi
1. Drainaseberwarnakuningjernihmelaluikateter
2. Insisitanpadrainase,tidakdemam
3. Menunjukkanpenyembuhannyeriyangbaik
4. Menunjukkanharapanyangnyatauntukberkemihdan
fungsiseksual

Cystitismerupakanperadanganpadakandungkemih(Medical
SurgicalNursing,2004)cystitisadalahkeadaanklinikakibat
berkembangbiaknyamikroorganismeyangmenyebabkan
inflamasipadakandungkemih.
Cystitisdapatdibedakanmenjadidua:

Tipeinfeksi,disebabkanolehbakteri,virus,jamurdan
parasit
Tipenoninfeksidisebabkanolehbahankimia,radiasi,
daninterstitial(tidakdiketahuipenyebabnya/idiopatik)
1. ETIOLOGI
Infeksipadacystitisdisebabkanoleh:
Bakteri
KebanyakanberasaldaribakteriEscherichiacolyyangscara
normalterletakpadagastrointestinal.padabeberapakasus
infeksiyangberasaldariurethradapatmenujuginjal.
Bakterilainyangyangbisamenyebabkaninfeksiadalah
Enterococcus,klebsiella,proteus,pseudomonas,dan
staphylococcus
Jamur
Infeksijamur,penyebabnyamisalnyacandidia
Virusdanparasit
Infeksiyangdisebabkanolehvirusdanparasitjarangterjadi.
Contohnya:trichomonas,parasitiniterdapatdalamvagina,juga
dapatberadadalamurine
Sedangkanyangnoninfeksibiasanyaterjadikarena:
Paparanbahankimia,contohnyaobatobatan(misalnya
cyclophosphamideataucytotaxanatauprocycox)
Radioterapi
ReaksiimunologibiasanyapadapasienSLE(Systemic
LupusErytemaous)
Penyebablaindaricystitisbelumdapatdiketahui,adapenelitian
yangmenyatakanbahwacystitisbisadisebabkantidak
berfungsinyaepitelkandungkemihuntukmenyimpanurine

yangmenyebabkanadanyakebocoranpadalapisandalam
kandungkemih
1. MANIFESTASIKLINIK
Separuhdaripasienyangditemukanmemilikibakteridalam
urin(bakteriuria)tidakmenunjukkangejala.Tandadangejala
cystitismencakupnyeriyangseringdanrasapanasketika
berkemih,kadangkadangdisertaispasmepadaareakandung
kemihdansuprapubis.hematuriadannyeripunggungjugadapat
terjadi.
Sedangkanpadatipenoninfeksidikarakteristikanolehdemam,
gejalaberkemihiritabel(seringberkemih,nokturia,urgensi,
rasatertekanpadaareasuprapubis,nyeripadasaatkandung
kemihpenuh)danterutamaditandaidenganhilangnyakapasitas
kandungkemih.Nyeridapatterjadidalamabdomenatau
perineum,ataumenyebarkepangkalpaha.
Padapasiendengansystitis,berikutinigejalayangsering
muncul:
1. Disuria
2. Rasapanassepertirasaterbakarsaatberkemih
3. Adanyeripadatulangpunggungbagianbawah
4. Urgensi(rasaterdesaksaatberkemih)
5. Nocturia(cenderungseringkencingpadamalamhari
akibatpenurunankapasitaskandungkemih)
6. Pengosongankandungkemihyangtidaksempurna
7. Inkontinensia
8. Retensi
9. Nyerisuprapubik

1. PENATALAKSANAANMEDISDAN
KEPERAWATAN
1. Penatalaksanaanmedis
Prinsipumumpenatalaksanaanpasiendengansystitis:
1. Eradikasibakteripenyebabdenganmenggunakan
antibioticyangsesuai
2. Mengoreksikelainananatomisyangmerupakanfactor
predisposisi
Tujuanpengobatansystitisadalahmencegahdan
menghilangkangejala,mencegahdanmengobatibakteremiadan
bakteriuria,mencegahdanmengurangiresikokerusakanjaringan
ginjalyangmungkintimbuldenganpemberiaanobatobatan
yangsensitive,murah,amandenganefeksampingyang
minimal.
1. Penatalaksanaankeperawatan
Penatalaksanaankeperawatanpasiendengansystitisini
ditujukanuntukpengurangannyeridanketidaknyamanan,
penguranganseringberkemih,urgencydanhesitancy,
peningkatanpengetahuantentangtindakanpencegahandan
modalitaspenanganansertatidakadanyakomplikasipootensial.
1. Menguranginyeridanketidaknyamanan
Nyeridanketidaknyamanandapatdikurangidengancepat
ketikaterapiantimicrobialdimulai.agenantispasmodic
membantudalammengurangiiritabilitaskandungkemihdan
nyeri.aspirin,pemanasanperineumdanmandirendampanas
membantumengurangiketidaknyamanandanspasme
1. Mengurangifrekuensi(seringberkemih),urgensidan
hesitancy
Pasiendidoronguntukminumdenganbebassejumlahcairan
(airadalahpilihanterbaik)untukmendukungalirandarahrenal

danuntukmembilasbakteridaritraktusurinarius.cairanyang
dapatmengiritasikandungkemih(missal;kopi,the,kola,
alcohol)dihindari.
1. Pendidikanpasien
Pasienharusmenerimarincianinstruksiberikut:
Mengurangikonsentrasipathogenpadaorifisiumvagina
(khususpadawanita)melaluitindakanhygiene:seringmandi
pancurandaripadamandirendamkarenabakteridalamairbak
dapatmasukkeuretra,bersihkansekelilingperineumdan
meatusuretrasetiapselesaidefekasidengangerakandaridepan
kebelakang
Minumdenganbebassejumlahcairandalamsehariuntuk
membilaskeluarbakteri,hindarikopi,the,kola,danalcohol
Berkemihsetiap23jamdalamseharidankosongkan
kandungkemihdengansempurnahalinimencegahdistensi
kandungkemihyangberlebihandangangguanterhadapsuplai
darahkedindingkandungkemihyangmerupakanpredisposisi
systitis
Jikahubunganseksualmerupakankejadianyang
mengawalaiberkembangnyabakteriuria:segeraberkemih
setelahmelakukanhubunganseksual,minumagen
antimicrobialoraldosistunggalsetelahhubunganseksual
Jikabakteritetapmunculdalamurin,terapi
antimicrobialjangkapanjangdiperlukanuntukmencegah
kolonisasiareaperiuretraldankekambuhaninfeksi
Konsulketenagakesehatansecarateraturuntuktindak
lanjut,kekambuhangejalaatauinfeksinonresponsiveterhadap
penanganan
1. Pemantauandanpenatalaksanaankomplikasi

Pengenalanpenyakitsystitissecaradinidanpenangananyang
tepatsangatpentinguntukmencegahkekambuhaninfeksidan
kemungkinankomplikasisepertigagalginjalatausepsis.Tujuan
penangananadalahuntukmencegahinfeksiagartidak
berkembangdanmenyebabkankerusakanrenalpermanendan
gagalginjal.
1. PENGKAJIAN
1. Identitas
Umur:terjadipadasemuaumur
Jeniskelamin:lebihseringterjadipadawanitadan
meningkatnyainsidennyasesuaipertambahanusiadanaktivitas
seksual
Tempattinggal:adaatautidaknyafactorpredisposisi
1. Keluhanutama
Rasasakitataupanasdiuretrasewaktukencing
Urinesedikit
Rasatidakenakdidaerahsuprapubik
1. Riwayatpenyakit
RiwayatISKsebelumnya
Obstruksipadasalurankemih
MasalahkesehatanlainmisalnyaDM,riwayatseksual
1. Pemerisaanfisik
TTV:tandatandasepsis
Infeksiabdomenbagianbawahdanpalpasiurine
bladder:pengosongantidakmaksimal
Inflamasidanlesidiuretra,meatusdanvaginaintroitus

Kajiperkemihan:dorongan,frekuensi,disuria,bauurine
yangmenyengat,nyeripadasuprapubik
1. Pemeriksaanpsikososial
Seringterjadipadausiaremajadandewasamuda
,aktivitasseksual,timbulperasaanmaludanbersalah
Perasaantakutakankekambuhandimanamenyebabkan
penolakanterhadapaktivitasseksual
Nyeridankelelahanyangberkenaandenganinfeksi
dapatberpengaruhterhadappenampilankerjadanaktivitas
kehidupanseharihari
1. Pemeriksaanlaboratorium
Urinalisaurintengah
Ketikainfeksiterjadimemperlihatkanbakteriuria,WBC(White
BloodCell),RBC(RedBloodCell)danendapanseldarah
putihdenganketerlibatanginjal
Tessensitivitas
Banyakmikroorganismesensitiveterhadapantibioticdan
antisepticberhubungandenganinfeksiberulang
Pengkajianradiographic
Cystitisditegakkanberdasarkanhistory,pemeriksaanmedisdan
laboratorium,jikaterdapatretensiurinedanobstruksialiran
urinedilakukanIPVIdentifikasiperubahandanabnormalitas
structural)
Pemeriksaankulturmengidentifikasibakteripenyebab
SinarXginjal,ureterdankandungkemih
mengidentifikasianomalystrukturnyata
1. ANALISADATABERHUBUNGANDENGAN
PENYIMPANGANKDM

Systitisterjadikarenaadanyakuman/bakteriyangmasuk
kedalamvesikaurinariamelaluiuretradarimikrobayang
terkandungdalamurinyanglamatertampungdalamvesika
urinariadanakanmenginfeksidikandungkemih.
Padawanitalebihcenderungterkenasystitiskarenauretra
pendekdibandingpria.Setelahterjadiinfeksiakibatdarikuman
dalamurineyangtertampungdalamvesikaurinariaakan
menyebabkandaerahtersebutmeradangdanbisajugakarena
kateteratauadanyatraumadariluarsehinggamenyebabkan
orangmengalamisystitissepertiperasaan/doronganselaluingin
BAK.
Padapriasystitistidakpernahprimeriahanyaterjadisebagai
ataukomplikasidariobstruksisalurankeluarvesikaurinaria
Urinelamatertampung
Trauma/pemasanganbatu
padakandung
DalamVU
kateterkemih
Infeksikuman/bakteri
Inflamasi/peradanganpada
Kandungkemih
Pengeluaranmediatorkimia
(bradikinin,prostaglandin,histamine)
Infeksisalurankemih
kortekscerebri
NyeribilaBAK
nyeridipersepsikan
Perubahanpolaeliminasi
urinenyeri

Perubahanstatuskesehatan
Kuranginformasi
Kurangpengetahuan
1. DIAGNOSAKEPERAWATAN
1. Nyeriberhubungandenganinfeksisalurankemih
2. Perubahanpolaeliminasiurineberhubungandengan
infeksisalurankemih
3. Kurangpengetahuanberhubungandengankurangnya
informasitentangpenyakitnya
2. PERENCANAAN
1. Nyeriberhubungandenganinfeksisalurankemih
Tujuan:tidakadanyeridanrasaterbakarsaatberkemih
1. Kajitingkatdanlokasinyeri
Rasional:temuaninidapatmemberitandakerusakanjaringan
lanjutdanperlupemeriksaanlebihluassepertipemeriksaan
radiologi
1. Pantautandatandavitaltiap4jam
Rasional:mengidentifikasiindikasikemajuankearahatau
penyimpangandarihasilyangdiharapkan
1. Anjurkanpasienuntukberkemihkapansajaadakeinginan
Rasional:berkemihyangseringmengurangistasisurinepada
kandungkemihdanmenghindaripertumbuhanbakteri
1. Kolaborasidengandoktertentangpemberianobat
analgetik
Rasional:analgetikmembloklintasannyerisehingganyeri
dapatberkurang

1. Perubahanpolaeliminasiurineberhubungandengan
infeksisalurankemih
Tujuan:polaeliminasimembaik
1. Berikanperawatanperinealdenganairsabunsetiapshift
Rasional:mencegahkontaminasiuretra
1. Pantaukeluaranurineterhadapperubahanwarnadanpola
eliminasi
Rasional:mengidentifikasiindikasikemajuandarihasilyang
diharapkan
1. Anjurkanmasukancairansekurangkurangnya2400ml/
hari
Rasional:mencegahstasisurine
1. Kolaborasidengandoktertentangpemberianobatyang
meningkatkanasamurine
Rasional:asamurinemengurangitimbulnyakumansehingga
dapatberpengaruhdalampengobataninfeksisalurankemih
1. Kurangpengetahuanberhubungandengankurangnya
informasitentangpenyakitnya
Tujuan:pasienmampuuntukmendemonstrasikankeinginan
untukmenaatirencanaterapeutik
1. Berikaninformasitentangsumberinfeksi,tindakanuntuk
mencegahpenyebaran
Rasional:pengetahuanapayangdiharapkandapatmengurangi
ansietasdanmembantumengembangkankepatuhanklien
terhadaprencanatherapeutic
1. Instruksikanpasienuntukmenggunakanantibioticyang
diresepkan

Rasional:pasienseringmenghentikanobatjikatandatanda
mereda
1. Anjurkangunakanpakaiandalamdarikatun
Rasional:kainkatunmemberikansirkulasiudarayangbaik
untukmengeringkanperineal
1. Tekankanpentingnyaperawatanyangtepatterhadap
pencegahaninfeksiyangberulangulang
Rasional:meningkatkankemampuanperawatandinidan
kemandirian
1. EVALUASI
Perawatmengevaluasikeadaanklien,hasilyangdiharapkan
danevaluasitersebutadalah:
Berkurangnyatandadangejalainfeksi
Kebutuhanakanrasanyamanterpenuhi
Mencegahadanyakekambuhaninfeksi
Klienmengatakanrasanyeriberkurang
Klienberkemihdenganurinejernihtanpa
ketidaknyamanan
Kultururinemenunjukantidakadabakteri
Klienmengertitentangkondisi,pemeriksaandignostik,
rencanapengobatan,tindakanperawatandiripreventif

Carsinomaprostatpalingumumterdiagnosisdanmerupakan
keganasansalurankemihkeduapalingseringdijumpaisesudah
keganasankandungkemihpadapriaAmerika.Darisemua
keganasan;prevalensikankerprostatmeningkatpalingcepat

sesuaipertambahanusia.Biasanyakeganasanprostatditemukan
padausiadiatas50tahundanjarangdibawah50tahun.
DiIndonesiabelumadaangkayangpastitentanginsidendan
mortalitaskarenakankerprostat;tetapiberdasarkanpengamatan
paraahliurologi;insidenkankerprostatcenderungmeningkat.
PenanganankankerprostatdiIndonesiamasihjauhdari
memadaibiladibandingkannegaramaju.Penyebabtersebut
olehkarenafaktorpenderita;pengelola;saranasertasistem
pelayanan.Danhanyapenderitayangdidiagnosisdalam
stadiumdinidanmendapatpenangananyangadekuatyang
punyaharapansembuh.Penderitakankerprostatlanjut;baik
lokalmaupunsistemikpenanganannyahanyabersifatpaliatif.
Angkakejadiankankerprostatsecarageografikdanrasial,lebih
banyakterjadipadaorangkulithitamdialamatCountry
CaliforniadibandingkanpadapopulasisiShanghaiatauCina
(Robin).OrangAmerikaAfrikaberisikolebihtinggiuntuk
mengalamikankerprostatdibandingorangkulitputib.Selain
itu,priaAmerikaAfrikacenderungmenunjukkantahap
penyakitlebihparahdaripadaorangkulitputih(Morton&
Terrell).Masalahyangdihadapipadakankerprostatadalah
deteksidini,olehkarenabersifatsubclinicaldankebanyakan
didapatkansetelahpemeriksaanautopsydarikelenjarprostat
atauprostatektomipadahiperplasiprostat(DouglasE.Johnson).
Banyakpenelitimenggunakanpemeriksaancolokdubur,trans
ultrasonografi(TRUS)danpemeriksaanProstatSpesifik
Antigenuntukdiagnosisdinikankerprostat.Pemeriksaanini
dirasakanpalingbaikdanekonomis.
ANATOMIKELENJARPROSTAT
Prostatmerupakankelenjarberbentukkonusterbalikyang
dibungkusolehkapsulfibromuskuleryangterletakdiinferior
darikandungkemih.Beratnormalnya:1820gram,didalamnya
terdapaturetraparsposterioryangpanjangnya2,5cm,ukuran
prostat3,5cmpadapotongantransversalbasisdan2,5cmpada

potonganvertikaldananteroposterior.Jaringanpenyangga
prostatdibagiandepanadalahligamentumpuboprostatikumdan
disebelahinferiorolehdiafragmaurogenital.Prostatdibagian
belakangditembusduktusejakulotoriusyangberjalanoblique
sampaimenembusveromontanumpadadasaruretrapars
prostatika,tepatdiproksimaldarisfinkteruretraeksterna.
Secaramakroskopisprostatterdiridariototpolosdanjaringan
ikat,organinimenghasilkansekretyangmemberikanbaukhas
padasemen.Bagianbagiannya:
Apex:bagianterbawahdariprostat,terletakkirakira12cm
posteriordaritepibawahsymphisispubis.
Basis:bagianprostatyangterletakpadabidanghorisontal
setinggipertengahansymphisispubis.
permukaaninferolateral:bagianyangconvexyangdipisahkan
darifaciessuperiordiafragmaurogenitalolehplexusvenosus.
permukaananterior:dipisahkandarisymphisisolehjaringan
lemakretropubiclegamentumpuboprostatikummedialis
melekatpadapermukaananteriorini.
permukaanposterior:datardanberbentuksegitigadimana
terdapatmediangroove,permukaanposteriorinidapatdiraba
dengancolokdubur.
Lobusprostat
MenurutklasifikasidariLowsley,prostatdibagimenjadi5
lobos,yaitu:
lobusanterior
lobusposterior
lobusmedialis
lobuslateralkanan
lobuslateralkiri
sedangkanmenurutMeNeal,prostatdibagi
zonaperifer
zonasentral
zonatransisional
segmenanterior
zonasfinkterpreprostatik

Secaramikroskopis:prostatterdiridan3050kelenjartubulo
alveolurbercabangyangmengeluarkansekretnyakedalam
uretraparsprostalikapadasaatejakulasi.Prostatdibungkus
kapsulfibroelastikyangbanyakmengandungototpolos,epithel
pseudokomplekatauselapissilindrissampaikuboidrendah,
tergantungsekresikelenjar,laminabasalistipis,dibawahnya
terdapatjaringanikatdanototpolos.
Vaskularisasi
Prostatmendapatdarahdari:A.pudendainterna,A.vesikalis
inferioryangmerupakansalahsatucabangdariA.iliacaintema,
masukkedalamprostatpadaperbatasanprostatdanVU,sertaA.
Hemorholdallsmedius.Darahvenadialirkankembalimelalui
plexusvenosusprostaticusyangkemudianditeruskankeV.
iliacainterna.
Lymphe
AliranlympedariprostatsebagianbesardialirkankeInn.iliaca
interna,tetapisebagianadayangmasukkeInniliacaexterna.
SebagiankecilmasukkedalamInnsacralis.
Inervasi
Prostatdiinervasiolehpleksusnervosusprostaticus.
FISIOLOGIKELENJARPROSTAT
Prostatadalahsuatualattubuhyangtergantungkepada
pengaruhendokrin.Pengetahuanmengenaisifatendokrinini
masihbelumpasti,tetapijelasbahwapengebirianmenyebabkan
kelenjarprostatmengecil.Padabinatangpercobaanjikakelenjar
hipofisediangkatmakaprostatakanmengecil,atropiinidapat
dicegahdenganpemberiantestosteron.Percobaanselanjutnya
menunjukkanbahwaprostatakanmembesarsetelahpemberian
estrogenpadabinatangyangdikebiri.Bagianyangpeka
terhadapestrogenadalahbagiantengah,sedangkanbagiantepi
pekaterhadapandrogen.Olehkarenaitupadaorangtuabagian
tengahlahyangmengalamihiperplasikarenasekresiandrogen
berkurangsehinggakadarestrogenrelatifbertambah.Selsel

kelenjarprostatdapatmembentukenzimasamfosfataseyang
palingaktifbekerjapadaph5.Kelenjarprostatmensekresi
sedikitcairanyangberwarnaputihsusudanbersifatalkalis.
Cairaninimengandungasamsitrat,asamfosfatase,kalsiumdan
koagulasesertafibrinolisis.Selamapengeluarancairanprostat,
kapsulkelenjarprostatakanberkontraksibersamaandengan
kontraksivasdeferendancairanprostatkeluarbercampur
dengansemenyanglainnya.
Cairanprostatmerupakan70%volumecairanejakulatdan
berfungsimemberikanmakananspermatozondanmenjagaagar
spermatozontidakcepatmatididalamtubuhwanita,dimana
sekretvaginasangatasam(PH:3,54).Dengandemikiansperma
dapathiduplebihlamadandapatmelanjutkanperjalanan
menujutubauterinadanmelakukanpembuahan.
ETIOLOGIDANFAKTORRESIKO
Etiologikarsinomaprostatbelumdiketahuisecarapasti,tetapi
denganepidemiologididugapenyebabterjadinyakarsinoma
prostatpadaseseorangbelumsepenuhnyajelas.Beberapafaktor
risikoitudiantaranya:
1.Faktorgenetik
Didugabilapadakeluargamisalnyaayah/kakak(firstdegree
relative)dankakek/paman(seconddegreerelative)didapat
karsinornaprostatmakaresikokeganasanprostattigakali
(Robin).
KulithitamdiAmerikaSerikatmempunyaimortalityratedua
kalidankulitputih(DouglasEJohnsons).
Tetapiapakahfaktorlingkunganmempengaruhijugafaktor
genetiksukaruntukditentukan.
2.Faktorhormonal
Aksiandrogenpadaselepithelprostat,testosteronyangbebas
masukkedalamselmenjadidehidrotestosterondenganbantuan
enzim5alphareduktase.Steroidreseptorkompleksdengan
DNAakanniengakibatkanspesifikmRNAdansintesaprotein
yangmempunyaiefekmetabolikdanproliferatif(Ronijn)

3.Faktordietdanlingkungan
Faktordietyaitudietyangbanyakmengandunglemakbinatang
danperbedaaninsidenkankerprostatpadapopulasidenganras
danlingkunganyangberbeda,sebagaicontohnyagenerasikedua
danketigaorangJepangyangbertempattinggaldiAmerika
memilikiinsidenyangsamadenganorangdiAmerikaUtara,
sedangkaninsidenkankerprostatdiJepanghanya10%dari
insidendiAmerika.
4.Faktorinfeksi
Didugabakteridanvirusdapatmempengaruhiterjadinyaca
prostat,tetapifaktorinimasihmenjadiperdebatan.
Diantarafaktorfaktorrisikotersebut,faktorrisikoherediter
(genetik)danfaktordietyangtelahterbuktisebagairisikountuk
karsinomaprostat.Bilaadasalahsatupriahubungankeluarga
segarisyangmenderitakarsinomaprostat,makakemungkinan
terkenakarsinomaprostatmenjadi2kalidanbilaada2pria
segarismenderitakarsinomaprostatmakakemungkinanterkena
karsinomaprostatmenjadi5sampai11kali.
Untukfaktorresikodiet,yaitubanyakmengandunglemak
binatang.PriaJepangjarangmenderitakarsinomaprostat,tetapi
setelahpindahkedaratanAmerikadanpolakonsumsidietnya
berubahmakainsidenkarsinomaprostatpadaimigranJepang
samadenganmasyarakatkulitputihAmerika.
GAMBARANHISTOLOGIS
Keganasanprostatbiasanyaberupaacinuskelenjarkecilyang
mengilfiltrasidalambentukirregulerdantak
beraturan.karsinomayangberasaldarikelenjarprostatyang
menjadihipertropikpadausiadekadekelimasampaitujuh.
Agaknyaprosesmenjadiganassudahmulaipadajaringan
prostatyangmasihmuda.Karsinomaprostatpalingsering(60
70%)terjadipadazonaperifer;sedangkan1020%berasalzona
transisidan510%adadizonacentral.
Derajatkeganasan(histopathologizalgrading)didasarkanpada
sistimyangdikembangkanolehGleason.Berdasarkanarsitektur
darijaringanCarsinomaProstatbukanberdasarkangambaran

selsecaraindividu.SecarahistologikCarsinomaProstat
biasanyamenunjukkan5polaarsitektur.SkordariGleason
adalahjumlahpolaarsitekturprimerdansekunderyang
dominan.Nilaiskoriniberkisar2sampai10contoh3+4=7.
ScorGleasonberkisar210iniberkorelasikuatdenganangka
survavilitaskasar,survavilitasbebastumor,survavilitasspisifik
causadanprediktorterhadapwakturekurensisetelah
prostatektomiradikal
GAMBARANKLINIK
Penderitakankerprostatgejalabervariasi,tetapiprinsipnyaada:
1. Bladeroutflowobstruktion(BOO)seperti:frekuensi,
hesistensi,pancaranlemah.
2. ekstensilokaldaritumor.
GambaranklinissesuaidenganstadiumdariCaprostat:
1.Caprostatyangmasihterlokalisr:
1. asimptomatic
2. peningkatanPSA
3. pancaranlemah
4. sensasisisaurin
5. frekunsi
6. urgensi
2.Caprostatlokallanjut
1. Hematuri
2. Disuri
3. Nyerisuprapubikdanperineal
4. Impotence

5. Incontinence
6. gejalagagalginjal
7. haemospermia.
3.Caprostatyangsudahmetastasis
1. Nyeritulangatauisialgia
2. paraplegi
3. pembesaranlimfonodi
4. anuri
5. letargi(anemia,uremia)
6. beratbadanturundancaceksia
7. perdarahanpadaususdankulit

Karsinomaprostatadalahsuatukankerganasyangtumbuhdi
dalamkelenjarprostat,tumbuhsecaraabnormaltakterkendali
sehinggamendesakdanmerusakjaringansekitarnyadan
merupakanyangterbanyakdiantarakeganasansistem
urogenitaliapadapria.Tumorinimenyerangpasienyang
berumurdiatas50tahun,diantaranya30%menyerangpria
berusia7080tahundan75%padausialebihdari80tahun.
Kankerinijarangmenyerangpriaberusiadibawah45tahun.1
Kankerprostatmerupakantumoryangpalingseringterjadipada
priadiAmerikaSerikat.Sekitar200.000kasusbarudidiagnosis
setiaptahunnya.Kankerprostatmenunjukkanmorbiditasdan
mortalitasyangsangattinggipadapopulasipriadiAmerika.
Secarakhususkankerprostatternyatalebihbanyakdideritaoleh
bangsaAfroAmerikayangberkulithitamdaripadabangsakulit
putih.Haltersebutditunjukkandenganperbandinganbahwa1
dari9padakulithitamdiAmerikaUtaraakanmenderitakanker
prostate,sedangkanpadakulitputihdiAmerikaUtarahanya1
dari11orangakanmengidapkankerprostate.Sedangkandi
Asiasendirimasihterhitungrendah.DiIndonesiadatadibagian
SubbagianUrologi,BagianbedahFKUI,selamaperiode1995
1998ditemukandatadata17kasuspertahun.Datadari13
FakultasKedokteranNegeridiIndonesiakankerprostat
termasukdalam10penyakitkeganasanterseringpadapriadan
mendudukiperingkatke2setelahkankerbulibuli(kandung
kemih).2
Kenaikaninsidenskankerprostatdapatdihubungkandengan
peningkatanusiaharapanhidup,perubahanpolamakan

khususnyakombinasilemakdanmodalitasdiagnostikyang
lebihbaik.Sejakdiperkenalkanpadaakhirtahun80an,prostate
spesifikantigen(PSA)merupakansalahsatualatbantuuntuk
diagnosiskankerprostat,dikombinasikandenganpemeriksaan
colokduburdanbiopsiprostatdenganbimbinganTransrectal
Ultrasonography(TRUS).Biopsiprostatdilakukanapabila
ditemukankecurigaankankerprostatpadapemeriksaancolok
duburyaituadanyakonsistensiprostatyangkeras,adanya
nodul,ataupembesaranprostatyangtidaksimetris.Biopsijuga
akandikerjakanbiladitemukanlesihypoechoicatauhiperechoic
padapemeriksaanTRUS.Selainitujugadikerjakanbilanilai
PSA>10ng/mlatauPSAdensity(PSAD)>0,15padapenderita
dengannilaiPSAantara410ng/mlwalaupuntidakada
kecurigaanpadapemeriksaancolokduburmaupunpemeriksaan
TRUS.
Pengobatankankerprostatbergantungpadastadiumpenyakit
denganterapiradikalbaiksecaraoperasimaupunradioterapi
diindikasikanpadapenderitadenganstadiumawal(T1bT2c,
N0,M0).Prostatektomiradikalmerupakananjuranpertama
padapenderitaberusia<70tahuntanpaadanyakomorbiditas
yangdapatmenghalangipelaksanaanoperasiataumenambah
morbiditaspaskabedah.Padapenderitaberusia>70tahunatau
menolaktindakanpembedahandianjurkanpemberian
radioterapiradikal.Sedangkanpadapenderitadenganstadium3
(T3,N0,M0)atau4(T4atauN+,atauM+)diberikanterapi
hormonalsecaraorchydectomibilateralataupemberianLHRH
agonisbesertaantiandrogen.PadapenderitaT3tanpa
penyebarankekelenjargetahbeningataumetastasis,kombinasi
radioterapidanterapihormonalselama23tahunmasihbisa
dipertimbangkanbilaharapanhidupantara510tahun.2
ANATOMI,HISTOLOGIDANFISIOLOGI
Anatomiprotatterdiriataskelenjar(50%)danjaringanikat
fibromuskular(25%myofibrilototpolosdan25%jaringanikat)
membungkusurethraparsprostatica.Mempunyaibentukseperti
pyramidterbalikdenganbasis(basisprostat)menghadapcollum
vesicaedanapex(apexprostat)yangmenghadapkearah

diapragmaurogenitale.Faciesanteriorberbentukkonveks,
faciesposterioragakkonkafdanduabuahfaciesinferolateralis.
Ukuranprostateadalahtinggi3cm,lebar4cm,danlebar
anteriorposteriorsebesar2,5cmdanberatnya20gram.
urethraberjalanverticalmenembusbagiananteriorprostat.
Faciesprostatmempunyaihubunganeratdengancollum
vesicae,kecualidibagianlateral.Celahyangterbentuk
diantaranyaterisiolehplexusvenosusvesicoprostatikusdan
ductusejakulatorius.3
Prostatmembentuktigabuahlobi,yakniduabuahlobuslateralis
dansebuahlobusmedius.Kedualobuslateralisdihubungkan
satudenganyanglaindisebelahventralurethraolehisthmus
prostataeyangtidaktampakdariluar.Lobusmedius
mempunyaiukuranyangbervariasi,terletakmenonjolkedalam
urethraparskranialispadapermukaanposteriordan
menyebabkanterbentuknyauvulavesicae.Hipertrophilobus
mediusdapatmenghalangipengeluaranurin.3
Dalamjaringanprostate,yangnampakalveolikelenjaradalah
banyaktubulusterminalkelenjartubuloalveolarbercabang,
irregulardankecilkecil.Alveoliukurannyabermacammacam,
lumenlebardanjelasirregularpadaalveoliyanglebihbesardan
epitelberbedabeda.Kelenjarterbenamdalamstroma
fibromuskularyangnyata,untaianmuscularpolosberjalan
dalamberbagaiarahbersamasamadenganseratseratkolagen
danjalajalaelastinhalus.Urethraparsprostatikanampak
sebagaibentuksusunanbulansabitdengancekungankecil
sepanjanglumen,terlebihnyatapadaresesus/lekukurethra.
Epitelumumnyaepiteltransisional,stromafibromuskular
prostatemengelilingiuretra.Kolikulusseminalissuatutaju
stromafibromuskularpadattanpakelenjar,menonjolkedalam
lumenurethra,memberikanbentukbulansabit.Utrikulus
prostatikusterletakdalammasakolikulusseringkaliujungdistal
melebar,sebelummasukkedalamurethra.Duktusejakulatorius
menembusprostate,berjalandisampingutrikulusdanakhirnya
bermuaradalamurethra.4
Kelenjarprostatemenyekresicairanencer,sepertisusuyang

mengandungionsitrat,kalsium,ionfosfat,enzimpembekudan
profibrinolisin.Selamapengisian,sampaikelenjarprostate
berkontraksisejalandengankontraksivasdeferenssehingga
cairanencersepertisusuyangdikeluarkanolehkelenjarprostate
menambahlebihbanyaklagijumlahsemen.Sifatyangsedikit
basadaricairanprostatemungkinpentinguntuksuatu
keberhasilanfertilisasiovum.5
McNealyangbanyakmenulistentanganatomiprostate
mengusulkansuatukonsepanatomizonalberdasarkandari
gambarananatomidanhistologyprostate.Dasarpembagian
zonaldariMcNealinidijadikandasaruntukmenentukanletak
danasalkeganasandariprostate.MenurutMcNealprostate
dibagimenjadiyangglandulairyaituyangberadapadadaerah
luaryangdisebutzonaperifer(periferzone)danzonasentral
yangkecil(centralzone)yangkeduanyakirakiramerupakan
95%dariseluruhkelenjar.Zonatransisional(transitionalzone)
yangterletakperiurethralsekitarverumontanumyang
merupakanhanya5%dariseluruhvolumeprostatedan
tampaknyabagianiniyangdapatmengalamihyperplasiadan
menimbulkangejalagejalapembesaranprostatejinaksedang
keganasanprostate6070%berasaldarizonaperifer,1020%
darizonatransisionaldan510%darizonasentral.6
ETIOLOGI
Penyebabyangpastibelumdiketahui,tetapiadabeberapahal
yangdapatmeningkatkanrisikoseseoranguntukterkenakanker
prostat.Faktorpredisposisitesebutantaralain:Genetic,ras,
usia,riwayatkeluarga,diettinggilemak,polusi,hormonaldan
aktivitasseksual.7
PATOGENESIS
Munculnyakankerprostatesecaralatenpadausiatuabanyak
terjadi.Sepuluhpersenpriausiaenampuluhtahunmempunyai
kankerprostatediamdantidakbergejala,pertumbuhandari
kankerprostateasimptomatisyangkebetulanditemukanlamban
sekali.Keganasanprostate90%biasanyaberupa
Adenocarsinomayangberasaldarikelenjarprostateyang

menjadihipotrofikpadausiadecadekelimasampaiketujuh.
Agaknyaprosesmenjadiganassudahmulaipadajaringan
prostateyangmasihmuda.Karsinomaprostatepalingsering
terjadipadazonaperifer(75%).8
Denganberkembangnyatumordapatterjadiperluasanlangsung
keurethra,leherkandungkemih,danvesikulaseminalis.
Karsinomaprostatedapatjugamenyebarmelaluijalurlimfatik
danhematogen.Secaraberturuttempatyangpalingseringdari
metastasismelaluijalurhematogenmelaluiv.vertebralisadalah
ketulangtulangpelvis,vertebralumbalis,femur,vertebra
torasika,dankosta.Metastasisinilebihseringosteoklastik
(menyeraptulang)daripadaosteoblastik(membentuktulang).
Padaosteokalstikjaringantulangdigantijaringantumoroleh
infiltrasidanpertumbuhantumor,sementarapadaosteoblastik,
tumornyajustrumerangsangselselpembentuktulangdi
sekitarnyauntukmembentuktulangekstrayangjelasdapat
dilihatpadafotoroentgen.9
Penyebaranlimfogendapatditemukandikelenjarlimfedi
panggulkecildanlewatsampingpembuluhdarahbesarkeatas
lewatsampingdindingperutbelakang(kelenjarlimfe
retroperitonealatas).agakjarangtumorinimenyebarkesum
sumtulangdanvisera,khususnyahatidanparu.8,9,10
Tingkatpenyebarankarsinomaprostateyanglazimdipakai
didasarkanpadasystemtingkatpenyebaranAmerican
UrologicalAssosiation(AUA)danTNM8
GAMBARANKLINIK
Karsinomaprostatestadiumdinidanlanjutmungkin
asimptomatikpadasaatdiagnosis,danlebihdari80persen
pasienmenderitapenyakitstadiumCdanDpadasaatdiagnosis.
Padaorangyangsimptomatis,keluhanyangseringditemui
adalahdisuria,kesulitanberkemih,mengedanjikaingin
berkemih,peningkatanfrekuensiberkemih,retensiurintotal,
nyeripunggungataupinggangdanhematuria.Setiaplakilaki
berusiadiatas40tahunyangmengeluhdisuria,seringberkemih
ataukesulitanberkemihtanpaobstruksiuretrhramekanisharus
dicurigaimenderitakankerprostate.Gejalalainnyaberupa:

segerasetelahberkemih,biasanyaairkemihmasihmenetes
netes
perasaantidakpuassetelahberkemih
nyeribaikketikaberkemihmaupunejakulasi
inkontinensiauri
penurunanberatbadan6,7,8,9,10,11
DIAGNOSIS
Diagnosiskankerprostateditegakkanberdasarkanpemeriksaan
fisisdanlaboratorium.Sebelummelakukanpemeriksaan
sebaiknyaditanyakanmengenairiwayatpenyakit,riwayat
penyakitkankerdalamkeluargadangejalagejalayangdialami,
khususnyayangberhubungandenganberkemih.Berdasarkan
anamnesistersebutbarulahdianjurkanpemeriksaanyangakan
dilakukansebagaimanayangakandijelaskandibawahini.
Berdasarkandariketentuandariperhimpunanahlikanker
amerika,duadaripemeriksaantersebut,yaitudigitalrectal
examination(DRE)danpemeriksaanprostateantigenspesifik
(PSA),dianjurkanuntukpasienlebihdari45tahundanmemiliki
perkiraanmasahidupkurangdari10tahun,sertausialebihdari
45tahunyangtermasukdalamresikotinggi.12
A.DigitalRectalExamination(DRE)
Karenabentukprostateberadadidepanrectum,maka
memudahkankitauntukmenyentuhprostatedengan
memasukkanjarilewatrectum.Palpasiprostatemerupakan
pemeriksaanyangmudah,murahtapiterbaikuntukmendeteksi
semuastadiumpenyakitselainstadiumA.Adapunyangdapat
dinilaidalammelakukanpemeriksaaninitonussfingtheranidan
refleksBCR,menilaiapakahadamassadalamlumenrectum
sertamenilaikeadaanprostate.DREpadapenderitakanker
prostateakanmenunjukkanadanyapembesaranprostatedengan
konsistensikeras,padat,noduler,irregular,permukaanyang
tidakrata,atauasimetris.10,11,12
B.ProstatSpesifikAntigen(PSA)test
Peningkataninsidenskankerprostatyangpesatdalamdekade
terakhirtidaklepasdaridigunakannyaPSAsebagaimodalitas
diagnostik.Walaupuntidakmerupakanpetandatumorspesifik

untukkeganasanprostat,bilanilaiPSA>4ng/ml,yaitunilai
yangdipakaisebagaibatasnormal,umumnyaakandilakukan
biopsiprostatsekalipuntidakditemukankelainanpadacolok
dubur.
Untukkeganasanprostatedikenalpetandatumoryaitufosfatase
asamprostate(prostateacidphosphatase=PAP)danantigen
khasprostate(prostatespecificantigen=PSA)yang
sensivitasnyatinggidanspesifisitasnyatidakterlalutinggi,
tetapilebihtinggidibandingkandenganPAP.8,12
Peningkatankadarantigenspesifikprostate(PSA)dalamserum
adalahpemeriksaanpalingpekauntukmendeteksikanker
prostatesecaradini.KadarPSAmungkinmeningkatpada
penyakitlocal,sedangkanpeningkatankadarfosfataseasam
biasanyamengisyaratkankelainanekstraprostate.Setelah
diagnosisdanpengobatan,penilaianresponpalingbaik
dilakukandenganmelakukanpemeriksaanberkalaPSAmaupun
fosfataseasam.9,10,12
C.TransrectalUltrasound(TRUS)
Transrectalultrasounddigunakanuntukmengetahui
pertumbuhanprostateyangtidaknormaldanmembantudalam
melakukanbiopsypadadaerahprostateyangabnormal.
Tindakaninimenggunakangelombangsuarauntukmembentuk
pencitraandariprostate.TRUSselaindapatmengukurvolume
prostate,dapatjugamendeteksikemungkinanadanyakeganasan
denganmemperlihatkandaerahhypoechoic,dandapatpula
melihatadanyabendunganvesikaseminalisyangtampak
merupakangambarankistadisebelahbawahdariprostate.6,12
D.TransabdominalUltrasound(TAUS)
ProstatedapatpuladiperiksadenganUSGtransabdominal
(TAUS),biasanyadilakukandalamkeadaanvesikaurinaria
penuh.TAUSdapatmendeteksibagianprostateyangmenonjol
kebulibuliyangdapatdipakaiuntukmeramalkanderajatbesar
obstruksi,selaintentusajadapatmendeteksiapabilaadabatu
didalamvesika.6
E.Biopsy
Padabiopsyjaringansamplediambildandiperiksadengan

bantuanmikroskopuntukmengetahuiadatidaknyaperubahan
darikanker.Hanyabiopsyyangdapatmenentukankanker
prostatedenganpasti.Sejumlahdokterbiasanyamengambil
sejumlahjaringansampleuntukdibiopsi.Namunperludiketahui
meskipunhasilbiopsynegativenamunkankerkemungkinan
tetapada.Halinimungkindikarenakanpadasaatbiopsysample
yangdiambilbukanlahjaringanyangmengalamikanker.Pada
kankerprostateyangmempunyaipembungkustumornya
memilikigradedanstagetersendiri.Gradedanstagetersebut
membantudalammenentukanjenisterapiyangakan
dilakukan.12
Scoregleasondiperuntukkanuntukkankerprostatberdasarkan
gambaranmikroskopiknya.Scoregleasonsangatpentingkarena
scoregleasonyangtinggiberhubungandenganprognosisyang
buruk.Halinidisebabkanscoregleasonyangtinggi
memberikangambarankankeryangpertumbuhannyacepat.
Untukmenerapkanscoregleasonperludilakukanbiopsy.Biopsi
dilakukandengancaraprostatectomyataudengancara
memasukkandenganneedlekedalamkelenjarprostatmelalui
rectum.
Scoregleasonberkisarantara2sampai10.scoregleasondengan
nilai2menandakanprognosisyangbaiksedangkannilai10
menandakannilai10.Scoreakhirmerupakankombinasidari2
penilaianyangberbedadenganrange1sampai5.Scoregleason
berhubungandenganbeberapagambaranberikutini:
Grade1.kankerprostatyangmenyerupaijaringanprostat
normal.Kelenjarnyakecil,bentuknyabaikdanterbungkusrapat.
Grade2.jaringanmasihmempunyaikelenjar0kelenjaryang
bentuknyabaik,tapilebihbesardanmemilikilebihbanyak
jaringandiantaranya.
Grade3.jaringanmasihmemilikikelenjaryangmasihdapat
dikenali,tapiselnyalebihgelap.padapembesaranyanglebih
tinggi,beberapadariselselinimeninggalkankelenjardan
mulaimenginvasijaringansekitarnya.
Grade4.jaringanhanyamenyisakansedikitkelenjaryangmasih
dapatdikenali.Selsudahlebihbanyakmenginvasijaringan

disekitarnya.
Grade5.jaringansudahtidakmemilikikelenjaryangdapat
dikenali.Hanyaterdapatlembaranlembaranseldisepanjang
jaringanyangberadadisekelilingnya.
Dilakukanpemeriksaanpatologiterhadapspesimenbiopsidan
berusahamemberikanpenilaianterhadapduabentukyang
palingberbeda.Hasilscoringtersebutdijumlahkanuntuk
mendapatkannilaiakhiruntukscoregleason.Contoh;spesimen
prostatyangdibiopsimemperlihatkanduabentukyangberbeda
salahsatunyadiberiangka2danyanglainnyadiberiangka3.
makahasilakhirdariscoregelasonadalah5.
Scoregleasonbergunadalammenegakkanprognosisdari
kankerprostat.Biladigunakandenganparameterlain,score
gleasonmembantudalammenentukanstagingkankerprostat
yangmanasecaratidaklangsungakanmemberikangambaran
prognosisdarikankerprostatitusendiridanbermamfaatdalam
penentuanterapiyangakandilakukan.13
PENATALAKSANAANDANTERAPI
I.Surveilance(observasi)
Surveilanceditujukanuntukobservasidanpengawasansecara
teraturtanpaterapiinmasif.Surveilancebiasadigunakanpada
stadiumawalkankerprostatedenganpertumbuhanyanglambat
yangbiasadidapatkanpadausialanjut.Tindakaninijuga
dilakukanpadapasienyangberisikoterhadapterapibedahradio
terapimaupunterapihormonal.Terapilaindapatmulai
diberikanapabilasudahtumbuhgejalaataujikaterdapattanda
tandapertumbuhankanker(misalnya:PSAyangmeningkat
cepat,ScoreGleasonyangtinggipadabiopsydanlainlain).
Sebagianbesarpasienyangmendapattindakansurveilance
biasanyamenunjukkantandatandapertumbuhandaritumor,
danterapibiasanyadilakukan3tahunkemudian.Meskipun
tindakansurveilanceyangdilakukandapatmencegahresiko
pembedahandanradiasi,namunresikodarimetastasisdapat
meningkat.Padapasienusiamudatindakansurveilancetidak
ditujukanuntukmencegahdilakukannyaterapisecara
bersamaan,tapibisamenjadisalahsatualasanuntukhaltersebut

beberapatahunkemudian,selamapengaruhterapiterhadap
kualitashidupdapatdicegah.Masalahmasalahkesehatanyang
berkembangseiringdenganberkembangusiaselamamasa
observasijugamenyulitkanuntukdilakukannyapembedahan
danradioterapi.14
II.TerapiHormonal
Terapihormonalmenggunakanpengobatanataupembedahan
untukmenghambatasupanDihidrotestosterone(DHT)padasel
kankerprostate,DHTadalahsuatuhormonyangdihasilkandi
prostatdandibutuhkanuntukpertumbuhandanmetastasissel
kankerprostate.14
PenghambatanDHTdapatmenghentikanpertumbuhankanker
prostatbahkanmenghambatmetastasisnya.Namun,terapi
hormonjarangmenyembuhkankankerprostatkarenakanker
yangberesponterhadapterapihormonalbiasanyamenjadi
resisten1sampai2tahunberikutnya.Selhormonalbiasa
diberikanpadakankerprostatyangsudahmendapatterapi
pembedahanatauradioterapiuntukmencegahtimbulnya
rekurensi.14,15
Tujuandariterapihormonaladalahmenurunkankadar
testosteronatauuntukmenghentikankerjatestosteron.Kanker
prostatedistimulasiolehtestosterondanhormonhormonpria
lainnya(androgen).PertamatamakadarDHTyangrendah
dalamdarahmenstimulasihipotalamusuntukmenghasilkan
GnRH.GnRHkemudianmenstimulikelenjarhipofiseuntuk
menghasilkanLH,yangselanjutnyaLHmenstimulitestisuntuk
menghasilkantestosteron.Padaakhirnyatestosterondaritestis
dandihidroepiandrosterondarikelenjaradrenalakan
menstimuliprostatuntukmenghasilkanDHT.Terapihormonal
dapatmenurunkankadarDHTdengancaramengganggutelur
pembentukkantersebutdiatas.14,15
Berikutinibeberapabentukdariterapihormonal.
Orchiektomyadalahsuatupembedahanyangbertujuan
mengangkattestis.Karenatestisyangdihasilkantestosterone,
makaapabilatestisdiangkatmakastimulasihormonalterhadap
tumorakanterhenti.

MenggunakanAgonisdariLHRH,sepertileuprolide(lupron,
viaduneligart),Gossereline(zoladex)atauBusereline(supra
Fact),untukmenghentikanproduksitestosterone.
AntiAndrogenyangbiasadigunakanadalahflutamide
(eulexine)bisalutamide(casodex),nilutamidedanasetat
siproteron,yangmenghambatkerjatestosteronedanDHTpada
pasienkankerprosta.
Obatlainyangdigunakanuntukmenghambatproduksi
androgenpadakelenjaradrenaladalahDHEAyang
mengandungketokenazoldanaminoglutethimide.Karena
kelenjaradrenalhanyamembentuk5%dariandrogenseluruh
tubuh,makapengobataniniumumnyadikombinasikandengan
pengobatanlainyangdapatmenghambat95%dariproduksi
androgenditestis.CarakombinasiinibiasadisebutTAB(Total
AndrogenBlock)
Estrogendalambentukdietilstilbesfron,dapatjugadigunakan
untukmenekanpembentukkantestosteron.Namunestrogen
jarangdigunakankarenaefeksampingnyayangkuat.Efek
sampingadricarapengobataniniberbedabeda.
OrchiektomydanAgonisLHRHdapatmenimbulkan
impotensi,rasapanas,danhilangnyakeinginanuntuk
berhubunganseks.Antiandrogendapatmenyebabkan
timbulnyamual,muntah,diare,danpembesaranpayudara.
Beberapadiantaracarapengobatantersebutdapatmenyebabkan
kelemahantulang(medicine).14,15,16
III.TerapiRadiasi
RadioterapiuntukkankerprostateterdiridariterapiExternal
BeamradiasidanBrachyterapi.
a.TerapiExternalBeamRadiasi
TerapiExternalBeamradiasikhususnyamenggunakan
ekselerationlinearberenergitinggimenghasilkankelangsungan
hidupyanglebihlamapadapasiendenganpenyakitlocal.Suatu
tehnikyangbiasadisebutdenganIMRT(IntensityModulated
RadiationTherapy)dapatdigunakanuntukmenunjangExternal
Beamradiasiyangdisesuaikandenganukurantumor,diberikan
dengandosistinggipadaprostatedanvesikulaseminalisdengan

sedikitmerusakkandungkemihdanrectum.Radioterapiini
biasanyadiberiukanselama67minggu,5haridalamseminggu.
Dosisdapatditingkatkandenganmenggunakansuatucara
tertentu,tetapiefeknyaterhadapangkakelangsunganhidup
tidakdiketahui.Untukpasiendenganpenyakitpenyakitlocal
(T3T4)tambahangocerelin(zoladex)agonisLhRH
menunjukkanadanyapeningkatansebagaimanaratarataangka
kelangsunganhidupyangada.Keuntungandariradioterapi
jenisiniadalahmudahpelaksanaannyadanmasihtergolong
aman.Kerugiannyaadalahmemilikiresikomenimbulkan
rekurensimaupunpertumbuhanlocal,biayadanresiko
timbulnyakomplikasi.Komplikasiumumnyadisebabkanoleh
radiasiyangmengenaijaringanyangnormalsepertikandung
kemih.Disampingituefeksampinglainnyaadalahimpotensi,
inkontinensia,cystitisdanprostitis.14,15,17
b.Brachyterapi
BrachyterapiuntukkankerprostatmenggunakanSeedsyaitu
suatulempengradioaktifyangkecilyangmengandungbahan
radioaktif(sepertiiodin125atauPaladium103)yang
ditanamkanpadatumordenganbantuantransrectalultrasound
(TRUS).JikaSeedsyangditanamkantaditelahmencapai
dosishomogenterhadapprostatmakamemungkinkan
dilakukannyaradiotherapi.Keuntungandaricararadiotherapi
iniadalahmudahdalampenempatannyadanmemilikimasa
terapiyangsingkat.Kerugiannyamemilikibiayayangbesar,
menimbulkanimpotensi,rekurensi,inkontinensia(umumnya
padapasienyangtelahmenjalanireseksiprostat)danpergeseran
ataumigrasikekandungkemihatausirkulasi,contohnyakeparu
paru.
Radioterapiumumnyadiberikanpadakankerstadiumdinidan
biasanyajugapadastadiumlanjutuntukmencegahmetastasis
ketulang,radioterapidapatdikombinasikandenganterapi
hormonpadapenyakitdenganresikosedang,dimanaradioterapi
sajatidakcukupuntukmengatasikankeritu.Beberapaahli
onkologimengkombinasikanexternalbeamradiasidanbrachy
terapiuntukkelompokresikosedangsampaitinggi.Padasalah

satupenelitianditemukanbahwakombinasiterapisupresi
androgenyangdikombinasikandenganexternalbeamradiasi
selama6bulandapatmemperbaikiangkakelangsunganhidup
pasienjikadibandingkandenganradioterapisajapadapasien
kankerprostatyangterlokalisir.Dapatpuladigunakan
kombinasidariexternalbeamradiasi,brachyterapidanterapi
hormon.Umumnyaradioterapidiberikanapabilakankersudah
sampaimenekanmedulaspinalisataukadangkalasetelah
dilakukanpembedahansepertipadakankeryangditemukandi
vesikulasemilunaris,limfonodus,diluarkapsulprostatatau
daerahyangdibiopsi.Radioterapibiasadibeikanpadapasien
yangmemilikikendalamedissehinggasusahuntukdilakukan
pembedahan.Radioterapijugaterbuktilebihbaikdalam
mengobatikankerangkeciljikadibandingkandengan
pembedahan.14,15,17
IV.Operatif
Tehnikoperatifuntukpenanganankankerprostatterdiriatasdua
cara:
1.Prostatectomyradikal
prostatectomyradikaladalahsuatutehnikpembedahandengan
caramengangkatseluruhprostat.Carainidiindikasikanuntuk
kankeryanghanyamengenaiprostatdantidakmenginvasi
kapsulaprostat,limfonodusdanorganlaindisekitarnya.
Terdapattigacarapelaksanaanradicalprostatectomyyaitu
radicalretropubikprostatectomydengancaramelakukaninsisi
abdomen.Sedangkanyangkeduayaituradikalperineal
prostatectomy,denganmelakukanprostatectomyyaitu:prostate
yangterkena,vesikulaseminalisdanampuladarivasdeferens
diangkatseluruhnya,sedangkankandungkemihdibiarkantetap
berhubungandenganmembraneurethrauntukmembiarkan
terjadinyaberkemih.Danyangketigacararadikalsuprapubik
prostatectomy.Prostatectomyradikaldapatdikombinasikan
denganradioterapipadakankerprostateyangletaknyahanya
padadaerahprostate.Haliniakanmemberikanhasilyangbaik
karenakankerbelumbermetastasis.Komplikasidaricaraini
antaralaininkontinensiaurinedanimpotensi.14,15,16,17

Radikalretropubikprostatectomy18
Lakukaninsisidibagianmidlinebawah,kemudianlakukan
limfadenectomypelvikbilateralekstraperitoneal.Keluarkan
lemakretropubikdancautercabangsuperfisialdarivena
dorsalispenis.Lakukaninsisitumpulpadafasciaendopelvic.
Angkatsemuaseratototyangtersisa(levatorani,
pubococcygeusdanpuborectalis)kebagianlateraldariprostat
sampaifasciaprostatdanvenadorsalisterlihat.Lakukanjahitan
menggunakanbenangvicryl2,0dibagianvenadorsalisdan
anteriordariurethra.Buatjahitankontroldenganbenangvicryl
2,0sebanyak8jahitandibagianproksimaldarivenadorsalis.
Pisahkanvenadorsalismenggunakanelektrocauter,buatdefek
padafasciatersebut.LakukaninsisiVpadatepifasciaprostat,
secaradistaldanproksimal.
BuatlahsebuahmanuvermenggunakanguntingSatinsky,
lakukaninsisipadaneurovaskulerkearahurethradankandung
kemih.Padakeadaaninifasciaprostatbagianlateralyangberisi
neurovaskulerdiimmobilisasikearahposterior.Tempatkanjari
telunjuktangankiridiantaraimmobilisasifasciaprostatdan
kapsulprostattepatdibagianpostriordariprostat.Manuverini
bertujuanuntukmemisahkanfasciadenonvilieradherenanterior
daribagianposteriorprostat.Selanjutkanpindahkanujungjari
kirikearahkanandariapicalprostatsampaikearahfascia
prostatdibagianyangkontralateraltepatdiatasneovaskuler
kanan.Ujungjarikiriakanmenembusprostatlateralkanan
denganmembentuksudutsikusikuterhadappengapit
Pengapitneurovaskulerkanandikeluarkandariprostatsecara
kranialdanposterior.Pisahkanurethrayangmembranius
menggunakanelektrocauter.Biarkanelektrocautertersebut
sampaimancapai45derajatuntukmencapaipuncaktersebut.
Dalamhaliniseratseratsisayangmasihsehatdariurethra
eksternalrabdospinkteryangmembungkusbagiananteriordari
apeksprostatselanjutnyadibagidandiberikanpadaurethra.
Setelahurethradipisahlakukanimmobilisasiprostatdan
lakukanligasivaskulerlateralmenggunakanhemoklips.
Pisahkanbagiananteriordarifasciadenonvilierdanampulla

vasdeferens.Diseksiampullavasdeferenskemedialdanlakukan
mobilisasikearahdistal.Lakukandiseksitajamdanmobilisasi
vesikelvesikelyangkemungkinanbisaberkembang.Lakukan
diseksipadadaerahnerovaskulerdanpleksuspelvikpada
daerahlateraldarivesikeluntukmencegahterjadinya
kemungkinankemungkinanyangtidakdiinginkan.
Lakukanretraksivesikeldanampullavasdeferenssertalakukan
diseksiuntukmembebaskannyadarikandungkemih
menggunakanelektrocauter.Diseksidilakukandariujungfascia
viceraliskandungkemihyangtegaklurusdenganfascia
denonfilierposterior.
Angkatseratseratsirkulerdarikandungkemihdankeluarkan
spesimenspesimenyangterdapatdidalamnya.Lakukanhalitu
denganhatihatisehinggatidakperludilakukanekstensileher
kandungkemih.Lakukanjahitanmenggunakanmonocryl3,0
untukmemperbaikileherkandungkemih.Mulaijahitanpada
arahjamtujuhdanlakukansampaimukosakandungkemih
menyatuhdenganfasciaparietal
Akhirijahitanpadaarahjam5danlakukanjahitanpadadaerah
fasciaviceraliskandungkemihtepatpadaarahjam5danjam7.
lakukananastomosevesikourethraldireckmenggunakan6
jahitan(menggunakanmonocryl2,0).
Radikalperinealprostatectomy19
Pasiendiposisikanpadaposisilitotomiposisitinggi.Bantal
LioyAllenataupijakanyellowfindigunakanuntukmenopang
keduakaki.Suatugelsetebal6inci(misalnyajellyguling)
ditempatkandibawahsakrum.Diperlukanpenanganankhusus
agarkeduakakitertopangdenganbaikdanmencegahagar
pinggultidakbergerak.Adanyatambahantekananpadasaat
melakukanposisitersebutakanmenimbulkanneuropraxia
sciaticataumemperlancarsirkulasikeekstremitasbawahdan
abdomenbagianbawah.Rhabdomyolisisdapatterjadinamun
jarangditemukandanbiasanyaberhubungandenganwaktu
operasiyanglamadankesalahandalammemposisikanpasien.
ResectiontransurethralOConnorSullivanditempatkanpada
rectumdenganbantuanjariuntukmemudahkanmelakukan

palpasiprostatdandindingrectumselamaoperasi.Suatutraktor
Lowsleyditempatkansepanjangurethrasampaikekandung
kemih,dansyapnyadibukauntukmemudahkandalam
memindahkanprostatkelapanganoperasi.
BuatinsisiUdenganapexdimidperineumsedangkanujung
anteriornyaberadadigarismidline1cmdimedialdaritubersitas
ischiadikum.Klemalisdigunakanuntukmengamankanreseksi
transurethralpadakulit.
Penulismenyatakanbahwapendekatanextraspinkteryoung
berlawanandenganpendekatansubspinnkterBelt.Fossa
ischiorectalisdiperlebarpadasalahsatusisidaritendonsentral
dantendonsentraldipisahkandenganmenggunakancauter.
Diseksidilanjutkansampaikejaringanfibrosaposteriorbahkan
sampaikeraphebulbospongiosum.Apabilajaringanfibrosa
dibukamakaakantampakrectrourehtralisdibagianmidlinedan
m.Levatoranidibagianlateral.Rectrourethralisdibukauntuk
mengamankanrectum.Angkatjaringanfibrousmenggunakan
forcepsuntukmelihatrectrourethralisdanrectum,rectum
diangkatsampaimendekatiurethratetapdibagianapexdari
prostat.Apabilarectumdimobilisasikebagianposteriordari
apexprostat,guntingdenganberlawanandariapexsampai
mendapatapponeurosis(fascia)Denonvillienyangberwarna
putih.TractorLowsleydigunakanuntukmenarikprostatkearah
perineumdanmembantudalamidentifikasiapexprostat.
Apabilaretrourethralistelahterbukasempurna,rectumakan
mendorongapponeurosisDenonvillierkearahposteriorsampai
kedalamluka,tepatdiproksimalvesikasemilunalis.Jari
dimasukkankedalamsampailevatormuskularisaniuntuk
membersihkanjaringanlemakperiprostat.Padakasuskasus
eksisibesarmonuverdilakukanuntukmenentukanbatas
maksimaldarijaringanekstraprostatyangerupakanbatas
operasiyangbersih.Padakasuspembukaansarafdibuatsuatu
bidangdibagianmedialdariseratlevator,lateraldarifascia
pelviklateralisjaringanpenunjangdibagianposterolateralrostat
disatukandengannervuscavernosum.Pembukaanfasciadan

jaringanpenunjangyangtipistersebutdilakukandaridaerah
anterolateralrektum.
Untuktujuantersebutbiasanyadigunakanretraktorperineal
TompsonatauBukwalter.Suaturetraktortajamsebesar2inci
ditempatkandirektumdan2pisaubersudutgandaditempatkan
dibagiananterolateral.kriteiatentangpembukaansarafberbeda
bedadiantarasetiapahlibedah,namunpasiendenganvolume
yangrendahkankernyayangtidakterpalpasidanscoregleason
kurangdariatausamadengan6biasanyamendapatpembukaan
saraf.Pembukaansarafdibagianunilateraldilakukanapabila
sarafsarafdibagiankontralateralmendapatmetastasedari
kanker.ApponeorosisDenonvillierdiinsisisecaratransversal
daribagianmedialsalahsatuvesikasemilunarissampaikebatas
medialvesikasemilunarislainnya.Pengguntungandilakukan
didaerahinisampaiampulladanvesikasemilunalisterlihat.
Salahsatuvasdeferensdidiseksidandiangkatkirakira5am
dariprostatdankemudiandilektkandenganmenggunakan
bantuanalatligasur.Vasdeferenslainnyamendapatperlakuan
yangsama.Vesikasemilunalisdiangkatmenggunakanforceps
danditarikkearahmedial.ApponeurosisDenonvillerdigunting
kearahlateraluntukmelihatbagianlateral.Pengguntingan
dilakukandibagianlateraldarivesikasemilunarissampai
mencapaipembuluhdarahdibagiantersebut.Pembuluh
pembuluhdarahtersebutdisatukanmenggunakanligasur.Leher
posteriorkandungkemihdidorongkearahbasisprostat
menggunakandisectorKuthnner.
Padakasuspembukaansaraf,appneorosisDenonvillierdiinsisi
darilateralkemidline,tepatdiatasmedialvesikasemilunaris
yangipsilateralkedaerahmidlinediatasdariapex,dankembali
lagikedaerahmedialdarivesikasemilunarisyangkontralateral
(berbentukUterbalik).Denganmenggunakanseksitajamfascia
dannervuscavernosumdimobilisasikearahlateraldaribagian
lateralprostat.Dibentukruanganantaraprostatdenganlapisan
apponeurosisDenonvillieryangmemilikinervuscavernosum.
Daerahtersebutdibentuksekitarbagianlateraldariprostatmulai
dariapexsampaivesikasemilunaris.Percabangandarinervus

yangmasukkeprostatdibagianapexdanbasisdipisahkanuntuk
mencegahterjadinyatraumadibagantersebut.Nervus
cavernosumdimobilisasikedaerahlateralmenjauhibasis
prostat,meninggalkanpediculusvaskulerdanbasisprostat.
Pediculusvaskulerdanbasisprostatdisatukandenganligasur,
untukmencegahterjadinyatraksitrauma.Cari
prostatovesikularisdanpisahkandaridaerahposteriordibagian
lateraldananteriordariligamentumpuboprostaticum.
Penangananinibertujuanmenceghterjadinyatraumapadasaraf
ketikaberlangsungpengangkatanprostat.Dibagianapex
persarafandipisahkandariurethra.Urethrakemudiandidiseksi
secarasirkumferentialdarijaringanapexprostatmenggunakan
disektorkuthnersampaikeprostat,naiksampaike
verumontanum.Tindakaninidilanjutkandenganmembagi
ligamentumpuboprostatikum.Padatindakantanpamembuka
persarafan,seluruhjaringanperiprostaticumdiangkatdari
prostatbertujuanuntukmenentukandaerahreseksitumor.
ApponeurosisDenonvillierdanfasciaendopelviktidak
diangkat,tetapberadadibagianposteriordanlateralprostat.
Pediculusprostatdisatukandenganligasur.Perhatikanpadasaat
mengembalikanapexprostat.Muskulusskeletalberadadidekat
apexprostatdipisahkanagartidakbersentuhandenganurethra
bagiandistalsampaikeapex.Selanjtnyalantaiototpelvik
dipisahkandarilantaipelvikkirakira12cmjaraknyadan
diletakkandiatasapexprostatuntukmemastikandaerah
disekitarapexsudahcukupadekuat.Penangananinibertujuan
untukmencegahbagianposteriorprostatbergerakkearahapex
dariprotat.
Urethradipisahkandariprostatsecarasirkumferential
menggunkandisektorkuthnerdiantaraurethradanapexprostat.
Pediculusapicaldipisahkanmenggunakankauter,traktor
lowsleydiangkat,dantambahnurethradidiseksidariapex
sampaikeverummontanum.Urethraselanjutnyadipotong.
Ligamentumpuboprostatikumdipisahkanmenggunakankauter
beberapamilimeterkearahanteriordaribagiananteriorprostat.
Klemringditempatkanpadajaringananterior,dengansalahsatu

ringnyamasukkeurethrauntukmencegahtimbulnyatraksi
prostatkearahbawahyangdapatmenyentuhbagiananteriordari
leherkandungkemih.Bagiananteriordipisahkandengan
menggunakankauter.Apabilaterjadiperdarahanvenayang
berasaldarivenadorsalismakadilakukanligasidengan
menggunakanbenangabsorben.
Padatraksiprostatdaerahdiseksiantaraleherkandungkemih
danbasisprostatdibuka,terlihaturethramasuksampaikebasis
prostat.Urethraselanjutnyadikeluakandaribasisprostatdan
dipotong,sisakankirakira1cmbagianurethryangmelekat
denganleherkandungkemih.
Daerahoperasidiirigasi,danlakukankontrolperdarahan
sebelummelakukananastomose.Ujungurethradianastomose
dengan2benangmonocryl3,0ditempatkandidaerahmidline
anteriorsampaikedaerahposterior,kemudiandiikatdengan
tidakterlalukencanguntukmencegahmenurunnyadiameter
anastomose.Apabiladaerahurethrasudahcukupadekuat
lakukanurethrostomysehinggaurethratidakberanastomose
denganleherkandungkemih.Apabilaanastomosesudah
sempurna,diinjeksidengancairansalinsecarategaklurusdari
arahmeatusdankemudiananastomosedikencangkandengan
jahitantambahan.Kateterukuran18Fditempatkanpada
kandungkemihdankemudiankandungkemihdiirigasiuntuk
mengeluarkansisasisabekuanyangadadidalamnya.Pada
ResectionprostattransUrethral,denganpembesarankelenjar
ataukankerdidekatleherkandungkemihmakaleherkandung
kemihtidakperludiikat.Padakeadaaninikandungkemih
masukkebagiananteriorsetelahligamentumpuboprostatikum
dipotong.Leherkandungkemihdipisahkandariprostatuntuk
membuatjarakyangamandariorifisiumurethra.Leherkandung
kemihselanjutnyadijahitdengankateter18Ftapitidaksampai
urothelium.Anastomoseterhadapurotheliumdilakukanpada
jahitananastomoseyanglain.
Retraktordiangkatdanrectumdiinspeksiuntukmelihatada
tidaknyatraumaatauadanyadaerahyangmenipis,bilaada
dilakukanpenangananmuskuluslevatoranidikembalikan

keposisimidlinemenggunakandraineJacksonPrattatau
Penroseyangditempatkandirektum.Tendonsentral
dikembalikandiposisinya,jaringansubkutanditutupdan
kemudiankulitditutupmenggunakanjahitansubkutikulerpada
sisikiridankanan.SelanjutnyaBelladonamaupunobat
supposutoriadapatdiberikanmelaluirectumuntukmengurangi
spasmepascaoperasi.Kateterdibiarkantapitidakmenekan
daerahbawahabdomendanpasienberadadalammasa
pemulihan.
Radikalsuprapubikprostatectomy20
A.pasiendiletakkandiatasmejaoperasipadaposisisupine,
dibawahpengaruhgravitasi,larutansulfatneomycin0,1%
dimasukkansampaimencapaikapasitaskandungkemih,Kateter
kemudiandilepas.Suatulembarankertas/tissuediletakkan
dibawahpingganguntukmenopangpelpisdanmemberikan
paparanterhadapleherkandungkemihdanprostat.Vasektomy
bilateraltidakselaludilakukan.Identifikasiorifisiumurethra
dapatdenganmudahdilakukandenganbantuaninjeksisatu
ampulindigocarminesecaraintravena.
B.Insisimidlineabdomensecaravertikaljarangdilakukan
dibandinginsisisecaratransversal.Insisiinidilakukanuntuk
mendapatkanpaparanyangtepatdanmemudahkanpadasaat
pembukaandanpenutupandaerahyangdiinsisi.Dapatterjadi
infeksiluka,insisivertikaldilakukanpadadaerahjaringanyang
tipis,dibandinginsisitransversadanmenyulitkanpenyebaran
infeksikedindingabdomen.
Insisikulitdilakukandaridaerahumbilikussampaikepubis.
Perdarahansubkutanterkoogulasidenganalatelektrosurgical.
GuntingCurvedMayodigunakanuntukmembagifasciarektus
disepanjangdaerahinsisi.Daerahdiantaraototrektusdibuka
menggunakanhemostatdandaerahtersebutdiangkatdaripubis
sampaikeumbilikus.Dibawahpermukaansetiapototrektus
harusdimobilisasiuntukmendapatkanretraksilateraldariotot
otottersebut.Dengantujuanuntukmencegahterjadinya
perdarahan,satusampaitigapembuluhdarahkecildimasukkan
kepermukaanposteriordanmedialdariototrektusyang

selanjutnyadikautersebelumdimasukkanretraktorBaltour.
RetraktorBaltourdigunakanuntukmemegangototrektus
lateralis.Fasciaprevesikalisdiinsisitepatdibelakangpubis,
lemakperivesikeldanperitoneumdibersihkanmenggunakan
kapassterilsampaimencapaidindinganteriorkandungkemih.
A.LukadibuatdiantarakeduaklemAllisuntukmembuka
kandungkemih.menjahitdindingkandungkemihpadasetiap
daerahyangmendapatcystotomyLarutanneomycin0,1%
dikeluarkanmenggunakansection,dandilakukancystotomy
tumpuluntukmenopangleherkandungkemih.Cistotomydibuat
sepanjangmungkinagartidakmengganggupandanganahli
bedahterhadaptrigonumdanvesika.Tidakadakeuntungan
padacystotomiyangkecilkarenahanyaakanmenghasilkan
lapanganpandangyangtidakmemadai.
B.Paparaninteriorkandungkemihdipertahankandengansampai
kefasciarektuslateralismenggunakanbenangcromic2.0.
laparatomidiletakkanpadaronggakandungkemih,dinding
posteriorkandungkemihditarikkeatasmenggunakanretraktor
Deaver.Ahlibedahharusmendapatpaparantrigonumdanleher
vesikayangtepat.Setelahletakorifisiumurethratelah
ditentukn,insisimukosabentuktapalkudadibuatdisekitar
daerahlateraldanposteriordarileherkandungkemih.Jikainsisi
dimulaidarilobusmediadannaiksampaikelobuslateral,
pandanganahlibedahtidakakanterhalangiolehperdarahandari
insisimukosayangdilakukan.Insisitersebutdilakukanuntuk
meminimalkankemungkinantraumadidaerahorifisiumlateral
selamaoperasiberlangsung.
A.Enukleasiadenomadilakukandengancaratumpul.Retraktor
diangkatdarilukauntukmencegahsentuhandengantanganahli
bedah.Denganmnggunakanindeksjari,urethraprostatikumdan
adenomadidorongkearahanteriortepatdidaerahproksimaldari
spinkterurineeksterna.Ruangandiantaraadenomadankapsula
bedahdibuka,enukleasidilakukansecepatmungkin.Lobus
anterior,posteriordanlateralisdienukleasiuntukpertamakali,
danlobusmedianpadabagianakhir.Halinidilakukanuntuk
mengangkatsemualobussebagaisatukesatuan.

B.Perdarahanterjadisewaktuadenomadiangkat.Hemostatis
tidakdapatdimulaisampaiadenektomidilakukandengan
sempurna,selanjutnyapemanjangandaerahoperasiakan
memperbanyakkehilangandarah.Apabilaenukleasidilakukan
dengancepatmakaakanmemberikanhasilyangbaik.Perlakuan
yangtidakperlupadakapsulaprostatakanmenimbulkan
perdarahan.Adhesidiantaraadenomadankapsuladapat
dipisahkandengancaratajam.Daerahapeksprostatakan
memberatpadaakhirnya.Padakeadaaninidapatdilakukancara
tumpultapiseringkalipembagiancaratajammenggunakan
guntingsangatdibutuhkan.Halinijarangdilakukandengan
pandanganlangsung.Penanganansebaiknyadilakukandengan
caramengangkatmembranurethrakeatassampaimencapai
fossaprostat,apabilapengangkatanstrukturtersebutdapat
meningkatkanresikoinkontinensiapaskaoperasi.
Hemostatisdapatdicapaimelaluipaparanyangmemadai
didaerahoperasi,ligasipenjahitanalirandaraharteribesar
prostatdibagianposteriordarileherkandungkemih,dan
membiarkanadanyatraksisementarapadadaerahlehervesika
untukmenghantikanperdarahanvenadifossaprostatika.
Paparanpadaleherkandungkemihdanfossaprostatika
merupakanprioritasutamadalammenilaihemostatis.
Kegagalanuntukmenilaiadanyakompelvesikaolehahlibedah
adalahdenganpenempatanjahitanhemostatisatautraksiden
waktuuntukmenghentikanperdarahan.
Paparandenganmemindahkanretraktoryangtebaldikeluarkan.
Fossaprostatikaditutupidengankassagulunguntuk
menstimulasikontraksidarikapsulasurgical.Dengantujuan
untukmelipatbibirposteriordarikandungkemih.Retraktor
Deaverditempatkandidalamfossaprostatikatepatdiatasdari
balutankassagulung,dandibagianposteriorleherkandung
kemihyangdilekatkandenganklemAllis.Denganmelakukan
traksikeatasdanposteriordariklemtersebut,sisifossa
prostatikadibagianposteriordarileherkandungkemihdapat
terlihatdenganjelas.Paparantambahandilakukan
menggunaklanretraktorRibbonatauDeaverpadadaerah

dindingkandungkemihyangmerupakantempatjahitanyang
dilakukan.
Gambarjahitandelapanditempatkanpadalehervesikal
posteriordariarahjam4jam8.kesalahanyangsering
dijumpaiadalahletakjahitanyangtidakberadadidaerahlateral
yangcukupamanuntukarteriprostatyangbesar.Jahitan
sebaiknyalebihdidalamdaridaerahfossaprostatikaleher
kandungkemih.Setelahmengamankanperdarahanarteridan
venabesar,balutandikeluarkandarifossaprostatika.Meskipun
terdapatrobekanpadakapsula,tapisebaiknyatidakdilakukan
penjahitan,ligasimaupunmembekukanperdarahandidaerah
tersebut.Perdarahandaridaerahkapsulabiasanyaberasaldari
venadandapatdikendalikanmenggunakantraksijangka
pendek.Fossaprostatikasebaiknyadiinspeksiuntuk
memastikanbahwaadenomatelahdiangkat.Integritasorifisium
urethradiperbaikiuntukmenentukanbahwatidakterdapat
hubunganantarajahitanhemostatikyangditempatkandidaerah
posteriordarileherkandungkemih.
A.KateterFrenchFolleyNo.24disertaibalon30mldimasukkan
kedalamkandungkemihpasien.Kateterbalondikembangkan
sehinggatidakterjaditraksiyangdapatmenggeserkateterbalon
tersebutsampaikefossaprostatika.Biasanyajaringanseberat1
mlair/grdikeluarkanuntukmenjagaagarpengembanganbalon
tetapadekuat.Kateterbalonditarikberlawanandenganleher
vesikaluntukmenekanfossaprostatika.Traksitersebut
dipertahankanmenggunakanklemKellyyangdiletakkan
bersilangandengankateterpadasaatakandikeluarkanmelalui
meatusurethra.Drainpenrosedimasukkansepanjangdaerah
hemostatdanmenggunakansedikittahananyangterkadang
membutuhkanbantuan.Drainasesuprapubikdilakukan
menggunakankateterFrenchMallecotNo.26atau28.luka
dibuatdidasarkandungkemih,dantubesuprapubikditarik
kearahretrogradpadasaatterbuka.Jahitanmenggunakan
chromic2.0dilakukanuntukmengikattubepadatitikkeluarnya
dikandungkemih.Posisiakhirtubesebaiknyatidak

menimbulkaniritasipadadaerahtrigonumdanspasmekandung
kemih.
A.Dengantujuanuntukmenyembuhkanlukadanmengurangi
terjadionyainfeksi,kandungkemihsebaiknyaditutupyangakan
mempertahankanurinetetapberadadisalurankemih.Halini
baikdilakukanuntukmemisahkanketigalapisankandung
kemihmenggunakanbenangcromicyangbaik.Lapisanmukosa
ditutupmenggunakanjahitanbenangchromic5.0.penutupan
yangbaikpadasudutnyadapatdicapaidenganmulaijahitan5.0
padasetiapsudutcystotomi.Haliniakanmemudahkanahli
bedahmelakukankerjanyadibagiantengahdaripenutupan
mukosadanmencegahterjadinyadogearpadasetiap
sudutnya.Suatujahitandenganbenangchromic4.0dilakukan
untukmenutuplapisanotot.Ketigalapisantersebut
digabungkandenganototdanserosasertaditutupdenganjahitan
Lembertmenggunakanbenangchromic3.0untukmenutup
seluruhdaerahyangdijahit.kekuatanpenutupankandungkemih
ditentukanolehirigasituibasuprapubikmenggunakansalin
normal.Penutupandilakukandenganketatdanmengurangi
daerahyangterbukadenganmenggunakanchromic3.0secara
terputusputus.Irigasikandungkemihjugadilakukanuntuk
mengeluarkanbekuandarahyangterdapatselamapenutupan
kandungkemihjikahemostatiktidakadekuat.
B.Setelahkandungkemihditutup,lukadiinspeksiuntukmelihat
adatidaknyaperdarahanpadadindingkandungkemih,daerah
perivesikalisataupunpadaototrektus.Lukaumumnyadiirigasi
secarasteril,salinenormalyanghangat,dansulfetneomycin0,1
%.Dengantujuanagarlebihefektif,larutanneomicyn
diletakkandidaerahlukadandibiarkanselama60detik.Draine
penrosediletakkandidaerahperivesikalis.Pisahkandaerahinsisi
padasetiapinsisimidlineuntukmendapatkantempatkeluardari
tubesuprapubikdandraine.Penrosedilekatkanpadakulit
menggunakanjahitanbenangnonabsorben3.0.
Ototrektusdiikatdengan34jahitanbenangchromic3.0.
lapisantersebutditutuptidakuntukmenguatkaninsisitapiuntuk
mengeluarjkanjaringanyangmati.Jahitannonabsorban

dibutuhkanuntukmenutupfasciarektus.Haliniakan
menguatkanpenutupandandisertaidenganbahanpenjahit
(misalnyaneurolonmaupunprolene),pembentukanbatupada
lukayangsecarateoritisakanmenimbulkankomplikasi.
PenutupanmenggunakanjahitaninteruptusjenisTomJones
denganneurolone0untukmenutupfasciarektus,jahitan
subkutanditutupdengancutgutplain3.0secarainteruptus,dan
kulitdenganbenangnilon3.0secarainteruptus.
2.TransurethralResectionoftheProstate(TURP)
TURPmerupakansuatucarapembedahanpadakankerprostate
apabilaterjadisumbatanpadaurethrayangdisebabkanoleh
pembesaranprostate.TURPbiasanyadilakukanpadapenyakit
penyakityangtergolongringan.Sebagianprostatdiangkat
menggunakansuatualatyangdimasukkankedalamurethra.alat
tersebutatauyangbiasadikenalcystoscopedimasukkan
kedalampenisdanberfungsiuntukmenghilangkansumbatan
padaurethratersebut.Tindakaninibiasanyadilakukanpada
stadiumawaluntukmengangkatjaringanyangmenghambat
aliranurine.Padastadiummetastasisdimanakankertelah
menyebarseluruhprostatpenganmgkatantestis(Orchiectomy)
dilakukanuntukmenurunkankadartestosterondan
mengendalikanpertumbuhankanker.21
V.Kemoterapi
Kemoterapiadalahcarapengobatanterakhiryangdigunakan
untukmengatasikankerprostate.Kemoterapibelumdapat
meningkatkanangkakelangsunganhidup.Suatupenelitiantelah
menunjukkanbahwatindakankemoterapiyangdilakukan
bersamacarapengobatanlainnyaterbuktibelumdapat
meningkatkankelangsunganhidup.Kemoterapisangattoxicdan
memilikibanyakefeksamping.22
KOMPLIKASI
Komplikasiyangdapatditimbulkandaripemberianterapibaik
denganmenggunakanradiasimaupunpembedahanberupa:
Gangguanereksi(impotensi)
Perdarahanpostoperasi
Anastomosistrikturpadaperinealprostatectomy

Urocutaneusfistula(perinealprostatectomy)
Herniaperineal(Perinealprostatectomy).dll17,18,19,20,23
PROGNOSIS
Harapanhidupuntukpenderitakankerprostatberhubungan
denganstadiumpenyakit:
StadiumA87%,StadiumB81%,StadiumC64%,stadiumD
30%.1,22

Pengertian
Hipertropi Prostat adalah hiperplasia dari kelenjar periurethral
yang kemudian mendesak jaringan prostat yang asli ke perifer
dan menjadi simpai bedah. (Jong, Wim de, 1998).
2.

Etiologi
Banyak teori yang menjelaskan terjadinya pembesaran kelenjar
prostat, namun sampai sekarang belum ada kesepakatan
mengenai hal tersebut. Ada beberapa teori mengemukakan
mengapa kelenjar periurethral dapat mengalami hiperplasia,
yaitu :

Teori Sel Stem (Isaacs 1984)


Berdasarkan teori ini jaringan prostat pada orang dewasa berada
pada keseimbangan antara pertumbuhan sel dan sel mati,
keadaan ini disebut steady state. Pada jaringan prostat terdapat
sel stem yang dapat berproliferasi lebih cepat, sehingga terjadi
hiperplasia kelenjar periurethral.

Teori MC Neal (1978)


Menurut MC. Neal, pembesaran prostat jinak dimulai dari zona
transisi yang letaknya sebelah proksimal dari spincter eksterna
pada kedua sisi veromontatum di zona periurethral.

Teori Di Hidro Testosteron (DHT)


Testosteron adalah hormon pria yang dihasilkan oleh sel
leyding. Testosteron sebagian besar dihasilkan oleh kedua testis,
sehingga timbulnya pembesaran prostat memerlukan adanya
testis yang normal. Jumlah testosteron yang dihasilkan oleh
testis kira-kira 90 % dari seluruh produksi testosteron, sedang
yang 10 % dihasilkan oleh kelenjar adrenal.
Anatomi Dan Fisiologi
Spincter externa mengelilingi urethra di bawah vesica urinaria
pada wanita, tetapi pada laki-laki terdapat kelenjar prostat yang
berada

dibelakang

spincter

penutup

urethra.

Prostat

mengekskresikan cairannya ke dalam urethra pada saat

ejakulasi, cairan prostat ini memberi makanan kepada sperma.


Cairan ini memasuki urethra pars prostatika dari vas deferens.
Prostat dilewati oleh :
a.

Ductus ejakulatorius, terdiri dari 2 buah berasal dari vesica


seminalis bermuara ke urethra.

b.

Urethra itu sendiri, yang panjangnya 17 23 cm.


Secara otomatis besarnya prostat adalah sebagai berikut :

a.

Transversal : 1,5 inchi

b.

Vertical : 1,25 inchi

c.

Anterior Posterior : 0,75 inchi


Prostat terdiri dari 5 lobus yaitu :

a.

Dua lobus lateralis

b.

Satu lobus posterior

c.

Satu lobus anterior

d.

Satu lobus medial


Kelenjar prostat kira-kira sebesar buah kenari besar, letaknya di
bawah

kandung

kemih.

Normal beratnya prostat pada orang dewasa diperkirakan 20


gram.
3.

Patofisiologi

Biasanya ditemukan gejala dan tanda obstruksi dan iritasi.


Adanya obstruksi jalan kemih berarti penderita harus menunggu
pada permulaan miksi, miksi terputus, menetes pada akhir
miksi, pancaran miksi menjadi melemah, dan rasa belum puas
selesai miksi. Gejala iritasi disebabkan oleh hipersentivitas otot
detrusor, berarti bertambahnya frekuensi miksi, nokturia, miksi
sulit ditahan dan disuria. Gejala obstruksi terjadi karena detrusor
gagal berkontraksi dengan cukup kuat atau gagal berkontraksi
cukup lama sehingga kontraksi terputus-putus. Gejala iritasi
terjadi karena pengosongan yang tidak sempurna pada saat
miksi atau pembesaran prostat menyebabkan rangsangan pada
kandung kemih, sehingga vesica sering berkontraksi meskipun
belum penuh. Keadaan ini membuat sistem scoring untuk
menentukan beratnya keluhan klinik penderita hipertropi
prostat.
Apabila vesica menjadi dekompensasi, akan terjadi retensi
urine sehingga pada akhir miksi masih ditemukan sisa urine di
dalam kandung kemih dan timbul rasa tidak tuntas pada akhir
miksi.
Jika keadaan ini berlanjut, pada suatu saat akan terjadi
kemacetan total, sehingga penderita tidak mampu lagi miksi
karena produksi urine terus terjadi maka pada suatu saat vesika
tidak mampu lagi menahan urine, sehingga tekanan vesika terus
meningakat. Apabila tekanan vesika menjadi lebih tinggi dari

pada tekanan spincter dan obstruksi, akan terjadi Inkotinensia


Paradoks Retensi kronik menyebabkan refluks vesicoureter,
hidroureter, hidronefrosis dan gagal ginjal. Proses kerusakan
ginjal

dipercepat

bila

ada

infeksi.

Pada waktu miksi penderita harus selalu mengedan sehingga


lama kelamaan menyebabkan hernia atau haemorhoid. Karena
selalu terdapat sisa urine dapat terbentuk batu endapan di dalam
kandung kemih. Batu ini dapat menambah keluhan iritasi dan
menimbulkan hematuria. Batu tersebut dapat pula menyebabkan
cystitis dan bila terjadi refluks dapat terjadi pyelonefritis.
Ada 3 cara untuk mengukur besarnya hipertropi prostat, yaitu:
a.

Rectal grading
Recthal grading atau rectal toucher dilakukan dalam
keadaan buli-buli kosong. Sebab bila buli-buli penuh dapat
terjadi kesalahan dalam penilaian. Dengan rectal toucher
diperkirakan dengan beberapa cm prostat menonjol ke dalam
lumen dan rectum. Menonjolnya prostat dapat ditentukan dalam
grade. Pembagian grade sebagai berikut :
0 - 1 cm.: Grade 0
1 2 cm.: Grade 1
2 - 3 cm.: Grade 2
3 4 cm.: Grade 3

Lebih 4 cm.: Grade 4


Biasanya pada grade 3 dan 4 batas dari prostat tidak dapat
diraba karena benjolan masuk ke dalam cavum rectum. Dengan
menentukan rectal grading maka didapatkan kesan besar dan
beratnya prostat dan juga penting untuk menentukan macam
tindakan operasi yang akan dilakukan. Bila kecil (grade 1),
maka terapi yang baik adalah T.U.R (Trans Urethral Resection)
Bila prostat besar sekali (grade 3-4) dapat dilakukan
prostatektomy terbuka secara trans vesical.

b.

Clinical grading
Pada pengukuran ini yang menjadi patokan adalah
banyaknya sisa urine. Pengukuran ini dilakukan dengan cara,
pagi hari pasien bangun tidur disuruh kemih sampai selesai,
kemudian dimasukkan catheter ke dalam kandung kemih untuk
mengukur sisa urine.
Sisa urine 0 cc. Normal
Sisa urine 0 50 cc. Grade 1
Sisa urine 50 150 cc. Grade 2
Sisa urine >150 cc Grade 3
Sama sekali tidak bisa kemih Grade 4

c.

Intra urethra grading


Untuk melihat seberapa jauh penonjolan lobus lateral ke
dalam lumen urethra. Pengukuran ini harus dapat dilihat dengan
penendoskopy dan sudah menjadi bidang dari urology yang
spesifik.

4.

Gejala Klinik
Terbagi 4 grade yaitu :

1.

Pada grade 1 (congestic)


Mula-mula pasien berbulan atau beberapa tahun susah kemih
dan mulai mengedan.

2.

Kalau miksi merasa puas.

3.

Urine keluar menetes dan pancaran lemah.

4.

Nocturia

5.

Urine keluar malam hari lebih dari normal.

6.

Ereksi lebih lama dari normal dan libido lebih dari normal.

7.

Pada cytoscopy kelihatan hyperemia dari orificium urethra


interna. Lambat laun terjadi varices akhirnya bisa terjadi
perdarahan (blooding)

Pada grade 2 (residual)

1.

Bila miksi terasa panas.

2.

Dysuri nocturi bertambah berat.

3.

Tidak bisa buang air kecil (kemih tidak puas).

4.

Bisa terjadi infeksi karena sisa air kemih.

5.

Terjadi panas tinggi dan bisa menggigil.

6.

Nyeri pada daerah pinggang (menjalar ke ginjal).

Pada grade 3 (retensi urine)

1.

Ischuria paradosal.

2.

Incontinensia paradosal.

Pada grade 4

1.

Kandung kemih penuh.

2.

Penderita merasa kesakitan.

3.

Air kemih menetes secara periodik yang disebut over flow


incontinensia.

4.

Pada pemeriksaan fisik yaitu palpasi abdomen bawah untuk


meraba ada tumor, karena bendungan yang hebat.

5.

Dengan adanya infeksi penderita bisa menggigil dan panas


tinggi sekitar 40 410 C.

6.

Selanjutnya penderita bisa koma.

5.

Diagnostik test
Diagnosa klinik pembesaran prostat dapat ditegakkan dengan
pemeriksaan sebagai berikut :

a.

Anamnese yang baik

b.

Pemeriksaan fisik
Dapat dilakukan dengan pemeriksaan rectal toucher, dimana
pada pembesaran prostat jinak akan teraba adanya massa pada
dining depan rectum yang konsistensinya kenyal, yang kalau
belum terlalu besar masih dapat dicapai batas atasnya dengan
ujung jari, sedang apabila batas atasnya sudah tidak teraba
biasanya jaringan prostat sudah lebih dari 60 gr.

c.

Pemeriksaan sisa kemih

d.

Pemeriksaan ultra sonografi (USG)


Dapat dilakukan dari supra pubic atau transrectal (Trans Rectal
Ultra Sonografi :TRUS). Untuk keperluan klinik supra pubic
cukup untuk memperkirakan besar dan anatomi prostat,

sedangkan TRUS biasanya diperlukan untuk mendeteksi


keganasan.
e.

Pemeriksaan endoscopy
Bila pada pemeriksaan rectal toucher, tidak terlalu menonjol
tetapi gejala prostatismus sangat jelas atau untuk mengetahui
besarnya prostat yang menonjol ke dalam lumen.

f.

Pemeriksaan radiologi
Dengan pemeriksaan radiology seperti foto polos perut dan
pyelografi intra vena yang sering disebut IVP (Intra Venous
Pyelografi) dan BNO (Buich Nier Oversich). Pada pemeriksaan
lain pembesaran prostat dapat dilihat sebagai lesi defek irisan
kontras pada dasar kandung kemih dan ujung distal ureter
membelok ke atas berbentuk seperti mata kail/pancing (fisa
hook appearance).

g.

Pemeriksaan CT- Scan dan MRI


Computed Tomography Scanning (CT-Scan) dapat memberikan
gambaran adanya pembesaran prostat, sedangkan Magnetic
Resonance Imaging (MRI) dapat memberikan gambaran prostat
pada bidang transversal maupun sagital pada berbagai bidang
irisan, namun pameriksaan ini jarang dilakukan karena mahal
biayanya.

h.

Pemeriksaan sistografi

Dilakukan apabila pada anamnesis ditemukan hematuria atau


pada

pemeriksaan

urine

ditemukan

mikrohematuria.

pemeriksaan ini dapat memberi gambaran kemungkinan tumor


di dalam kandung kemih atau sumber perdarahan dari atas
apabila darah dating dari muara ureter atau batu radiolusen di
dalam vesica. Selain itu sistoscopi dapat juga memberi
keterangan mengenai besar prostat dengan mengukur panjang
urethra pars prostatica dan melihat penonjolan prostat ke dalam
urethra.
i.

Pemeriksaan lain
Secara spesifik untuk pemeriksaan pembesaran prostat jinak
belum ada, yang ada ialah pemeriksaan penanda adanya tumor
untuk karsinoma prostat yaitu pemeriksaan Prostatic Spesifik
Antigen (PSA), angka penggal PSA ialah 4 nanogram/ml.

Konsep Dasar Asuhan Keperawatan


Asuhan keperawatan pasien dengan hipertropi prostat melalui
pendekatan proses keperawatan yang terdiri dari pengkajian
keperawatan,

perencanaan

evaluasi keperawatan.
1.

Pengkajian Keperawatan

keperawatan,

pelaksanaan

dan

Pengumpulan data
Data dasar yang berhubungan dengan post operasi hipertropi
prostat. Mengelompokkan data merupakan langkah yang
dilakukan

setelah

mengadakan

pengumpulan

diperoleh sebagai berikut :


Nyeri pada daerah tindakan operasi.
Pusing.
Perubahan frekuensi berkemih.
Urgensi.
Dysuria
Flatus negatif.
Luka tindakan operasi pada daerah prostat.
Retensi, kandung kemih penuh.
Inkontinensia
Bibir kering.
Puasa.
Bising usus negatif.
Ekspresi wajah meringis.
Pemasangan catheter tetap.
Gelisah.
Informasi kurang.

data

yang

Urine berwarna kemerahan.


2.
a)

Diagnosa keperawatan
Perubahan eliminasi urine berhubungan dengan obstruksi
mekanikal

b)

Resiko terjadi kekurangan volume cairan berhubungan


dengan area bedah vaskuler

c)

Resiko infeksi berhubungan dengan prosedur invasive

d)

nyeri berhubungan dengan iritasi mukosa kandung kemih

e)

Resiko terjadi disfungsi seksual berhubungan dengan situasi


krisis

Diagnosa 1.

a.

Tujuan
Klien mengatakan tidak ada keluhan, dengan kriteria :

Catheter tetap paten pada tempatntya.

Tidak ada sumbatan aliran darah melalui catheter.

Berkemih tanpa aliran berlebihan.

Tidak terjadi retensi pada saat irigasi.

b.

Intervensi
Kaji haluaran urine dan sistem catheter/drainase, khususnya
selama irigasi kandung kemih.

c.

Rasional
Retensi dapat terjadi karena edema area bedah, bekuan darah
dan spasme kandung kemih.
Perhatikan waktu, jumlah berkemih dan ukuran aliran setelah
catheter dilepas.

Diagnosa 2

a.

Tujuan
Tidak terjadi kekurangan volume cairan

b.

Intervensi
Benamkan catheter, hindari manipulasi berlenihan

c.

.Rasional :
Penarikan/gerakan catheter dapat menyebabkan perdarahan atau
pembentukan bekuan darah.

Diagnosa 3

a.

Tujuan
Menunjukkan tidak tampak tanda-tanda infeksi

b.

Intervensi

Berikan perawatan catheter tetap secara steril


c.

Rasional

Mencegah pemasukan bakteri dan infeksi/cross infeksi

Menghindari refleks balik urine, yang dapat memasukkan


bakteri ke kandung kemih

Klien yang mengalami TUR beresiko untuk syok


bedah/septic sehubungan dengan instrumentasi

Diagnosa 4

a.

Tujuan
Mengurangi rasa nyeri

b.

Intervensi
Kaji tingkat nyeri

c.

Rasional
Mengetahui tingkat nyeri yang dirasakan klien dan
memudahkan kita dalam memberikan tindakan

Mempertahankan fungsi catheter dan sistem drainase,


menurunkan resiko distensi/spasme kandung kemih

Merileksasikan otot-otot sehingga suplay darah ke jaringan


terpenuhi/adekuat, sehingga nyeri berkurang

Diagnosa 5

a.

Tujuan
Fungsi seksual dapat dipertahankan

b.

Intervensi
Berikan informasi tentang harapan kembalinya fungsi seksual

c.

Rasional

Impotensi fisiologis : terjadi bila saraf perineal dipotong


selama prosedur bedah radikal

Saraf pleksus mengontrol aliran secara posterior ke prostat


melalui kapsul

Meningkatkan peningkatan kontrol otot kontinensia urine dan


fungsi seksual

3.

Evaluasi Keperawatan.
Asuhan keperawatan dalam bentuk perubahan prilaku pasien
merupakan focus dari evaluasi tujuan, maka hasil evaluasi
keperawatan dengan post operasi hipertropi prostat adalah
sebagai berikut :
Pola eliminasi urine dapat normal.
Kriteria hasil :

Menunjukkan prilaku untuk mengendalikan refleks kandung


kemih.

Pengosongan

kandung

kemih

tanpa

penekanan/distensi kandung kemih/retensi urine.

Terpenuhinya kebutuhan cairan.

Tanda-tanda vital normal

Nadi perifer baik/teraba.

Pengisian kapiler baik.

Membran mukosa lembab.

Haluaran urine tepat.

Mencegah terjadinya infeksi.

Berpartisipasi dalam program pengobatan.

Melakukan perubahan prilaku yang perlu.

Klien mengerti/memahami tentang penyakitnya.

Menunjukkan keterampilan pemecahan masalah.

Menyatakan pemahaman situasi individual

adanya

Gangguan prostat merupakan salah satu penyakit


yang ditakuti di kalangan pria usia lanjut. Betapa
tidak? Kelenjar prostat sering menimbulkan
masalah dalam kehidupan kaum pria. Berdasarkan
data, tidak kurang dari 70% pria usia lanjut
mengalami kanker prostat. Biasanya kanker
prostat mulai mengintai pria umur 50 tahun, dan
sepuluh tahun kemudian sering mengganas.
Menurut Rainy Umbas dari Subbagian Urologi,
Bagian Bedah FKUI/RSCM, dalam salah satu
seminar di Jakarta, angka kejadian kanker prostat
di Amerika Serikat merupakan yang sering terjadi
pada kaum pria. Sayang hingga saat ini Indonesia
belum memiliki data penderita kanker prostat
secara lengkap. Namun berdasarkan data dari 13
Fakultas kedokteran di Indonesia tahun 19881990, kanker prostat termasuk 10 penyakit
terganas yang sering menimpa kaum Adam.
Apakah hanya kanker yang sering menggangu
prostat anda? Ternyata tidak! Banyak gangguan
yang senang mendekati prostat anda. Kenali Dia
agar anda siap menangkisnya .

MENGENAL PROSTAT
Prostat adalah suatu kelenjar pada pria yang
terletak di antara tulang kemaluan dan poros usus.
Akibat rangsangan hormon testosteron yang
diproduksi testis, prostat menghasilkan cairan
semen. Prostat mengelilingi saluran kemih bagian
atas, tempat mengalirnya air seni dari kandung
kemih ke luar.
Ketika seorang pria memasuki pubertas, ukuran
prostatnya sebesar buah kenari. Ukuran ini adalah
normal dan tidak menekan saluran kemih. Pria
menjelang usia 50 tahun, sebagian besar
mengalami
pembesaran
prostat
yang
menyebabkan saluran kemih tertekan sehingga
pengeluaran air seni menjadi sulit dan lambat.
Hambatan ini membuat kandung kemih harus
bekerja lebih keras untuk mengeluarkan air seni,
mengakibatkan otot dinding kandung kemih
menebal dan ukuran kandung kemih membesar.
Bila keadaan ini tidak segera diatasi, pengeluaran
air seni tidak tuntas dan sisa air seni yang
tertinggal dapt mengakibatkan infeksi kandung
kemih yang bisa menjalar ke ginjal sehingga kerja
ginjal terganggu.

AKIBAT PEMBESARAN PROSTAT.

Pembesaran prostat mengakibatkan seringnya


buang air kecil dengan gejala pancaran air seni
melemah dan tidak tuntas. Rasa ingin buang air
kecil sering muncul. Jika dibiarkan pembesaran
prostat dapat menjepit saluran air seni yang
semakin lama bertambah buruk sehingga anda
tidak mampu lagi mengeluarkan air seni.

ANEKA MASALAH PROSTAT


Hipertrofi.
Pembesaran
kelenjar
prostat
disebut
hipertrofi..Pembesaran ini merupakan keluhan
prostat yang banyak ditemukan, disebabkan oleh
pertumbuhan, jaringan prostat ke dalam uretra
(saluran air seni ) sehingga menyempitkan rongga
uretra. Bila pertumbuhan jaringan ini bertambah
besar, uretra menjadi semakin terjepit, aliran
senipun terhambat.
Prostatitis
Peredangan prostat akibat infeksi. Peradangan ini
sering menyertai hipertrofi prostat jinak. Infeksi
prostat
juga
mengakibatkan
pembengkakan
jaringan prostat sehingga menghambat aliran air
seni. Pada prostatitis, air kencing sering bernanah,
terasa panas saat buang air kecil dan ejakulasi.
Kanker

Kanker prostat biasanya dimulai dari bagian


permukaan kelenjar prostat. Kanker prostat bisa
teraba pada saat pemeriksaan. Jaringan prostat
normal akan terasa lunak, sedangkan tumor atau
kanker ganas akan terasa lebih keras. Harus
diwaspadai bahwa kanker prostat seringkali tidak
menimbulkan sumbatan pada aliran air seni.

PEMERIKSAAN PROSTAT
Banyak pemeriksaan fisik atau laboratorium yang
harus dilakukan untuk mengetahui gambaran
lengkap kondisi prostat anda. Pemeriksaan ini
meliputi : riwayat medis, pemeriksaan fisik,
pemeriksaan laboratorium dan pemeriksaan lain
yang dapat menunjang hasil pemeriksaan.

RIWAYAT MEDIS
Biasanya dokter akan bertanya kepada anda
keluhan-keluhan yang dihadapi, penyakit lain yang
sedang anda alami, riwayat penyakit dalam
keluarga, alergi terhadap obat tertentu dan
pengobatan apa yang pernah anda jalani.
Pemeriksaan fisik.
Dokter akan melakukan pemeriksaan colok dubur
yaitu perabaan terhadap prostat melalui lubang
dubur. Perabaan ini dapat mendeteksi adanya

pembesaran atau kelainan yang terjadi pada


prostat. Menurut Rainy, pemeriksaan colok dubur
ini merupakan pemeriksaan yang mudah dan
murah dalam mendeteksi kanker prostat dengan
ketepatan sampai 21-53%.
Pemeriksaan laboratorium.
Untuk mengetahui gangguan prostat banyak
pemeriksaan laboratorium yang tersedia, di
antaranya Tes PSA ( Prostate Specific Antigen ),
tes darah dan urinalisis ( pemeriksaan air seni ).

TES PSA
Tes PSA digunakan untuk mendeteksi kadar
protein spesifik dalam darah. Tingginya kadar
protein tersebut dapat menunjukkan kemungkinan
kanker prostat. Perkumpulan kanker di Amerika
Serikat ( the American Cancer Society )
menganjurkan agar setiap pria yang berusia 50
tahun ke atas menjalani tes PSA.

TES DARAH
Tes darah juga bisa mengetahui penurunan fungsi
ginjal
yang
disebabkan
oleh
terbentuknya
kumpulan
air
seni
yang
tertahan
akibat
pembesaran prostat.

URINALISIS
Pemeriksaan air seni penting untuk mengetahui
tanda-tanda gangguan prostat. Kelainan yang
ditemukan pada air seni dapat menimbulkan
adanya infeksi di uretra atau kandungan air kemih.
Berdasarkan
hasil
yang
ditemukan
dari
pemeriksaan di atas, dokter menganjurkan untuk
menjalankan pemeriksaan seperti di bawah ini
untuk memastikan diagnosa.

IVP
( Intra Venous Pyelogram ) adalah pemeriksaan
terhadap saluran kemih dengan sinar-X, untuk
mendeteksi adanya gangguan pada sistem saluran
kemih seperti batu ginjal atau tumor kandungan
kemih.

SISTOSKOPI
adalah
pemeriksaan
pada
kandungan
kemih
dan
prostat
dengan
menggunakan alat yang dinamakan sistoskop,
untuk menditeksi penyebab sumbatan pada
kandung kemih.

ULTRASOUND ( USG ) adalah pemeriksaan


dengan menggunakan gelombang suara untuk
memperoleh gambaran tiga dimensi dari organ

yang di periksa. Efektif untuk mengetahui dan


mengukur besarnya prostat maupun tumornya.

MRI ( Magnetik Resonance Imaging ) dan CT (


Computed Tomography )
Merupakan suatu metode
akurat untuk memperoleh
prostat secara jelas.

pemeriksaan yang
gambaran jaringan

PERENCANAAN TERAPI
Setelah
dilakukan
evaluasi
terhadap
hasil
pemeriksaan, dokter akan memberikan terapi yang
sesuai. Ketika prostat dalam taraf infeksi dan
merenggang, biasanya dokter meresepkan obat
yang harus di konsumsi sedikitnya selama
seminggu.selain
itu
juga
dokter
akan
menganjurkan istirahat total ( bed rest ) dan
banyak minum. Namun jika terdapat hipertrofi
prostat jinak, pengobatan yang diberikan di
sesuaikan kondisi dan gejala yang anda alami.

PERLUKAH OPERASI?
Jika anda mengalami pembesaran prostat, sangat
sulit buang air seni terjadi pendarahan, fungsi
ginjal menurun, atau infeksi berulang di kandung
kemih, anda mungkin merupakan calon pasien

yang perlu menjalani


prostatektomi.

operasi

prostat

alias

APA ITU PROSTATEKTOMI ?


Prostatektomi
adalah
pembedahan
untuk
mengangkat
jaringan
tumor
pada
prostat.
Sebagian besar operasi ini berhasil menghilangkan
sumbatan yang memperbaiki aliran air seni.
Berdasarkan penelitian, operasi ini juga tidak
menggangu kemampuan seksual anda.

Operasi prostat ada 2 macam :

TUR ( Trans Urethmal Resection ). Sebuah alat


yang
dinamakan
resektoskop
dimasukkan
melalui saluran kencing batang penis. Melalui ini
memungkinkan dokter untuk melihat daerah
prostat dan sekitarnya, dan memotong jaringan
tumor yang menyumbat saluran kemih. Setelah
itu dilakukan pembilasan dengan air dan
jaringan tumor dikeluarkan melalui resektoskop.

Prostatektomi terbuka. Operasi ini dilakukan


dengan cara menyayat bagian perut. Operasi
semacam ini bisa mengangkat jaringan tumor
dan batu kandung kemih sekaligus. Dokter akan
mengangkat jaringan tumor melalui kandung
kemih (suprapubik), melalui dinding kelenjar
prostat ( retropubik ), atau melalui daerah

perineum, yaitu daerah di antara buah zakar dan


dubur.

Setelah operasi selesai, kateter akan dipasang


melalui batang zakar. Keteter ini berfungsi untuk
menjaga agar aliran air seni tetap lancar. Biasanya
kateter ini dipasang selama 2-4 hari (setelah
operasi TUR) atau 1 minggu ( setelah operasi
prostatektomi terbuka).

MASA PEMULIHAN
Penyembuhan setelah operasi memerlukan waktu
2-6
minggu.
Selama
masa
penyembuhan,
dianjurkan banyak minum cairan untuk menguras
isi kandung kemih. Bulan pertama setelah operasi
TUR mungkin anda akan mengalami pendarahan
akibat terkelupasnya jaringan bekas luka operasi di
dalam kandung kemih. Dengan bed rest dan
banyak minum, biasanya pendarahan akan cepat
berhenti. Apabila setelah 6 minggu masih banyak
pendarahan segeralah ke dokter.

BIO ENERGY POWER TERHADAP PROSTAT.


Pembesaran Prostat maupun hipertrofi, protatitis
dan kanker adalah penyakit yang disebabkan oleh
karena gangguan metabolisme tubuh serta

mengganasnya bakteri dalam tubuh. Bio Energy


Power bekerja dengan memperbaiki metabolisme
tubuh dan melipat gandakan kualitas antibodi
dalam membuang bakteri yang mengganas.
sehingga operasi dapat dihindarkan. seandainya
operasi masih harus tetap dilakukan maka latihan
Bio Energy Power akan lebih meningkatkan
keberhasilanoperasitersebut.

Prostatadalahkelenjareksokrinpadasistemreproduksi
binatangmenyusuijantan.Fungsiutamanyaadalahuntuk
mengeluarkandanmenyimpansejeniscairanyangmenjadidua
pertigabagiandariairmani.Prostatberbedabedadarisatu
spesieskespesieslainnyadalamhalanatomi,kimiadan
fisiologi.
Pembesaranprostatadalahgejalaumumyangdideritakaum
lelakidiatasusia50tahun.Pembesaranterjadidibagian
tengahdarikelenjarprostatyangmengelilingisalurankencing
(uretra).Pembesarankelenjarprostatyangberkelanjutandapat
mengarahketahapyanglebihseriussampaikekankerprostat.
(sumber:id.Wikipedia.org)
Bisadisimpulkanpembengkakanpadaprostatdanumumnya
dialamiolehpriausialanjutadalahkutukanparapria.:)
termasuksayamenjaditakutjikalaunantisudahusialanjut
terkenapembesaranprostatataulebihparahnyakankerprostat.
Jadi,bagaimanakitabisamencegahpembesaranprostatsejak
dini.Berikutadabeberapatipsyangsayadapatkanlewatom
Google.:D
Sumber:http://lelaki.suaramerdeka.com/index.php?id=48)
kankerprostatdapatdicegahdenganmasturbasi.Berikutkutipan
yangmenarikdariartikeltersebut:Penelitiantersebut
melibatkanlebihdari1.000priayangmengalamikanker
prostatdan1.250priasehat.Priayangseringmelakukan
ejakulasiantarausia20hingga50tahun,memiliki
kemungkinankecilmengalamikankerprostat.Bahkan,lebih
lanjutdikemukakanbahwapriayangmelakukanejakulasilebih

darilimakaliseminggu,risikonyaterkenakankerprostat
menurunhinggatigakali.
Selainmencegah,kitajugabisamenghindarikebiasaanburuk
seperti:
Gayahiduptidaknyaman,penuhtekanandanstres.
Priayangmenggemaridagingmerahdantidakmenyukai
sayursertabuah.
Perokok.
Kurangberolahraga.
Priayangpunyariwayatkeluargakankerprostat.
Penderitadiabetesmelitus.
Obesitas.Tipeberatbadanyangmenggangguprostat
adalahtipebentuktubuhmembesardibagianpinggangdengan
perutbuncitsepertiapel.Bebandiperutmenekanototorgan
seksual,sehinggamenyebabkanhilangnyakelenturanototorgan
seksual.Selainitu,depositlemakmengganggukinerjatestis.
Adagangguanjantung,misalnyakerusakanorgan,payah
jantung,ataupembesaranjantung.
Diatasadalahpotonganartikeldari:
http://www.kompas.com/read/xml/2008/01/17/17592960/bila.pr
ostat.menjadi.kanker
Untukmengetahuiapakahkitasedangmengalami
pembengkakanataukankerprostat,linkberikutmungkinbisa
menjadiacuan,karenadisiniadatestuntukmengetahuiapakah
kitamengalamipembengkakanataukankerprostat.Linknya
adalah:
http://www.konseling.net/artikel_seks/gejala_gangguan_prostat.
htm
Gejalagejalapertandakemungkinankitaterkena
pembengkakanataukankerprostat(sumber:
http://www.sinarharapan.co.id/iptek/kesehatan/2004/1203/kes4.
html),adalah:
susahbuangairkecil,
seringbuangairkeciltapitidaktuntas,
terputusputus,
terkadangtimbulrasanyeri.

Kankerprostatdikelompokkanmenjadi:
#StadiumA:benjolan/tumortidakdapatdirabapada
pemeriksaanfisik,biasanyaditemukansecaratidaksengaja
setelahpembedahanprostatkarenapenyakitlain.
#StadiumB:tumorterbataspadaprostatdanbiasanya
ditemukanpadapemeriksaanfisikatautesPSA.
#StadiumC:tumortelahmenyebarkeluardarikapsulprostat,
tetapibelumsampaimenyebarkekelenjargetahbening.
#StadiumD:kankertelahmenyebar(metastase)kekelenjar
getahbeningregionalmaupunbagiantubuhlainnya(misalnya
tulangdanparuparu).
Berikutpotonganartikelyanglainyangcukupmenarikuntuk
dibaca,sayaambildari:
http://www.indonesiaindonesia.com/f/12989kankerprostat/:
Caraterbaikuntukmenyaringkankerprostatadalahmelakukan
pemeriksaancolokduburdanpemeriksaandarah.
Colokduburpadapenderitakankerprostatakanmenunjukkan
adanyabenjolankerasyangbentuknyatidakberaturan.
Padapemeriksaandarahdilakukanpengukurankadarantigen
prostatspesifik(PSA),yangbiasanyameningkatpadapenderita
kankerprostat,tetapijugabisameningkat(tidakterlalutinggi)
padapenderitaBPH.
Jikapadapemeriksaancolokduburditemukanbenjolan,maka
dilakukanpemeriksaanUSG.
Denganmelakukanrontgenatauskeningtulang,bisadiketahui
adanyapenyebarankankerketulang.
Pemeriksaanlainnyayangbiasadilakukan:
#Analisaairkemih
#Sitologiairkemihataucairanprostat
#Biopsiprostat.
PENGOBATAN
Pengobatanyangtepatuntukkankerprostatmasih
diperdebatkan.
Pilihanpengobatanbervariasi,tergantungkepadastadiumnya:
#Padastadiumawalbisadigunakanprostatektomi
(pengangkatanprostat)danterapipenyinaran

#Jikakankertelahmenyebar,bisadilakukanmanipulasi
hormonal(mengurangikadartestosteronmelaluiobatobatan
maupunpengangkatantestis)ataukemoterapi.
Pembedahan
1.Prostatektomiradikal(pengangkatankelenjarprostat).
SeringkalidilakukanpadakankerstadiumAdanB.
Prosedurnyalamadanbiasanyadilakukandibawahpembiusan
totalmaupunspinal.
Sebuahsayatandibuatdiperutmaupundaerahperineumdan
penderitaharusmenjalaniperawatanrumahsakitselama57
harai.
Komplikasiyangmungkinterjadiadalahimpotensiadan
inkontinensiauri.
Padapenderitayangkehidupanseksualnyamasihaktif,bisa
dilakukanpotencysparingradicalprostatectomy.
2.Orkiektomi(pengangkatantestis,pengebirian).
Pengangkatankeduatestismenyebabkanberkurangnyakadar
testosteron,tetapiprosedurinimenimbulkanefekfisikdan
psikisyangtidakdapatditolerirolehpenderita.
Orkiektomiadalahpengobatanyangefektif,tidakmemerlukan
pengobatanulang,lebihmurahdibandingkandenganobat
obatandansesudahmenjalaniorkiektomipenderitatidakperlu
menjalaniperawatanrumahsakit.
Orkiektomibiasanyadilakukanpadakankeryangtelah
menyebar.
Terapipenyinaran
Terapipenyinaranterutamadigunakanuntukmengobatikanker
stadiumA,BdanC.
Biasanyajikaresikopembedahanterlalutinggi,maka
dilakukanterapipenyinaran.
Terapipenyinaranterhadapkelenjarprostatbisadilakukan
melaluibeberapacara:
1.Terapipenyinaraneksterna,dilakukandirumahsakittanpa
perlumenjalanirawatinap.
Efeksampingnyaberupapenurunannafsumakan,kelelahan,
reaksikulit(misalnyakemerahandaniritasi),cederaatauluka

bakarpadarektum,diare,sistitis(infeksikandungkemih)dan
hematuria.
Terapipenyinaraneksternabiasanyadilakukansebanyak5
kali/mingguselama68minggu.
2.Pencangkokanbutiranyodium,emasatauiridiumradioaktif
langsungpadajaringanprostatmelaluisayatankecil.
Keuntungandaribentukterapipenyinaraniniadalahbahwa
radiasilangsungdiarahkankepadaprostatdengankerusakan
jaringandisekitarnyayanglebihsedikit.
Obatobatan
1.Manipulasihormonal.
Tujuannyaadalahmengurangikadartestosteron.
Penurunankadartestosteronseringkalisangatefektifdalam
mencegahpertumbuhandanpenyebarankanker.
Manipulasihormonalterutamadigunakanuntukmeringankan
gejalatanpamenyembuhkankankernya,yaitumisalnyapada
penderitayangkankernyatelahmenyebar.
ObatsintetisyangfungsinyamenyerupaiLHRH(luteinizing
hormonereleasinghormone),semakinbanyakdigunakanuntuk
mengobatikankerprostatstadiumlanjut.Contohnyaadalah
lupronatauzoladeks.
Obatinimenekanperangsangantestisterhadappembentukan
testosteron(halsepertiinidisebutpengebiriankimiawikarena
memilikihasilyangsamadenganpengangkatantestis).
Obatdiberikandalambentuksuntikan,biasanyasetiap3bulan
sekali.
Efeksampingnyaadalahmualdanmuntah,wajahkemerahan,
anemia,osteoporosisdanimpotensi.
Obatlainnyayangdigunakanuntukterapihormonaladalahzat
penghambatandrogen(misalnyaflutamid),yangberfungsi
mencegahmenempelnyatestosteronpadaselselprostat.
Efeksampingnyaadalahimpotensi,gangguanhati,diaredan
ginekomastia(pembesaranpayudara).
2.Kemoterapi
Kemoterapiseringkalidigunakanuntukmengatasigejala
kankerprostatyangkebalterhadappengobatanhormonal.

Biasanyadiberikanobattunggalataukombinasibeberapaobat
untukmenghancurkanselselkanker.
Obatobatanyangbisadigunakanuntukmengobatikanker
prostatadalah:
Mitoxantron
Prednisone
Paclitaxel
Dosetaxel
Estramustin
Adriamycin.
Efeksampingnyabervariasidantergantungkepadaobatyang
diberikan.
Pemantauan
Apapunjenispengobatanyangdijalaninya,penderitaakan
dipantausecaraketatmengenaiperkembanganpenyakitnya.
Pemantauannyameliputi:
#PemeriksaandarahuntukmengetahuikadarPSA(biasanya
setiap3bulan1tahun).
#Skeningdan/atauCTscantulanguntukmengetahui
penyebarankanker.
#Pemeriksaandarahlengkapuntukmemantautandatandadan
gejalaanemia.
#Pemantauantandadangejalalainnyayangmenunjukkan
perkembanganpenyakit(misalnyakelelahan,penurunanberat
badan,nyeriyangsemakinhebat,penurunanfungsiususdan
kandungkemihsertakelemahan).

ProstatespecificAntigen(PSA)
PSAmerupakanpetandatumoryangpalingseringdiperiksa
keberadaannya.Antigeninimenjadipetunjukadanyakeganasan
padaprostat.Secaranormal,PSAterdapatdalamkadarrendah
padasemuapriadewasa(N:04sng/ml,jelasLyana.
Petandainispesifikuntukjaringanprostat.Namun,PSAtidak
spesifikuntukkanker.
Sebab,kadarnyadapatmeningkat.Selainpadakanker,juga
saatadaperadanganataupembesaranprostatjinak.PSApun
bervariasimenurutrassertameningkatsejalanusia,tutur
alumnusFakultasKedokteranUniversitasIndonesiaini.
Terkaitkanker,PSAterbilangsangatsensitifuntukkanker
prostat.PeningkatanPSAeratkaitannyadenganstadiumdan
besarnyatumor.PSAjugadapatmemprediksikekambuhandan
responsterhadapobat,ujarLyanaserayamenyebutkan
kombinasipemeriksaanrectumdenganPSApatutdijalankan
untukdeteksikankerprostat.
CarcinoembryonicAntigen(CEA)

CEAmerupakanproteinyangditemukanpadabanyakjenissel.
Namun,iadapatdikaitkandengantumordanjaninyangsedang
berkembang.CEAdalamdarah,padaorangdewasa,kadarnya
kurangdari5ng/ml,paparLyana.
CEAdapatmeningkatpadaberbagaijeniskanker.Termasuk,
kankerkolon,pankreas,lambung,paru,danpayudara.Namun,
CEAjugatampaktinggipadakeadaanlain,sepertisirosis,
penyakitradangusus(inflamatoryboweldisease),penyakitparu
kronik,danpankreatitis,ucapSekretarisIIPerhimpunan
DokterSpesialisPatologiKlinikcabangJakartaini.
Perludiingat,CEAtidakdapatdipakaiuntukskrining.Sebab,
kerapterjadipositifpalsu.Namun,petandatumorinibisa
dipakaiuntukmemantauperjalananpenyakitberikutrespons
terhadapterapikankerpayudara,paru,pankreas,lambung,dan
ovarium.CEAbahkanmempunyainilaiprognostikuntuk
pasiendengankankerkolondanbisadipergunakanuntuk
pemantauankekambuhan,kataLyana.
PemantauankadarCEAuntukmemeriksakekambuhanharus
dilakukantiaptigabulan.Hasilpemeriksaannyaharus
didokumentasikandenganbaik.PeningkatanCEAdiatasnilai
awalharusdipastikanbetulbetulkarenaitumerupakanpetunjuk
untukmelakukanoperasiulang,ujarLyana.
CEAjugabergunauntukmemantaukebehasilanpengobatan
kankerkolon.Lyanamenjelaskan,kadarnyaakankembali
normaldalamsatusampaiduabulansetelahpembedahan.
Kalautetapmeningkat,kitaharusmewaspadaipenyakitnya
masihada.
AlphaFetoprotein(AFP)
AFPadalahproteinjaninnormalyangdisintesisolehhati,
kantongkuningtelur,dansalurancerna.Iamerupakanbagian
utamadalamplasmadarahjanindankadarnyaakanturun
dengancepatsetelahlahir.Padaorangdewasa,kadarnya
kurangdari10ng/ml,ucapLyana.
AFPberperanpentingdalamdiagnosiskankerhati.Bisajuga
dipakaiuntukskriningkankerhati,khususnyapadapopulasi
berisikotinggi.Selainitu,AFPjugapetandauntukkankersel

benih(germcellcarcinoma),paparSekretarisHimpunanKimia
KlinikcabangJakartaini.
Lyanamenuturkan,AFPdapatmeningkatmenyusulkehamilan
normalataupenyakithatijinak,sepertihepatitisatausirosis.
Peningkatankadarnyapadakondisibukankankerbiasanya
kurangdari500ng/ml.
Ca153
Inimerupakanantigenyangdigunakanuntukmemantau
aktivitaskankerpayudara.KadarCa153meningkatpada60
sampai80persenkasuskankerpayudarametastatik.Kadarnya
sebandingdenganperjalananpenyakitdanresponsterhadap
terapi,ungkapLyana.
Ca125
Ca125merupakanantigenyangditemukanpada80persen
kasuskarsinomaovariumnonmusinosa.Petandainiterlihat
meningkatpadapasienkankerovarium,endometrium,pankreas,
paru,payudara,dankolon.Namun,karenaprevalensikanker
ovariumrendah,pemeriksaaninitidakdapatdigunakansecara
tersendiriuntukscreening,ujarLyana.
Ca199
Inimerupakanantibodimonoklonalyangdihasilkanterhadap
suatugalurselkankerkolon.Kadarnyameningkatpada21
sampai42persenkasuskankerlambung.Ca199jugatinggi
pada20sampai40persenkasuskankerkolondansekitar71
sampai93persenkasuskankerpankreas,uraiLyana.
MeningkatkanKewaspadaan
DrLyanaSetiawanSpPKmelihatmasyarakatbelumbegitu
memahamikanker.Alhasil,kebanyakanpasiendatangdalam
stadiumlanjut.Padahal,adakankeryangbisadideteksidini.
Deteksidinikankerprostat,misalnya,patutdilakukanolehpria
yangsudahberusia50tahun.Pemeriksaanberkalasangatbaik
untukdilakukan.Namun,memangtarifpemeriksaannyamasih
mahal,kataLyanadalamseminardiRSKankerDharmais,
Selasa(13/7)lalu.
Sementaraitu,untukkalanganperempuan,Lyanamenyerukan
pemeriksaanpapsmearsecaraberkala.Langkahiniutamanya

diperlukanolehmerekayangmelahirkanbanyakanak,menikah
dini,bergantigantipasanganintim,atausudahberusialebihdari
50tahun.Pemeriksaaninidapatmendeteksikankerserviks
apalagijikaAndaseringkeputihandanpendarahan.
Selainitu,Lyanamenganjurkanperempuanmelakukan
pemeriksaanpayudarasendiri.Jikaditemukanbenjolan,
segeralahmemeriksakandirikedokter.Sedangkan,mamografi
baiknyatidakterlalusering,cukuplimatahunsekaliuntukyang
sudahberusialebihdari30tahun.
Jikaditemukanadanyabenjolan,jinakataupunganas,pasien
harusmemintapenjelasandetail.Pasiensebaiknyapahambetul
statuskesehatannya.Ketidakmengertianakanmenghalangi
peluangsembuh,ungkapLyana.
Pasienkankerhendaknyamenyadaribahwamerekamenjalani
pengobatanjangkapanjang.Bahkan,kerapdiperlukan
kombinasibeberapaterapi.Adakemungkinankambuhjika
sempatterjadiputusterapi,kataLyana.
Kankermemangmenjadipenyebabkematiannomortigadi
Indonesia.Namun,janganputussemangat.Jikadideteksi
secaradiniatauditerapidengantepat,peluangmemenangkan
perangterhadapkeganasanseltentuakanlebihbesar,kata
Lyanamenandaskan.

KankerProstatadalahsuatutumorganasyangtumbuhdidalam
kelenjarprostat.
Kankerprostatsangatseringterjadi.
Pemeriksaanmikroskopisterhadapjaringanprostatpasca
pembedahanmaupunpadaotopsimenunjukkanadanyakanker
pada50%priaberusiadiatas70tahundanpadasemuapriayang
berusiadiatas90tahun.
Kebanyakankankertersebuttidakmenimbulkangejalakarena
penyebarannyasangatlambat.

PENYEBAB
Penyebabnyatidakdiketahui,meskipunbeberapapenelitian
telahmenunjukkanadanyahubunganantaradiettinggilemak
danpeningkatankadarhormontestosteron.
Kankerprostatmerupakanpenyebabkematianakibatkankerno
3padapriadanmerupakanpenyebabutamakematinakibat
kankerpadapriadiatas74tahun.
Kankerprostatjarangditemukanpadapriaberusiakurangdari
40tahun.
Priayangmemilikiresikolebihtinggiuntukmenderitakanker
prostatadalahpriakulithitamyangberusiadiatas60tahun,
petani,pelukisdanpemaparankadmium.
AngkakejadianterendahditemukanpadapriaJepangdan
vegetarian.
Kankerprostatdikelompokkanmenjadi:

StadiumA:benjolan/tumortidakdapatdirabapada
pemeriksaanfisik,biasanyaditemukansecaratidaksengaja
setelahpembedahanprostatkarenapenyakitlain.
StadiumB:tumorterbataspadaprostatdanbiasanya
ditemukanpadapemeriksaanfisikatautesPSA.
StadiumC:tumortelahmenyebarkeluardarikapsul
prostat,tetapibelumsampaimenyebarkekelenjargetahbening.
StadiumD:kankertelahmenyebar(metastase)kekelenjar
getahbeningregionalmaupunbagiantubuhlainnya(misalnya
tulangdanparuparu).
GEJALA
Biasanyakankerprostatberkembangsecaraperlahandantidak
menimbulkangejalasampaikankertelahmencapaistadium
lanjut.
KadanggejalanyamenyerupaiBPH,yaituberupakesulitan
dalamberkemihdanseringberkemih.
Gejalatersebuttimbulkarenakankermenyebabkan
penyumbatanparsialpadaaliranairkemihmelaluiuretra.
Kankerprostatbisamenyebabkanairkemihberwarnamerah
(karenamengandungdarah)ataumenyebabkanterjadinya
penahananairkemihmendadak.
Padabeberapakasus,kankerprostatbaruterdiagnosissetelah
menyebarketulang(terutamatulangpanggul,igadantulang
belakang)ataukeginjal(menyebabkangagalginjal).
Kankertulangmenimbulkannyeridantulangmenjadirapuh
sehinggamudahmengalamifraktur(patahtulang).
Setelahkankermenyebar,biasanyapenderitaakanmengalami
anemia.
Kankerprostatjugabisamenyebarkeotakdanmenyebabkan

kejangsertagejalamentalatauneurologislainnya.
Gejalalainnyaadalah:
Segerasetelahberkemih,biasanyaairkemihmasihmenetes
netes
Nyeriketikaberkemih
Nyeriketikaejakulasi
Nyeripunggungbagianbawah
Nyeriketikabuangairbesar
Nokturia(berkemihpadamalamhari)
Inkontinensiauri(beser)
Nyeritulangatautulangnyerijikaditekan
Hematuria(darahdalamairkemih)
Nyeriperut
Penurunanberatbadan.

DIAGNOSA
Caraterbaikuntukmenyaringkankerprostatadalahmelakukan
pemeriksaancolokduburdanpemeriksaandarah.
Colokduburpadapenderitakankerprostatakanmenunjukkan
adanyabenjolankerasyangbentuknyatidakberaturan.
Padapemeriksaandarahdilakukanpengukurankadarantigen
prostatspesifik(PSA),yangbiasanyameningkatpadapenderita
kankerprostat,tetapijugabisameningkat(tidakterlalutinggi)
padapenderitaBPH.
Jikapadapemeriksaancolokduburditemukanbenjolan,maka
dilakukanpemeriksaanUSG.
Denganmelakukanrontgenatauskeningtulang,bisadiketahui
adanyapenyebarankankerketulang.
Pemeriksaanlainnyayangbiasadilakukan:
Analisaairkemih

Sitologiairkemihataucairanprostat
Biopsiprostat.
PENGOBATAN
Pengobatanyangtepatuntukkankerprostatmasih
diperdebatkan.
Pilihanpengobatanbervariasi,tergantungkepadastadiumnya:
Padastadiumawalbisadigunakanprostatektomi
(pengangkatanprostat)danterapipenyinaran
Jikakankertelahmenyebar,bisadilakukanmanipulasi
hormonal(mengurangikadartestosteronmelaluiobatobatan
maupunpengangkatantestis)ataukemoterapi.
Pembedahan
1. Prostatektomiradikal(pengangkatankelenjarprostat).
SeringkalidilakukanpadakankerstadiumAdanB.
Prosedurnyalamadanbiasanyadilakukandibawah
pembiusantotalmaupunspinal.
Sebuahsayatandibuatdiperutmaupundaerahperineum
danpenderitaharusmenjalaniperawatanrumahsakit
selama57harai.
Komplikasiyangmungkinterjadiadalahimpotensiadan
inkontinensiauri.
Padapenderitayangkehidupanseksualnyamasihaktif,
bisadilakukanpotencysparingradicalprostatectomy.
2. Orkiektomi(pengangkatantestis,pengebirian).
Pengangkatankeduatestismenyebabkanberkurangnya
kadartestosteron,tetapiprosedurinimenimbulkanefek
fisikdanpsikisyangtidakdapatditolerirolehpenderita.
Orkiektomiadalahpengobatanyangefektif,tidak
memerlukanpengobatanulang,lebihmurahdibandingkan
denganobatobatandansesudahmenjalaniorkiektomi
penderitatidakperlumenjalaniperawatanrumahsakit.

Orkiektomibiasanyadilakukanpadakankeryangtelah
menyebar.
Terapipenyinaran
Terapipenyinaranterutamadigunakanuntukmengobatikanker
stadiumA,BdanC.
Biasanyajikaresikopembedahanterlalutinggi,makadilakukan
terapipenyinaran.
Terapipenyinaranterhadapkelenjarprostatbisadilakukan
melaluibeberapacara:
1. Terapipenyinaraneksterna,dilakukandirumahsakit
tanpaperlumenjalanirawatinap.
Efeksampingnyaberupapenurunannafsumakan,
kelelahan,reaksikulit(misalnyakemerahandaniritasi),
cederaataulukabakarpadarektum,diare,sistitis(infeksi
kandungkemih)danhematuria.
Terapipenyinaraneksternabiasanyadilakukansebanyak5
kali/mingguselama68minggu.
2. Pencangkokanbutiranyodium,emasatauiridium
radioaktiflangsungpadajaringanprostatmelaluisayatan
kecil.
Keuntungandaribentukterapipenyinaraniniadalah
bahwaradiasilangsungdiarahkankepadaprostatdengan
kerusakanjaringandisekitarnyayanglebihsedikit.
Obatobatan
1. Manipulasihormonal.
Tujuannyaadalahmengurangikadartestosteron.
Penurunankadartestosteronseringkalisangatefektif
dalammencegahpertumbuhandanpenyebarankanker.
Manipulasihormonalterutamadigunakanuntuk
meringankangejalatanpamenyembuhkankankernya,

yaitumisalnyapadapenderitayangkankernyatelah
menyebar.
ObatsintetisyangfungsinyamenyerupaiLHRH
(luteinizinghormonereleasinghormone),semakinbanyak
digunakanuntukmengobatikankerprostatstadiumlanjut.
Contohnyaadalahlupronatauzoladeks.
Obatinimenekanperangsangantestisterhadap
pembentukantestosteron(halsepertiinidisebut
pengebiriankimiawikarenamemilikihasilyangsama
denganpengangkatantestis).
Obatdiberikandalambentuksuntikan,biasanyasetiap3
bulansekali.
Efeksampingnyaadalahmualdanmuntah,wajah
kemerahan,anemia,osteoporosisdanimpotensi.
Obatlainnyayangdigunakanuntukterapihormonal
adalahzatpenghambatandrogen(misalnyaflutamid),
yangberfungsimencegahmenempelnyatestosteronpada
selselprostat.
Efeksampingnyaadalahimpotensi,gangguanhati,diare
danginekomastia(pembesaranpayudara).
2. Kemoterapi
Kemoterapiseringkalidigunakanuntukmengatasigejala
kankerprostatyangkebalterhadappengobatanhormonal.
Biasanyadiberikanobattunggalataukombinasibeberapa
obatuntukmenghancurkanselselkanker.
Obatobatanyangbisadigunakanuntukmengobatikanker
prostatadalah:
Mitoxantronx
Prednisone
Paclitaxel
Dosetaxel
Estramustin

Adriamycin.
Efeksampingnyabervariasidantergantungkepadaobat
yangdiberikan.
Pemantauan
Apapunjenispengobatanyangdijalaninya,penderitaakan
dipantausecaraketatmengenaiperkembanganpenyakitnya.
Pemantauannyameliputi:
PemeriksaandarahuntukmengetahuikadarPSA(biasanya
setiap3bulan1tahun).
Skeningdan/atauCTscantulanguntukmengetahui
penyebarankanker.
Pemeriksaandarahlengkapuntukmemantautandatanda
dangejalaanemia.
Pemantauantandadangejalalainnyayangmenunjukkan
perkembanganpenyakit(misalnyakelelahan,penurunanberat
badan,nyeriyangsemakinhebat,penurunanfungsiususdan
kandungkemihsertakelemahan).

Awalkankerprostathanyaterbataspadakelenjarprostatitu
sendiri;sebagianbesarpasiendengankankerjenisinidapat
hidupselamabertahuntahuntanpamasalah.Prostatadalah
kecil,seukuranbuahkenaristrukturyangmembentukbagian
darisistemreproduksilakilaki,melainkanmembungkusdi
sekitaruretra,tabungyangmembawaurinkeluardaritubuh.
Tugasutamadarikelenjarprostatadalahmembuatcairanair
mani,susuzatyangmengangkutsperma.
Kankerprostatmerupakantumorganasdariprostatekelenjar.
Padausialanjut,risikokankerprostatoperasiatauperawatan
lainyanglebihradikalsebenarnyabisalebihburukdaripada
penyakit.Sekitar80persenpriayangmencapaiusia80tahun
memilikinya.
JikaAndamemilikisatuataulebihgejalakankerprostat,Anda
akanmelihatdokterberkualifikasisesegeramungkin.Karena
gejalainibisamenirugejalapenyakitlainataugangguan,laki

lakiyangmengalamigejalagejalatersebutharusmenjalani
kerjamenyeluruhupuntukmenentukandasarcausedarigejala.
Gejalalainmungkintermasukberatbadantidakdisengajadan
kelesuan.!br!!br!Jikakankeryangditangkappadatahapawal,
kebanyakanpriatidakakanmengalamigejalaapapun.Salah
satugejalaadalahsuatukebutuhanuntukseringbuangairkecil,
terutamapadamalamhari.Mungkinadagejalalainyangtidak
disebutkandisini.
AdatesyanglebihbaruyangdisebutAMACRyanglebih
sensitifdaripadatesPSAuntukmenentukanadanyakanker
prostat.Sebuahbiopsiprostatbiasanyamengkonfirmasikan
diagnosis.Prostatspesifikantigen(PSA)mengukurtesPSA
enzimdalamdarahuntukkelainan.
Teslainyangbiasanyadigunakanketikagejalayanghadir
adalahduburdigital(DRE)yangdilakukanolehdokter.Ada
beberapapotensikerugianuntukpengujianPSAmisalnyaPSA
yangtinggitidakselaluberartipasienmenderitakankerprostat.
SebuahtesPSAdengantingkattinggijugadapatdarinon
kankerpembesarankelenjarprostat.
Padapasienyangkesehatannyamakesrisikotinggitidakdapat
diterimapembedahan,terapiradiasiseringkaliyangdipilih
alternatifkonvensional.Selainobatobatanhormon,manipulasi
hormonjugadapatdilakukandenganmembuangtestismelalui
pembedahan.Kankerprostatyangtelahmenyebar(metastasis)
dapatdiobatisecarakonvensionaldenganobatobatanuntuk
mengurangikadartestosteron,pembedahanuntukmengangkat
testis,kemoterapiatautidaksamasekali.
Recentperbaikandalamprosedurpembedahantelahmembuat
jarangterjadikomplikasi.Anspesialisonkologibiasanyaakan
merekomendasikanmemperlakukandengansatuobatatau
kombinasiobatobatan.Operasi,yangdisebutradikal
prostatektomi,menghilangkanseluruhkelenjarprostatdan
beberapajaringandisekitarnya.
Efeksampingdariobatkemoterapitergantungpadamanayang
Andamengambildanseberapaseringdanberapalamamereka
akandiarahkan.Obatobatandapatdigunakanuntukmengatur

kadartestosteron;disebutmanipulasihormonal.Apakahradiasi
adalahsebaikmengeluarkankelenjarprostatdiperdebatkandan
keputusantentangyanguntukmemilih,jikaada,bisasulit.!br!!
br!pengobatankonvensionalkankerprostatsering
kontroversial.Terapiradiasipadakelenjarprostatbaikeksternal
maupuninternal,keduanyayangmenggunakansinarberenergi
tinggiuntukmembunuhselkankerdantumormenyusut.
Impotensiadalahkomplikasipotensialsetelahprostatektomi
atausetelahterapiradiasi.
Obatdapatmemilikibanyakefeksamping,termasukhotflashes
danhilangnyasexualkeinginan.Pembedahan,radiasi,terapi
hormonaldankemoterapisemuamemilikiefeksampingyang
signifikan;tahusepenuhnyaapayangmerekasebelum
melanjutkan.
Buktimenunjukkanbahwabanyakpasienmerekamendeteksi
kankerpadatahapawalkarenaskriningtahunan,jadipastikan
untukmendapatkanujian.Hasildarikankerprostatsangat
bervariasi,terutamakarenapenyakitiniditemukanpadapria
usialanjutyangdapatmemilikiberbagaikomplikasipenyakit
lainataukondisi,sepertijantungataurespiratORYpenyakit,
ataucacatyangmelumpuhkanatausangatmengurangikegiatan
mereka.Karenaituadalahpenyakittumbuhlambat,banyak
orangdenganpenyakitiniakanmatidarisebabsebablain
sebelummerekamatidarikankerprostat.

Indikasi:
Untukhipertensiberathinggasedang,kombinasidengantiazida
memberikanefekaditif,sedangkankombinasidenganbeta
blokermemberikanefekyangkurangaditif.Untukgagal
jantungyangtidakcukupresponsifatautidakdapatdikontrol
dengandiuretikdandigitalis,dalamhalinipemberiankaptopril
diberikanbersamadiuretikdandigitalis.
KontraIndikasi:
Penderitayanghipersensitifterhadapkaptoprilataupenghambat
ACElainnya(misalnyapasienmengalamiangioedemaselama
pengobatandenganpenghambatACElainnya).
Komposisi:
Setiaptabletmengandungkaptopril12,5mg.
Setiaptabletmengandungkaptopril25mg.
Setiaptabletmengandungkaptopril50mg.
CaraKerjaObat:
Kaptoprilmerupakanobatantihipertensidanefekifdalam
penanganangagaljantungdengancarasupresisistemrenin
angiotensinaldosteron.Reninadalahenzimyangdihasilkan
ginjaldanbekerjapadaglobulinplasmauntukmemproduksi
angiotensinIyangbesifatinaktif."AngiotensinConverting
Enzyme"(ACE),akanmerubahangiotensinImenjadi
angiotensinIlyangbesifataktifdanmerupakanvasokonstriktor
endogensertadapatmenstimulasisintesadansekresialdosteron

dalamkorteksadrenal.
Peningkatansekresialdosteronakanmengakibatkanginjal
meretensinatriumdancairan,sertameretensikalium.Dalam
kerjanya,kaptoprilakanmenghambatkerjaACE,akibatnya
pembentukanangiotensinllterhambat,timbulvasodilatasi,
penurunansekresialdosteronsehinggaginjal
mensekresinatriumdancairansertamensekresikalium.
Keadaaniniakanmenyebabkanpenurunantekanandarahdan
mengurangibebanjantung,baik'afterload'maupun'preload',
sehinggaterjadipeningkatankerjajantung.Vasodilatasiyang
timbultidakmenimbulkanreflektakikardia.
Dosis:
Kaptoprilharusdiberikan1jamsebelummakan,dosisnya
sangattergantungdarikebutuhanpenderita(individual).
Dewasa:
Hipertensi,dosisawal:12,5mgtigakalisehari.
Bilasetelah2minggu,penurunantekanandarahmasihbelum
memuaskanmakadosisdapatditingkatkanmenjadi25mgtiga
kalisehari.Bilasetelah2minggulagi,tekanandarahmasih
belumterkontrolsebaiknyaditambahkanobatdiuretikgolongan
tiazidamisalhidroklorotiazida25mgsetiap
hari.
Dosisdiuretikmungkindapatditingkatkanpadaintervalsatu
sampaiduaminggu.Maksimumdosiskaptopriluntukhipertensi
seharitidakbolehlebihdari450mg.
Gagaljantung12,525mgtigakalisehari;diberikanbersama
diuretikdandigitalis,dariawalterapiharusdilakukan
pengawasanmediksecaraketat.Untukpenderitadengan
gangguanfungsiginjaldsiisperludikurangidisesuaikandengan
klirenskreatininpenderita.
PeringatandanPerhatian:
Keamananpenggunaanpadawanitahamilbelumterbukti,bila
terjadikehamilanselamapemakaianobatini,makapemberian
obatharusdihentikandengansegera.

Harusdiberikandenganhatihatipadawanitamenyusui,
pemberianASIperludihentikankarenaditemukankadardalam
ASIlebihtinggidaripadakadardalamdarahibu.
Pemberianpadaanakanakmasihbelumdiketahui
keamanannya,sehinggaobatinihanyadiberikanbilatidakada
obatlainyangefektif.
Pemakaianpadalanjutusiaharushatihatikarena
sensitivitasnyaterhadapefekhipotensif.
Hatihatipemberianpadapenderitapenyakitginjal.
Pengobatanagardihentikanbilaterjadigejalagejalaangiodema
sepertibengkakmulut,mata,bibir,lidah,laringjugasukar
menelan,sukarbernafasdanserak.
Konsultasikankedokterbilamenggunakansuplemen
potassium,potassiumsparingdiureticdangaramgaram
polassium.
PemakaianobatpenghambatACEpadakehamilandapat
menyebabkangangguan/kelainanorganpadafetusatau
neonatus,bahkandapatmenyebabkankematianfetusatau
neonatus.
Padakehamilantrimesterlldanllldapatmenimbulkan
gangguanantaralain:hipotensi,hipoplasiatengkorakneonatus,
anuria,gagalginjalreversibleatauirreversibledankematian.
Jugadapatterjadioligohidramnios,deformasikraniofasial,
perkembanganparuhipoplasi,kelahiranprematur,
perkembanganretardasiintrauteri,patenduktusarteriosus.
Bayidenganriwayatdimanaselamadidalamkandungan
ibunyamendapatpengobatanpenghambatACE,harus
diobservasiintensiftentangkemungkinanterjadinyahipotensi,
oligouriadanhiperkalemia.
EfekSamping:
Kaptoprilmenimbulkanproteinurialebihdari1gseharipada
0,5%penderitadanpada1,2%penderitadenganpenyakitginjal.
Dapattejadisindromanefrotiksertamembranglomerulopati
padapenderitahipertensi.Karenaproteinuriaumumnyaterjadi
dalamwaktu8bulanpengobatanmakapenderitasebaiknya

melakukanpemeriksaanproteinurinsebelumdansetiapbulan
selama8bulanpertama
pengobatan.
Neutropenia/agranulositosisterjadikirakira0,4%penderita.
Efeksampinginiterutamaterjadipadapenderitadengan
gangguanfungsiginjal.Neutropeniainimunculdalam13
bulanpengobatan,pengobatanagardihentkansebelumpenderita
terkenapenyakitinfeksi.Padapenderitadenganresikotinggi
harusdilakukanhitungleukositsebelumpengobatan,setiap2
mingguselama3bulanpertamapengobatandansecaraperiodik.
Padapenderitayangmengalamitandatandainfeksiakut
(demam,faringitis)pemberiankaptoprilharussegeradihentikan
karenamerupakanpetunjukadanyaneutropenia.
Hipotensidapatterjadi11,5jamsetelahdosispertamadan
beberapadosisberikutnya,tapibiasanyatidakmenimbulkan
gejalaatauhanyamenimbulkanrasapusingyangringan.Tetapi
bilamengalamikehilangancairan,misalnyaakibatpemberian
diuretik,dietrendahgaram,dialisis,muntah,diare,dehidrasi
makahipotensitersebutmenjadilebihberat.Makapengobatan
dengankaptoprilperludilakukanpengawasanmedikyangketat,
terutamapadapenderitagagaljantungyangumumnya
mempunyaitensiyangnomalataurendah.Hipotensiberatdapat
diatasidenganinfusgaramfaalataudenganmenurunkandosis
kaptoprilataudiuretiknya.
Seringterjadiruamdanpruritus,kadangkadangterjadidemam
daneosinofilia.Efektersebutbiasanyaringandanmenghilang
beberapaharisetelahdosisditurunkan.
Teriadiperubahanrasa(tastealteration),yangbiasanyaterjadi
dalam3bulanpertamadanmenghilangmeskipunobat
diteruskan.
Retensikaliumringanseringterjadi,terutamapadapenderita
gangguanginjal,sehinggaperludiuretikyangmeretensikalium
sepertiamiloridadanpemberiannyaharusdilakukandengan
hatihati.
InteraksiObat:

Alkohot.
Obatantiinflamasiterutamaindometasin.
Suplemenpotassiumatauobatyangmengandungpotassium.
Obatobatberefekhipotensi.
Carapenyimpanan:
Simpanditempatsejukdankering,terlindungdaricahaya.
KemasandanNomorRegistrasi:
Captopril12,5mgtablet,kotak10strip@10tablet
No.Reg.GKL9720916010C1
Captopril25mgtablet,kotak10strip@10tablet
No.Reg.GKL9320916010A1
Captopril50mgtablet,kotak10strip@10tablet
No.Reg.GKL93209160108
HARUSDENGANRESEPDOKTER
Jenis:Tablet
Produsen:PTIndofarma
Sharedi Sharedi
Bookmark:
Facebook Twitter
Gabungmilis
DechaCare.com!

Disclaimers RSSkomentar

Beritahu
teman

Ada15ulasantentang"Captopril"darikonsumen.Posting
ulasanAnda.
ibusayapenderitajantung
Dari:lilikyuliantodisalatiga,tanggal:Apr9,201119:24:18

Rating : 5
Positif : bengkakdikakiibusayahilang
Negatif : sayabelummenemuinya
UlasanlilikyuliantotentangCaptopril

ibusayaadalahpenderitajantungsela1tahunini,
bahkanseluruhbadannyabengka.setelahmeminum
secararutinobatini,dalamjangka1minggubengkak
hilang.

berapalamawaktuyangdibutuhkancaptopriluntuk
meretensiKalium
Dari:tarmizidiPadang,tanggal:Aug24,200904:39:24
Rating : 5
Positif :

mempunyaiaktivitasdanmanfaatyang
menguntungkan

Negatif : efeksampingbatukkering
UlasantarmizitentangCaptopril

Sayainginbertanya,berapalamawaktuyang
dibutuhkancaptopriluntukmeretensiKaliumsecara
signifikan?apakah1atau2hari?
TerimakasihatasinformasinyaBapak/Ibu

fungsicaptopril
Dari:MeydiMalang,tanggal:Aug6,200920:31:17

Rating : 3
Positif : penuruntekanandarahdankomposisinyaringan
Negatif : harusdiminumsetiaphari
UlasanMeytentangCaptopril

Sayahanyainginbertanyadanmenambahinfo
tentangfungsiCaptoprilsecaraumum.Sayapernah
mendapatkansekilasinfobahwaCaptopril
sebenarnyabaikdiminumdengandosisminimum
setiaphari(kontinyutidakputus)bagipenderita
hipertensi.Gunanyaadalahuntukmencegah
penyumbatanpadajantungdanjugabaikbagisistem
kerjaginjal.
Mohonbagitemantemanygpunyainfolengkapdan
akurat,sayaperlupenjelasannya.Terimakasih.

obattensitinggi
Dari:achyaruzairtoudibekasi,tanggal:Aug7,2010
00:51:24
Rating : 1
Positif : positimengurangirasasakit
Negatif : belumdirasakan
UlasanachyaruzairtoutentangCaptopril

sayaminumobatinibelumlamaatassarandokter
yangmelakukanpemeriksaangratisuntukpara
pensiunan,sayadiberiyang25grdanaklhamdulilllah,
pusingsembuhsesudahminumobatini.cumasaya

ingintahuapakahobatinicuma

captoprilbisamenurunkantensidarah
Dari:dewiatidibandung,tanggal:Feb15,201116:33:31
Rating : 3
Positif : bisamenurunkantensidarah
Negatif : menimbulkanbatuk

Setiaptabletmengandungkaptopril12,5mg.
Setiaptabletmengandungkaptopril25mg.
Setiaptabletmengandungkaptopril50mg.

Indikasi:
Untukhipertensiberathinggasedang,kombinasidengantiazida
memberikanefekaditif,sedangkankombinasidenganbeta
blokermemberikanefekyangkurangaditif.Untukgagal
jantungyangtidakcukupresponsifatautidakdapatdikontrol
dengandiuretikdandigitalis,dalamhalinipemberiankaptopril
diberikanbersamadiuretikdandigitalis.
KontraIndikasi:
Penderitayanghipersensitifterhadapkaptoprilataupenghambat
ACElainnya(misalnyapasienmengalamiangioedemaselama
pengobatandenganpenghambatACElainnya).
CaraKerjaObat:
Kaptoprilmerupakanobatantihipertensidanefekifdalam
penanganangagaljantungdengancarasupresisistemrenin
angiotensinaldosteron.Reninadalahenzimyangdihasilkan
ginjaldanbekerjapadaglobulinplasmauntukmemproduksi
angiotensinIyangbesifatinaktif.AngiotensinConverting
Enzyme(ACE),akanmerubahangiotensinImenjadi
angiotensinIlyangbesifataktifdanmerupakanvasokonstriktor
endogensertadapatmenstimulasisintesadansekresialdosteron
dalamkorteksadrenal.
Peningkatansekresialdosteronakanmengakibatkanginjal
meretensinatriumdancairan,sertameretensikalium.Dalam
kerjanya,kaptoprilakanmenghambatkerjaACE,akibatnya
pembentukanangiotensinllterhambat,timbulvasodilatasi,
penurunansekresialdosteronsehinggaginjalmensekresi
natriumdancairansertamensekresikalium.Keadaaniniakan
menyebabkanpenurunantekanandarahdanmengurangibeban
jantung,baikafterloadmaupunpreload,sehinggaterjadi
peningkatankerjajantung.Vasodilatasiyangtimbultidak
menimbulkanreflektakikardia.
Dosis:
Kaptoprilharusdiberikan1jamsebelummakan,dosisnya
sangattergantungdarikebutuhanpenderita(individual).
Dewasa:
Hipertensi,dosisawal:12,5mgtigakalisehari.

Bilasetelah2minggu,penurunantekanandarahmasihbelum
memuaskanmakadosisdapatditingkatkanmenjadi25mgtiga
kalisehari.Bilasetelah2minggulagi,tekanandarahmasih
belumterkontrolsebaiknyaditambahkanobatdiuretikgolongan
tiazidamisalhidroklorotiazida25mgsetiaphari.
Dosisdiuretikmungkindapatditingkatkanpadaintervalsatu
sampaiduaminggu.Maksimumdosiskaptopriluntukhipertensi
seharitidakbolehlebihdari450mg.
Gagaljantung12,525mgtigakalisehari;diberikanbersama
diuretikdandigitalis,dariawalterapiharusdilakukan
pengawasanmediksecaraketat.Untukpenderitadengan
gangguanfungsiginjaldoiisperludikurangidisesuaikandengan
klirenskreatininpenderita.
PeringatandanPerhatian:
Keamananpenggunaanpadawanitahamilbelumterbukti,bila
terjadikehamilanselamapemakaianobatini,makapemberian
obatharusdihentikandengansegera.
Harusdiberikandenganhatihatipadawanitamenyusui,
pemberianASIperludihentikankarenaditemukankadardalam
ASIlebihtinggidaripadakadardalamdarahibu.
Pemberianpadaanakanakmasihbelumdiketahui
keamanannya,sehinggaobatinihanyadiberikanbilatidakada
obatlainyangefektif.
Pemakaianpadalanjutusiaharushatihatikarena
sensitivitasnyaterhadapefekhipotensif.
Hatihatipemberianpadapenderitapenyakitginjal.
Pengobatanagardihentikanbilaterjadigejalagejalaangiodema
sepertibengkakmulut,mata,bibir,lidah,laringjugasukar
menelan,sukarbernafasdanserak.
Konsultasikankedokterbilamenggunakansuplemen
potassium,potassiumsparingdiureticdangaramgaram
polassium.
PemakaianobatpenghambatACEpadakehamilandapat
menyebabkangangguan/kelainanorganpadafetusatau
neonatus,bahkandapatmenyebabkankematianfetusatau
neonatus.

Padakehamilantrimesterlldanllldapatmenimbulkan
gangguanantaralain:hipotensi,hipoplasiatengkorakneonatus,
anuria,gagalginjalreversibleatauirreversibledankematian.
Jugadapatterjadioligohidramnios,deformasikraniofasial,
perkembanganparuhipoplasi,kelahiranprematur,
perkembanganretardasiintrauteri,patenduktusarteriosus.
Bayidenganriwayatdimanaselamadidalamkandungan
ibunyamendapatpengobatanpenghambatACE,harus
diobservasiintensiftentangkemungkinanterjadinyahipotensi,
oligouriadanhiperkalemia.
EfekSamping:
Kaptoprilmenimbulkanproteinurialebihdari1gseharipada
0,5%penderitadanpada1,2%penderitadenganpenyakitginjal.
Dapattejadisindromanefrotiksertamembranglomerulopati
padapenderitahipertensi.Karenaproteinuriaumumnyaterjadi
dalamwaktu8bulanpengobatanmakapenderitasebaiknya
melakukanpemeriksaanproteinurinsebelumdansetiapbulan
selama8bulanpertama.
Carapenyimpanan:
Simpanditempatsejukdankering,terlindungdaricahaya.

BPHadalahpembesaranprogresifdarikelenjarprostat(secaraumumpadapria
lebihtuadari50tahun)menyebabkanberbagaiderajatobstruksiuretraldan
pembatasanaliranurinarius(Marilynn,E.D,2000:671).

HipertropiProstatadalahhiperplasiadarikelenjarperiurethralyangkemudianmendesak
jaringanprostatyangaslikeperiferdanmenjadisimpaibedah.(KapitaSelekta,2000).

1.

2.Etiologi

PenyebabyangpastidariterjadinyaBPHsampaisekarangbelumdiketahui.Namunyangpasti
kelenjarprostatsangattergantungpadahormonandrogen.Faktorlainyangeratkaitannya
denganBPHadalahprosespenuaanAdabeberapafactorkemungkinanpenyebabantaralain:
1).Dihydrotestosteron(DHT)
Peningkatan5alfareduktasedanreseptorandrogenmenyebabkanepiteldanstromadarikelenjar
prostatmengalamihiperplasi.
2).Perubahankeseimbanganhormonestrogentestoteron
Padaprosespenuaanpadapriaterjadipeningkatanhormonestrogendanpenurunantestosteron
yangmengakibatkanhiperplasistroma.
3).Interaksistromaepitel
Peningkatanepidermalgorwthfactorataufibroblastgrowthfactordanpenurunan
transforminggrowthfactorbetamenyebabkanhiperplasistromadanepitel.
4).Berkurangnyaselyangmati
Estrogenyangmeningkatmenyebabkanpeningkatanlamahidupstromadanepiteldari
kelenjarprostat.
5).TeorikebangkitanKembali(reawakening)ataureinduksidarikemampuanmesenkimsinus
urogenitaluntukberproliferasidanmembentukjaringanprostat.
1.

3.Patofisiologi

PeningkatanSelStermPeningkatan5AlfareduktaseProsesMenuaInteraksi
SelEpiteldanStromaBerkurangnyaselyangmati

Ketidakseimbanganhormon

(Estrogendantestoteron)

PenyempitanLumenUreterProtatika

MenghambatAliranUrina
RetensiUrinaPeningkatatekananintravesikal

HidroUreterHiperirritablepadabladder

HidronefritisPeningkatanKontraksiOtotdetrusordaribuli
buli

PenurunananHipertropiOtotdetrusor,trabekulasi
Fungsiginjal
TerbentuknyaSekulasekuladandifertikelbulibuli

FrekuensiIntermitenDisuriaUrgensiHesistensiTerminaldribling
1.

4.AnatomiDanFisiologi

Spincterexternamengelilingiurethradibawahvesicaurinariapadawanita,tetapipadalakilaki
terdapatkelenjarprostatyangberadadibelakangspincterpenutupurethra.Prostatmengekskresikan
cairannyakedalamurethrapadasaatejakulasi,cairanprostatinimemberimakanankepadasperma.
Cairaninimemasukiurethraparsprostatikadarivasdeferens.
Prostatdilewatioleh:
1.

Ductusejakulatorius,terdiridari2buahberasaldarivesicaseminalisbermuarakeurethra.

2.

Urethraitusendiri,yangpanjangnya1723cm.

Secaraotomatisbesarnyaprostatadalahsebagaiberikut:
1.

Transversal:1,5inchi

2.

Vertical:1,25inchi

3.

AnteriorPosterior:0,75inchi

Prostatterdiridari5lobusyaitu:
1.

Dualobuslateralis

2.

Satulobusposterior

3.

Satulobusanterior

4.

Satulobusmedial

Kelenjarprostatkirakirasebesarbuahkenaribesar,letaknyadibawahkandungkemih.Normal
beratnyaprostatpadaorangdewasadiperkirakan20gram.
Ada3carauntukmengukurbesarnyahipertropiprostat,yaitu
1.

Rectalgrading

Recthalgradingataurectaltoucherdilakukandalamkeadaanbulibulikosong.Sebabbilabulibuli
penuhdapatterjadikesalahandalampenilaian.Denganrectaltoucherdiperkirakandenganbeberapa
cmprostatmenonjolkedalamlumendanrectum.Menonjolnyaprostatdapatditentukandalamgrade.
Pembagiangradesebagaiberikut:
1.

01cm.:Grade0

2.

12cm.:Grade1

3.

23cm.:Grade2

4.

34cm.:Grade3

5.

Lebih4cm.:Grade4

Biasanyapadagrade3dan4batasdariprostattidakdapatdirabakarenabenjolanmasukkedalam
cavumrectum.Denganmenentukanrectalgradingmakadidapatkankesanbesardanberatnyaprostat
danjugapentinguntukmenentukanmacamtindakanoperasiyangakandilakukan.Bilakecil(grade1),
makaterapiyangbaikadalahT.U.R(TransUrethralResection)Bilaprostatbesarsekali(grade34)
dapatdilakukanprostatektomyterbukasecaratransvesical.
1.

Clinicalgradingdan

Padapengukuraniniyangmenjadipatokanadalahbanyaknyasisaurine.Pengukuraninidilakukan
dengancara,pagiharipasienbanguntidurdisuruhkemihsampaiselesai,kemudiandimasukkan
catheterkedalamkandungkemihuntukmengukursisaurine.
1.

Sisaurine0cc.Normal

2.

Sisaurine050cc.Grade1

3.

Sisaurine50150cc.Grade2

4.

Sisaurine>150ccGrade3

5.

SamasekalitidakbisakemihGrade4

6.

Intraurethragrading.

Untukmelihatseberapajauhpenonjolanlobuslateralkedalamlumenurethra.Pengukuraniniharus
dapatdilihatdenganpenendoskopydansudahmenjadibidangdariurologyyangspesifik.
Efekyangdapatterjadiakibathypertropiprostat:
1.

Terhadapurethra

Bilalobusmediusmembesar,biasanyaarahkeatasmengakibatkanurethraparsprostatikabertambah
panjang,danolehkarenafiksasiductusejaculatoriusmakaperpanjanganakanberputardan
mengakibatkansumbatan.
1.

Terhadapvesicaurinaria

Padavesicaurinariaakandidapatkanhypertropiototsebagaiakibatdariproseskompensasi,dimana
musclefibromenebalinididapatkanbagianyangmengalamidepresi(lekukan)yangdisebutpotensial
divertikula.
Padaprosesyanglebihlamaakanterjadidekompensasidaripadaototototyanghypertropidan
akibatnyaterjadiatonia(tidakadakekuatan)daripadaotototottersebut.
Kalaupembesaranterjadipadamediallobus,iniakanmembentuksuatupostprostatikapouch,ini
adalahkantongyangterdapatpadakandungkemihdibelakangmediallobe.
Postprostatikaadalahsebagaisumberdariterbentuknyaresidualurine(urineyangtersisa)danpada
postprostatikapouchinijugaselaludidapatiadanyabatubatudikandungkemih.
1.

Terhadapureterdanginjal

Kalaukeadaanurethravesicavalvebaik,makatekanankeekstravesikeltidakditeruskankeatas,tetapi
bilavalveinirusakmakatekananditeruskankeatas,akibatnyaototototcalyces,pelvis,uretersendiri
mengalamihipertropydanakanmengakibatkanhidronefrosisdanakibatlanjuturemia.
1.

Terhadapsexorgan

Mulamulalibidomeningkat,teatapiakhirnyalibidomenurun.
1.

5.GejalaBenigneProstatHyperplasia

Berdasarkangradenya,terbagimenjadi4gradeyaitu:
1.

1.

Padagrade1(congestic)
1.

Mulamulapasienberbulanataubeberapatahunsusahkemihdanmulaimengedan.

2.

Kalaumiksimerasapuas.

3.

Urinekeluarmenetesdanpancaranlemah.

4.

Nocturia

5.

Urinekeluarmalamharilebihdarinormal.

6.

Ereksilebihlamadarinormaldanlibidolebihdarinormal.

7.

Padacytoscopykelihatanhyperemiadariorificiumurethrainterna.Lambatlaun
terjadivaricesakhirnyabisaterjadiperdarahan(blooding)

Padagrade2(residual)
1.

Bilamiksiterasapanas.

2.

Dysurinocturibertambahberat.

3.

Tidakbisabuangairkecil(kemihtidakpuas).

4.

Bisaterjadiinfeksikarenasisaairkemih.

5.

Terjadipanastinggidanbisamenggigil.

6.

Nyeripadadaerahpinggang(menjalarkeginjal).

7.

Padagrade3(retensiurine)

8.

1.

Ischuriaparadosal.

2.

Incontinensiaparadosal.

Padagrade4
1.

Kandungkemihpenuh.

2.

Penderitamerasakesakitan.

3.

Airkemihmenetessecaraperiodikyangdisebutoverflowincontinensia.

4.

Padapemeriksaanfisikyaitupalpasiabdomenbawahuntukmerabaada
tumor,karenabendunganyanghebat.

5.

Denganadanyainfeksipenderitabisamenggigildanpanastinggisekitar40
41C.

6.

Selanjutnyapenderitabisakoma.

Darikapitaselekta,2000.GejalaklinisyangditimbulkanolehBenigneProstatHyperplasiadisebut
sebagaiSyndromaProstatisme.SyndromaProstatismedibagimenjadiduayaitu:
1.GejalaObstruktifyaitu:
1.

Hesitansiyaitumemulaikencingyanglamadanseringkalidisertaidenganmengejanyang
disebabkanolehkarenaototdestrussorbulibulimemerlukanwaktubeberapalama
meningkatkantekananintravesikalgunamengatasiadanyatekanandalamuretraprostatika.

2.

Intermitencyyaituterputusputusnyaalirankencingyangdisebabkankarenaketidakmampuan
ototdestrussordalampempertahankantekananintravesikasampaiberakhirnyamiksi.

3.

Terminaldriblingyaitumenetesnyaurinepadaakhirkencing.

4.

Pancaranlemah:kelemahankekuatandankaliberpancarandestrussormemerlukanwaktu
untukdapatmelampauitekanandiuretra.

5.

Rasatidakpuassetelahberakhirnyabuangairkecildanterasabelumpuas.

2.GejalaIritasiyaitu:
1.

Urgencyyaituperasaaninginbuangairkecilyangsulitditahan.

2.

Frekuensiyaitupenderitamiksilebihseringdaribiasanyadapatterjadipadamalamhari
(Nocturia)danpadasianghari.

3.

Disuriayaitunyeripadawaktukencing.

1.

6.Komplikasi

1.

Perdarahan

2.

Inkotinensia

3.

Batukandungkemih

4.

Retensiurine

5.

Impotensi

6.

Epididimitis

7.

Haemorhoid,hernia,prolapsrectumakibatmengedan

8.

Infeksisalurankemihdisebabkankarenacatheterisasi

9.

Hydronefrosis

Halhalyangharusdilakukanpadapasiensetelahpulangdarirumahsakitadalah;
1.

Latihanberat,mengangkatberatdansexualintercoursedihindariselama3minggusetelah
dirumah.

2.

Tidakbolehmembawakendaraan.

3.

Mengedanpadasaatdefekasiharusdihindari,faecesharuslembekkalauperlupemberianobat
untukmelembekkanfaeces.

4.

Menganjurkanbanyakminumuntukmencegahstatisdaninfeksidanmembuatfaeceslembek.

1.

7.PemeriksaanPenunjang
1.

PemeriksaanLaboratorium

Pemeriksaandarahlengkap,faalginjal,serumelektrolitdankadarguladigunakan
untukmemperolehdatadasarkeadaanumumklien.

Pemeriksaanurinlengkapdankultur.

PSA(ProstatikSpesificAntigen)pentingdiperiksasebagaikewaspadaanadanya
keganasan.

1.

PemeriksaanUroflowmetri

SalahsatugejaladariBPHadalahmelemahnyapancaranurin.Secaraobyektifpancaranurin
dapatdiperiksadenganuroflowmeterdenganpenilaian:

Flowratemaksimal>15ml/dtk=nonobstruktif.

Flowratemaksimal1015ml/dtk=borderline.

Flowratemaksimal<10ml/dtk=obstruktif.

1.

PemeriksaanImagingdanRontgenologik

BOF(BuikOverzich):Untukmelihatadanyabatudanmetastasepadatulang.

USG(Ultrasonografi),digunakanuntukmemeriksakonsistensi,volumedanbesar
prostatjugakeadaanbulibulitermasukresidualurin.Pemeriksaandapatdilakukan
secaratransrektal,transuretraldansuprapubik.

IVP(PyelografiIntravena)

Digunakanuntukmelihatfungsiexkresiginjaldanadanyahidronefrosis.

PemeriksaanPanendoskop

Untukmengetahuikeadaanuretradanbulibuli.
1.

PemeriksaanCTScandanMRI

ComputedTomographyScanning(CTScan)dapatmemberikangambaranadanyapembesaranprostat,
sedangkanMagneticResonanceImaging(MRI)dapatmemberikangambaranprostatpadabidang
transversalmaupunsagitalpadaberbagaibidangirisan,namunpameriksaaninijarangdilakukan
karenamahalbiayanya.
1.

Pemeriksaansistografi

Dilakukanapabilapadaanamnesisditemukanhematuriaataupadapemeriksaanurineditemukan
mikrohematuria.pemeriksaaninidapatmemberigambarankemungkinantumordidalamkandung
kemihatausumberperdarahandariatasapabiladarahdatangdarimuaraureterataubaturadiolusendi
dalamvesica.Selainitusistoscopidapatjugamemberiketeranganmengenaibesarprostatdengan
mengukurpanjangurethraparsprostaticadanmelihatpenonjolanprostatkedalamurethra.
1.

8.Diagnosabanding

Olehkarenaadanyaprosesmiksitergantungpadakekuatankontraksidetrusor,elastisitasleher
kandungkemihdengantonusototnyadanresistensiurethrayangmerupakanfaktordalamkesulitan
miksi.Kelemahandetrusordisebabkanolehkelainansaraf(kandungkemihneurologik)misalnya:Lesi
medullaspinalis,penggunaanobatpenenang.Kekakuanlehervesicadisebabkanolehprosesfibrosis,
sedangkanresistensiurethradisebabkanolehpembesaranprostatjinakatauganas,tumordileher
kandungkemih,batudiurethraataustriktururethra.
1.

9.Penatalaksanaan

ModalitasterapiBPHadalah:
1).Observasi
Yaitupengawasanberkalapadakliensetiap36bulankemudiansetiaptahuntergantung
keadaanklien
2).Medikamentosa
TerapiinidiindikasikanpadaBPHdengankeluhanringan,sedang,danberattanpadisertai
penyulit.Obatyangdigunakanberasaldari:phitoterapi(misalnya:Hipoxisrosperi,Serenoa
repens,dll),gelombangalfablockerdangolongansupresorandrogen.
3).Pembedahan
IndikasipembedahanpadaBPHadalah:
a).Klienyangmengalamiretensiurinakutataupernahretensiurinakut.
b).Kliendenganresidualurin>100ml.
c).Kliendenganpenyulit.
d).Terapimedikamentosatidakberhasil.
e).Flowmetrimenunjukkanpolaobstruktif.

Pembedahandapatdilakukandengan:
a).TURP(TransUretralReseksiProstat9095%)
Dilaksanakanbilapembesaranterjadipadalobusmedialyanglangsungmengelilingiurethra.Jaringan
yangdireseksihanyasedikitsehinggatidakterjadiperdarahandanwaktupembedahantidakterlalu
lama.Rectoscopedisambungkandenganaruslistriklaludimasukkankedalamurethra.Kandungkemih
dibilasterusmenerusselamaprosedurberjalan.Pasienmendapatalatuntukmasaterhadapshocklistrik
denganlempenglogamyangdiberipelumasditempatkanpadabawahpaha.Kepinganjaringanyang
halusdibuangdenganirisandantempattempatperdarahanditutupdengancauter.
SetelahTURPdipasangcatheterFoleytigasaluranyangdilengkapibalon30ml.Setelahbalon
catheterdikembangkan,catheterditarikkebawahsehinggabalonberadapadafosaprostatyang
bekerjasebagaihemostat.Ukurancatheteryangbesardipasanguntukmemperlancarpengeluaran
gumpalandarahdarikandungkemih.
Kandungkemihdiirigasiterusdenganalattetesantigajalurdengangaramfisiologisataularutanlain
yangdipakaiolehahlibedah.Tujuandariirigasikonstanialahuntukmembebaskankandungkemih
dariekuandarahyangmenyumbatalirankemih.Irigasikandungkemihyangkonstandihentikan
setelah24jambilatidakkeluarbekuandarikandungkemih.Kemudiancatheterbisadibilasbiasatiap4
jamsekalisampaicatheterdiangkatbiasanya3sampai5harisetelahoperasi.Setelahcatheterdiangkat
pasienharusmengukurjumlahurinedanwaktutiapkaliberkemih.
b).RetropubicAtauExtravesicalProstatectomy
Padaprostatectomyretropubicdibuatinsisipadaabdominalbawahtapikandungkemihtidakdibuka.
c).PerianalProstatectomy
Dilakukanpadadugaankankerprostat,insisidibuatdiantarascrotumdanrectum.
d).SuprapubicAtauTranvesicalProstatectomy
Metodeoperasiterbuka,reseksisuprapubickelenjarprostatdiangkatdariurethralewatkandung
kemih.
4).Alternatiflain(misalnya:Kriyoterapi,Hipertermia,Termoterapi,TerapiUltrasonik.
10.KonsepDasarAsuhanKeperawatan
Asuhankeperawatanpasiendenganhipertropiprostatmelaluipendekatanproseskeperawatanyang
terdiridaripengkajiankeperawatan,perencanaankeperawatan,pelaksanaandanevaluasikeperawatan.
1.

PengkajianKeperawatan

1.

Anamnesa

KumpulangejalapadaBPHdikenaldenganLUTS(LowerUrinaryTractSymptoms)antara
lain:
1.

Nyeripadadaerahtindakanoperasi.

2.

Pusing.

3.

Perubahanfrekuensiberkemih.

4.

Urgensi.

5.

Dysuria

6.

Flatusnegatif.

7.

Lukatindakanoperasipadadaerahprostat.

8.

Retensi,kandungkemihpenuh.

9.

Inkontinensia

10. Bibirkering.
11. Puasa.
12. Bisingususnegatif.
13. Ekspresiwajahmeringis.
14. Pemasangancathetertetap.
15. Gelisah.
16. Informasikurang.
17. Urineberwarnakemerahan.
1.

PemeriksaanFisik

Dilakukandenganpemeriksaantekanandarah,nadidansuhu.Nadidapatmeningkat
padakeadaankesakitanpadaretensiurinakut,dehidrasisampaisyokpadaretensiurin
sertaurosepsissampaisyokseptik.

Pemeriksaanabdomendilakukandengantehnikbimanualuntukmengetahuiadanya
hidronefrosis,danpyelonefrosis.Padadaerahsuprasimfiserpadakeadaanretensiakan
menonjol.Saatpalpasiterasaadanyaballotemendanklienakanterasainginmiksi.
Perkusidilakukanuntukmengetahuiadatidaknyaresidualurin.

Penisdanuretrauntukmendeteksikemungkinanstenosemeatus,striktururetra,batu
uretra,karsinomamaupunfimosis.

Pemeriksaanskrotumuntukmenentukanadanyaepididimitis

Rectaltouch/pemeriksaancolokduburbertujuanuntukmenentukankonsistensisistim
persarafanunitvesikouretradanbesarnyaprostat.Denganrectaltoucherdapat
diketahuiderajatdariBPH,yaitu:

a).DerajatI=beratnya20gram.
b).DerajatII=beratnyaantara2040gram.
c).DerajatIII=beratnya>40gram.
1.

Diagnosakeperawatan.

Diagnosakeperawatanyangmungkintimbuladalahsebagaiberikut:
1.

PreOperasi:
1.

Obstruksiakut/kronisberhubungandenganobstruksimekanik,pembesaran
prostat,dekompensasiototdestrusordanketidakmapuankandungkemihunmtuk
berkontraksisecaraadekuat.

2.

Nyeri(akut)berhubungandenganiritasimukosabulibuli,distensikandung
kemih,kolikginjal,infeksiurinaria.

1.

3.

Resikotinggikekurangancairanberhubungandenganpascaobstruksidiuresis..

4.

Ansietasberhubungandenganperubahanstatuskesehatanataumenghadapiprosedur
bedah

5.

Kurangpengetahuantentangkondisi,prognosisdankebutuhanpengobatan
berhubungandengankurangnyainformasi

6.

PostOperasi:
1.

Nyeriberhubungandenganspasmuskandungkemihdaninsisisekunder
padaTURP

2.

Resikotinggiinfeksiberhubungandenganprosedurinvasif:alatselama
pembedahan,kateter,irigasikandungkemihsering.

3.

Resikotinggicidera:perdarahanberhubungandengantindakan
pembedahan

4.

Resikotinggidisfungsiseksualberhubungandenganketakutanakan
impotenakibatdariTURP.

5.

Kurangpengetahuan:tentangTURPberhubungandengankuranginformasi

6.

Gangguanpolatidurberhubungandengannyerisebagaiefekpembedahan

Intervensi

PreOperasi
1)Obstruksiakut/kronisberhubungandenganobstruksimekanik,pembesaranprostat,dekompensasi
ototdestrusordanketidakmapuankandungkemihuntukberkontraksisecaraadekuat,ditandaidengan:
1.

Perubahanfrekuensiberkemih.

2.

Urgensi.

3.

Dysuria.

4.

Pemasangancathetertetap.

5.

Urineberwarnakemerahan.

Tujuan:Klienmengatakantidakadakeluhan,dengankriteria:
1.

Cathetertetappatenpadatempatntya.

2.

Tidakadasumbatanalirandarahmelaluicatheter.

3.

Berkemihtanpaaliranberlebihan.

4.

Tidakterjadiretensipadasaatirigasi.

Rencanatindakandanrasional
1)Dorongpasienuntukberkemihtiap24jamdanbilatibatibadirasakan.
R/Meminimalkanretensiurinadistensiberlebihanpadakandungkemih
2)Observasialiranurinaperhatianukurandankekuatanpancaranurina
R/Untukmengevaluasiibstruksidanpilihanintervensi

3)Awasidancatatwaktusertajumlahsetiapkaliberkemih
R/Retensiurinemeningkatkantekanandalamsaluranperkemihanyangdapatmempengaruhifungsi
ginjal
4)Berikancairansampai3000mlseharidalamtoleransijantung.
R/Peningkatkanalirancairanmeningkatkanperfusiginjalsertamembersihkanginjal,kandungkemih
daripertumbuhanbakteri
5)Berikanobatsesuaiindikasi(antispamodik)
R/mengurangispasmekandungkemihdanmempercepatpenyembuhan
2)Nyeri(akut)berhubungandenganiritasimukosabulibuli,distensikandungkemih,kolik
ginjal,infeksiurinaria.
Tujuan:Nyerihilang/terkontrol.
Kriterahasil:
Klienmelaporkannyerihilang/terkontrol,menunjukkanketrampilanrelaksasidanaktivitas
terapeutiksesuaiindikasiuntuksituasiindividu.Tampakrileks,tidur/istirahatdengantepat.
Rencanatindakandanrasional
1.

Kajinyeri,perhatikanlokasi,intensitas(skala010).

R/Nyeritajam,intermittendengandoronganberkemih/masaseurinsekitarkateter
menunjukkanspasmebulibuli,yangcenderunglebihberatpadapendekatanTURP(biasanya
menurundalam48jam).
1.

Pertahankanpatensikateterdansistemdrainase.Pertahankanselangbebasdarilekukan
danbekuan.

R/Mempertahankanfungsikateterdandrainasesistem,menurunkanresikodistensi/spasme
bulibuli.
1.

Pertahankantirahbaringbiladiindikasikan

R/Diperlukanselamafaseawalselamafaseakut.
1.

Berikantindakankenyamanan(sentuhanterapeutik,pengubahanposisi,pijatan
punggung)danaktivitasterapeutik.

R/Menurunkanteganganotot,memfokusksnkembaliperhatiandandapatmeningkatkan
kemampuankoping.
1.

Berikanrendamdudukataulampupenghangatbiladiindikasikan.

R/Meningkatkanperfusijaringandanperbaikanedemasertameningkatkanpenyembuhan(
pendekatanperineal).
1.

Kolaborasidalampemberianantispasmodik

R/Menghilangkanspasme
3)Resikotinggikekurangancairanyangberhubungandenganpascaobstruksidiuresis.
Tujuan:Keseimbangancairantubuhtetapterpelihara.

Kriteriahasil:Mempertahankanhidrasiadekuatdibuktikandengan:tandatandavitalstabil,nadi
periferteraba,pengisianperiferbaik,membranmukosalembabdankeluaranurintepat.
Rencanatindakandanrasional
a).Awasikeluarantiapjambiladiindikasikan.Perhatikankeluaran100200ml/.
R/Diuresisiyangcepatdapatmengurangkanvolumetotalkarenaketidaklcukupanjumlahnatrium
diabsorbsitubulusginjal.
b).Pantaumasukandanhaluarancairan.
R/Indikatorkeseimangancairandankebutuhanpenggantian.
c).Awasitandatandavital,perhatikanpeningkatannadidanpernapasan,penurunantekanan
darah,diaforesis,pucat,
R/Deteksidiniterhadaphipovolemiksistemik
d).Tingkatkantirahbaringdengankepalalebihtinggi
R/Menurunkankerjajantungmemudahkanhemeostatissirkulasi.
e).Kolaborasidalammemantaupemeriksaanlaboratoriumsesuaiindikasi,contoh:
Hb/Ht,jumlahseldarahmerah.Pemeriksaankoagulasi,jumlahtrombosit
R/Bergunadalamevaluasikehilangandarah/kebutuhanpenggantian.Sertadapat
mengindikasikanterjadinyakomplikasimisalnyapenurunanfaktorpembekuandarah,
4)Ansietasberhubungandenganperubahanstatuskesehatanataumenghadapiprosedurbedah.
Tujuan:Pasientampakrileks.
Kriteriahasil
Menyatakanpengetahuanyangakurattentangsituasi,menunjukkanrentangyangyangtepattentang
perasaandanpenurunanrasatakut.
Rencanatindakandanrasional
a).Dampingikliendanbinahubungansalingpercaya
R/Menunjukkaperhatiandankeinginanuntukmembantu
b).Memberikaninformasitentangprosedurtindakanyangakandilakukan.
R/Membantupasiendalammemahamitujuandarisuatutindakan.
c).Dorongpasienatauorangterdekatuntukmenyatakanmasalahatauperasaan.
R/Memberikankesempatanpadapasiendankonsepsolusipemecahanmasalah
5)Kurangpengetahuantentangkondisi,prognosisdankebutuhanpengobatanberhubungandengan
kurangnyainformasi
Tujuan:Menyatakanpemahamantentangprosespenyakitdanprognosisnya.
Kriteriahasil
Melakukanperubahanpolahidupatauprilaskuysngperlu,berpartisipasidalamprogrampengobatan.

Rencanatindakandanrasional
1.

Dorongpasienmenyatakanrasatakutpersaandanperhatian.

R/Membantupasiendalammengalamiperasaan.
1.

Kajiulangprosespenyakit,pengalamanpasien

R/Memberikandasarpengetahuandimanapasiendapatmembuatpilihaninformasiterapi.
Postoperasi
1)NyeriberhubungandenganspasmuskandungkemihdaninsisisekunderpadaTURP
Tujuan:Nyeriberkurangatauhilang.
Kriteriahasil:
1.

Klienmengatakannyeriberkurang/hilang.

2.

Ekspresiwajahklientenang.

3.

Klienakanmenunjukkanketrampilanrelaksasi.

4.

Klienakantidur/istirahatdengantepat.

5.

Tandatandavitaldalambatasnormal.

Rencanatindakan:
1.

Jelaskanpadakliententanggejaladinispasmuskandungkemih.

R/Kiendapatmendeteksigajaladinispasmuskandungkemih.
1.

Pemantauanklienpadaintervalyangteraturselama48jam,untukmengenalgejalagejala
dinidarispasmuskandungkemih.

R/Menentukanterdapatnyaspasmussehinggaobatobatanbisadiberikan
1.

Jelaskanpadaklienbahwaintensitasdanfrekuensiakanberkurangdalam24sampai48jam.

R/Memberitahuklienbahwaketidaknyamananhanyatemporer.
1.

Beripenyuluhanpadaklienagartidakberkemihkeseputarkateter.

R/Mengurangkemungkinanspasmus.
1.

AnjurkanpadaklienuntuktidakdudukdalamwaktuyanglamasesudahtindakanTURP.

R/Mengurangitekananpadalukainsisi
1.

Ajarkanpenggunaanteknikrelaksasi,termasuklatihannafasdalam,visualisasi.

R/Menurunkanteganganotot,memfokuskankembaliperhatiandandapatmeningkatkankemampuan
koping.
1.

Jagalahselangdrainaseurinetetapamandipahauntukmencegahpeningkatantekananpada
kandungkemih.Irigasikateterjikaterlihatbekuanpadaselang.

R/Sumbatanpadaselangkateterolehbekuandarahdapatmenyebabkandistensikandungkemih
denganpeningkatanspasme.

1.

Observasitandatandavital

R/Mengetahuiperkembanganlebihlanjut.
1.

Kolaborasidengandokteruntukmemberiobatobatan(analgesikatauantispasmodik)

R/Menghilangkannyeridanmencegahspasmuskandungkemih.
2)Resikotinggiinfeksiberhubungandenganprosedurinvasif:alatselamapembedahan,kateter,
irigasikandungkemihsering.
Tujuan:Klientidakmenunjukkantandatandainfeksi.
Kriteriahasil:
1.

Klientidakmengalamiinfeksi.

2.

Dapatmencapaiwaktupenyembuhan.

3.

Tandatandavitaldalambatasnormaldantidakadatandatandashock.

Rencanatindakan:
1.

Pertahankansistemkatetersteril,berikanperawatankateterdengansteril.

R/Mencegahpemasukanbakteridaninfeksi
1.

Anjurkanintakecairanyangcukup(25003000)sehinggadapatmenurunkanpotensial
infeksi.

R/.MeningkatkanoutputurinesehinggaresikoterjadiISKdikurangidanmempertahankanfungsi
ginjal.
1.

Pertahankanposisiurobagdibawah.

R/Menghindarirefleksbalikurineyangdapatmemasukkanbakterikekandungkemih.
1.

Observasitandatandavital,laporkantandatandashockdandemam.

R/Mencegahsebelumterjadishock.
1.

Observasiurine:warna,jumlah,bau.

R/Mengidentifikasiadanyainfeksi.
1.

Kolaborasidengandokteruntukmemberiobatantibiotik.

R/Untukmencegahinfeksidanmembantuprosespenyembuhan.
3)Resikotinggicidera:perdarahanberhubungandengantindakanpembedahan.
Tujuan:Tidakterjadiperdarahan.
Kriteriahasil:
1.

Klientidakmenunjukkantandatandaperdarahan.

2.

Tandatandavitaldalambatasnormal.

3.

Urinelancarlewatkateter.

Rencanatindakan:

1.

Jelaskanpadakliententangsebabterjadiperdarahansetelahpembedahandantandatanda
perdarahan.

R/Menurunkankecemasankliendanmengetahuitandatandaperdarahan
1.

Irigasialirankateterjikaterdeteksigumpalandalmsalurankateter

R/Gumpalandapatmenyumbatkateter,menyebabkanperegangandanperdarahankandungkemih
1.

Sediakandietmakanantinggiseratdanmemberiobatuntukmemudahkandefekasi.

R/Denganpeningkatantekananpadafosaprostatikyangakanmengendapkanperdarahan.
1.

Mencegahpemakaiantermometerrektal,pemeriksaanrektalatauhuknah,untuksekurang
kurangnyasatuminggu.

R/Dapatmenimbulkanperdarahanprostat.
1.

Pantautraksikateter:catatwaktutraksidipasangdankapantraksidilepas.

R/Traksikatetermenyebabkanpengembanganbalonkesisifosaprostatik,menurunkanperdarahan.
Umumnyadilepas36jamsetelahpembedahan.
1.

Observasi:Tandatandavitaltiap4jam,masukandanhaluarandanwarnaurine

R/Deteksiawalterhadapkomplikasi,denganintervensiyangtepatmencegahkerusakanjaringanyang
permanen.
4)ResikotinggidisfungsiseksualberhubungandenganketakutanakanimpotenakibatdariTURP.
Tujuan:Fungsiseksualdapatdipertahankan
Kriteriahasil:
1.

Klientampakrileksdanmelaporkankecemasanmenurun.

2.

Klienmenyatakanpemahamansituasiindividual.

3.

Klienmenunjukkanketerampilanpemecahanmasalah.

4.

KlienmengertitentangpengaruhTURPpadaseksual.

Rencanatindakan:
1.

BerikesempatanpadaklienuntukmemperbincangkantentangpengaruhTURPterhadap
seksual.

R/Untukmengetahuimasalahklien.
1.

Jelaskantentang:kemungkinankembaliketingkattinggisepertisemuladankejadian
ejakulasiretrograd(airkemihsepertisusu)

R/Kurangpengetahuandapatmembangkitkancemasdanberdampakdisfungsiseksual
1.

Mencegahhubunganseksual34minggusetelahoperasi.

R/Bisaterjadiperdarahandanketidaknyamanan
1.

Dorongklienuntukmenanyakankedoktersalamadirawatdirumahsakitdankunjungan
lanjutan.

R/Untukmengklarifikasikekhatirandanmemberikanakseskepadapenjelasanyangspesifik.

5)Kurangpengetahuan:tentangTURPberhubungandengankuranginformasi
Tujuan:Kliendapatmenguraikanpantangankegiatansertakebutuhanberobatlanjutan.
Kriteriahasil:
1.

Klienakanmelakukanperubahanperilaku.

2.

Klienberpartisipasidalamprogrampengobatan.

3.

Klienakanmengatakanpemahamanpadapantangankegiatandankebutuhanberobat
lanjutan.

Rencanatindakan:
1.

Beripenjelasanuntukmencegahaktifitasberatselama34minggu.

R/Dapatmenimbulkanperdarahan.
1.

BeripenjelasanuntukmencegahmengedanwaktuBABselama46minggu;danmemakai
pelumastinjauntuklaksatifsesuaikebutuhan.

R/Mengedanbisamenimbulkanperdarahan,pelunaktinjabisamengurangikebutuhanmengedanpada
waktuBAB
1.

Pemasukancairansekurangkurangnya25003000ml/hari.

R/Mengurangipotensialinfeksidangumpalandarah.
1.

Anjurkanuntukberobatlanjutanpadadokter.

R/.Untukmenjamintidakadakomplikasi.
1.

Kosongkankandungkemihapabilakandungkemihsudahpenuh.

R/Untukmembantuprosespenyembuhan.
6)Gangguanpolatidurberhubungandengannyeri/efekpembedahan
Tujuan:Kebutuhantidurdanistirahatterpenuhi.
Kriteriahasil:
1.

Klienmampuberistirahat/tidurdalamwaktuyangcukup.

2.

Klienmengungkapansudahbisatidur.

3.

Klienmampumenjelaskanfaktorpenghambattidur.

Rencanatindakan:
1.

Jelaskanpadakliendankeluargapenyebabgangguantidurdankemungkinancarauntuk
menghindari.

R/meningkatkanpengetahuankliensehinggamaukooperatifdalamtindakanperawatan.
1.

Ciptakansuasanayangmendukung,suasanatenangdenganmengurangikebisingan.

R/Suasanatenangakanmendukungistirahat
1.

Berikesempatanklienuntukmengungkapkanpenyebabgangguantidur.

R/Menentukanrencanamengatasigangguan
1.

Kolaborasidengandokteruntukpemberianobatyangdapatmenguranginyeri(analgesik).

R/Menguranginyerisehinggaklienbisaistirahatdengancukup.
1.

Implementasi

Padalangkahini,perawatmemberikanasuhankeperawatan,yangpelaksanaannyaberdasarkanrencana
keperawatanyangtelahdisesuaikanpadalangkahsebelumnya(intervensi).
1.

EvaluasiKeperawatan.

Asuhankeperawatandalambentukperubahanprilakupasienmerupakanfocusdarievaluasitujuan.