Anda di halaman 1dari 144

KCINJ$qllR uK$u UAII,]AN

RAYA

c-{-

SUKI

PHffiENfrEF$ffi&ru P- ffiP-F.:Ft

ti

1[

FeH,/-}tr ffi&Y,e,

i.
. '.i
.:;
r

.,

'

' ri$*

l''

,- -.,- *.
r.s : .,_-.:

:-

_.-....:.::...ix:"-'**:"t:;'-:.:*W8qii{4.-//' :
-. ., r..

,/,

L,l,

,'

#f,

f-di;*I

;t.! , ,

^ffitd;S,:p$fimlBfistrfl

u;.-ffi,

fr{}ryix

ffi&,t{*}ulf{{d

*iroi

".:

ECTI{$ 2

PERfi NCf, l{Gf, N PERKERf,Sf,

,61fiil Rf,Yf,
IR. |{A&\IRFIAN SAODANG

MSCTT

PENDRBII NOVA
Kotak Poc l4rBA BANDIING

il

Saodang, Hamirhan

tr(onstruksi Jalan Eaya /


3

iil.

Cetakon l.
x 23 cm.

oleh Hcmirhan Soodong


------ Bcndung : Nova, 2oo5.

16

(rt(gt<rt<a(8(4tcqt@t<*r$@t(6<rt(8<gt<qt<$(rt(rt(6<a(fi<4t<8<qt(8<8<qt@tca<8cs(8(8

Buku:

1.
2.
3.

GE0METRTKJATAN.

JAilIN MYA.
STRUKTUR & KoNSTRUKSI JAIIIN RAYA.

PERANCANGAN PERKERASAN

Bibliografi

dideniftaaifran untuft

zhlm.24t
keduo o,r0r4g tuo , don

ISBN 979 - 95847 -2-8


ISBN 979-95847-3-6
ISBN 979 - 95847 - 4- 4
ISBN 979-95847 -5-2

1.

Jalan

no.iil. lengkcrp)

iil.

beLuatgabu

i11.2

iil.3

Raya l.

r,itodL,l;l*,

aW,l,;-

KONSTRUKSI JAI-AN RAYA


625.7

Hak cipta dilindungi Undang

undang.

Dilarang memperbanyak karya tulis ini sebagian atau seluruhnya,


termasuk stensil, fotokopi,
dalam bentuk dan dengan car^
^p^pun,
tanpa ijin tertulis dari penerbit.

<qtgt(gtcqtgtcgt<a(qt@tc$<rt(g(g<rt<B(8<8<8(8<A<4t(8<rt<8(fi

KATA

PtrDSGAB$TAR

Posisi Perkerasan Jalan didalam Konstruksi Jalan Raya sangat


sentral mengingat perkerasan adalah esensi didalam struktur jalanJalan
Raya selalu menuntut keberadaan perkerasan yang kuat,tahan
lama,nyaman,murah tepat sasaran dan banyak hal lagi. Ini semua merupakan
indikator dari keingin^n
jalan raya berfungsi sebagaiman,
-..tirryr.
^gar
Untuk mendapatkan fungsi
yang baik tentunya memedukan dua hal yaitu
pef.anc ngan yang sempufna dan keberhasilan pelaksanaan agar sesuai
dengan r^nc flgan.

Buku 2 : Perancangan Perkerasan Jalan Raya ini membahas


perancangan perkerasan jalan raya baik perkerasan lentur maupun
perkerasan kaku. Dengan mengedepankan prinsip-prinsip dari kedua
perkerasan,konsep dasar dan metodologi perancangan. Dibagian akhir
diselipkan pera,ncang n perkerasan lenrur yang bersifat aplikatip untuk
mencoba menjelaskan sejauh mana perkembangan sistem perkeiasan di
Indonesia.

Seperti sudah dijelaskan sebelumnya pada Buku 1: Geometrik


buku
yang pen),usun terbitkan,tidak terkait langsung saru sama
Jalan,ttga
lain,sehingga siapapun yanghanya berniat untuk memiliki salah satu saja dai
ketiga buku tidak akan kehilangan konteks permasal ahan.p ada kenyataannya
memang dalam kurikulum nasional Geometrik Jalan dzn perkerasan
Jalan
telpisah sendiri-sendiri,walaupun ada koneksitas permasalahan.Sehingga
pen)^rsun mengikuti pola pemisahan tersebut,dan bahkan dilengkapi dengan
renc n Buku 3: Struktur dan Konstruksi Jalan yang merupakan bahasan
teknik-teknik pelaksanaan konstruksi jalan.

Buku 1 Geometrik Jalan diterbiikan Juni 2004 dan Buku 2

Perancangan PerkerasanJalan Raya ini direncanakan awal tahun 2005 paling

lambat kuartal peftaLm^ sudah bisa diterbitkan juga.

Sengaja penulis mengambil kosa kata pefancangan bukan


perencanaan karena pengertian perancangan bermakna lebih luas dari pada
perencanaan. Materi perkerasan jilan ttda.k hanya merencanakan perkerasan
saja,berapa tebal perke r^san,apa j enis perkerasan,materi al apa pembentuk

I(aa

lPengwtar

1rc'rlicmstn dan lain-lain,tapi fuga mempunyai pengertian bagaimana dasar


pemikiran konsep dalam penentuari suatu kebutuhan perkerasan. Bagaimana
pula design prlcess samp4i terpilihnya suatu bentuk perkerasan. Interaksi apa
dan dimana kedudukar[ perker4san jalan terhadap suatu sistem manajemen
ialan datr dimana pula fosisinya dalam pengembangan sara;n dan prasarana
transportasi. \X/alaupun penulis tidak membahas itu semua,tapi penulis
beranggapan bahwa istilah perancangan lebih tepat digunakan didalam
pengertian dan kedudukan perkerasan jalan yang merupakan salah satu
elemen transportasi,berfungsi untuk mengakomodir seluruh perencanaanperencan an lain untuk membentuk suatu sistem transPoftasi secara
keseluruhan.

Akhirul kata penulis sangat

mengharapkan bilamana ada


masukan-masukan untuk perbaikan penfrsunan yang lebih lengkap dari
buku peranc ng rr perkerasan ialanrayairu.

DAFTARl
HALAMANJUDUL
KATA PENGANTAR

DAF'TAR ISI

iii

BAB

Wassalam.

PENDAI{ULUAN

1.1.

Lingkup Bahasan

1.2.

Istilah dan Pengerttannya.

-)

Bandung, akhir tahun 2004.

BAB 2

KRITERIA PERANCANGAN PERKERASAN JALAN

2.1.
2.2.
2.3.
2.4.
2.5.

PENUL[S.

BAB 3

BAB 4

Perancangan................. ..
Pendekatan Metoda Perancangan.................
I(onsep Perancangan PerkerasanJalan
Kriteria Perancangan PerkerasanJalan........
Paramater Perancangan PerkerasanJalan
Kriteria Dasar

17

22

24
25
25

ELEMEN STRUIffUR PERKERASAN JALAN

3.1.

KelompokStrukturJalanLentur

JJ

3.2.

Kelompok Struktur Jalan Kaku.....

57

J.-).

Elemen Struktur Perkerasan Interblock

/-t

METODA PERANCANGAN PERKERASAN JAI-AN

4.1,. Pengertian Umum Perwufudan


4.2. MekanismeKerusakan

Perkerasan.

77
78

Doftar lsi
4.3.
4.4.

BAB

Penr,,uiudan
Metoda Perancangan.................
Penilaian

152

Bahan Tanah

5.2. Pasir...........
5.3. Bahan Agregat......
5.4. Bahan Aspal
5.5. Campuran Bitumen....

154
158

162

Pemeriksaan Bahan Perkerasan Jalan Lentur

164

5.7.

Pemeriksaan Bahan Campuran Aspa1..........

168

Institute.....

170

199

5.10. Metoda Perancangan Campuran Aspal......

204

SISTEM PERANCANGAN PERKERASAN JALAN


6.1.

Proses P erancangan.................

224

6.2.

T ahapan Pro ses

229

6.3.

P er

ancangan .................

?eno$flwuqn

154

5.6.

5.8. Job Mix Design @esain Campuran)


5.9. Metoda Rancangan Campuran dari Asphalt

81

RANCANGAN BAHAN PERKERASAN JAI-AN

5.1.

BAB

79

230

DAFTAR PUSTAKA.

243

DAFTAR LAMPIRAN

245

Lampiran A

246

Lampiran B

251.

Lampiran C

263

erkerasan]alan adalahbagian dari jalur lalu lintas,yang bila kita


perhatikan secara strukturil pada penampang melintingialan,
merupakan penampang strukrur dalam kedudukan yang paling
dalam suatu badan jalan. Lalu lintas langsung terkonsentrasi pada
bagian ini,dan boleh dikatakan merupakan urat nadi dari suatu konstruksi
jalan. Perkerasan jalan dalam kondisi baik maka arus lalu lintas akan berjalan
dengan lancar, demikian sebaliknya kalau perkerasan ialan rusak,lalu lintas
akan sangat terganggu.
Apapun jenis perkerasan lalu lintas,dia harus dapat memfasilitasi
sejumlah pergerakan lalu lintas,apakah berupa jasa angkutan manusia,arau
jasa angkutanbanng berupa seluruh komoditas yang diiiinkan untuk berlalu
lalang disitu. Dengan beragam jenis kendaraan dengan angkutan banngnya,
akan memberikan variasi beban sedang sampai berat,jenis kendaraan
penumpang akan memberikan pula sejumlah variasi beban ringan sampai
sedang. Ini harus dapat didukung oleh perkerasan jalan.Daya dukung

6V)
lyf
<
sentral

perkerasan ialan ini,akan menentukan kelas jalzn yani

bersangkutan,misalnya jalan kelas I akan menerima beban yang lebih


besar,dari jalan kelas Il,sehingga sudah banngtentu mutu bahan p.rt.rur".,
jalan,akan disyaratkan berbeda sesuai dengan kualifi kasi pembebanannya.
)aringan jalan di Indonesia,tersebar meluas keseluruh pelosok yang
dapat dijangkau transportasi darat. Mengingat luasnya cakupan wiiayrh
transportasi, dan dengan belum seimbangnya kemampuan sumber
dana,masih banyak daerah yaflg belum dapat dijangkau oleh
transportasi,sehingga mungkin dibanyak tempat masih belum seimbangnya
pras^r^na jalan,dengan kebutuhan yang ada. Barangkah bznyak desa-desa di

Xon6cfiuKa) 74J,4ll

B^KA 2 : PER,4No,+NqAN

PERKER.4SANJAL-qN

Irrcloncsia yang masih bertumpu hanya pada jalan setapak,sebagai satusatunya pr^szrzn penghubung dengan desa lainnya. Sehingga sudah barung
tcntu perkerasan jalan-nya belum terbentuk,masih berupa ialan-jalan tanah
alamiah. Namun demikian dari tinjauan historis ialzn, jilan-ialan seperti
inilah yang akan meniadi cikal-bakal perkerasan ialan dimasa yang akan
datang.

Untuk tfi)

dipahami bahwa:
* )alan harus direncanakan sehingga sesuai dengan kebutuhan lalu
lintas yang akan dilayani pada ruas tersebut.
tr Jalan harus direncznakan dengan standar teknik yang masuk
akal,yang ditetapkan oleh irrstansi yang berwenang.
* Jalan harus dibangun dalam keterikatan waktu,tenaga dar, dana
yang bias an y a terbatzs.
* Perhatian harus diberikan pada pengaruh dampak lingkungan
daenh sekitarnya.
* Jalan harus dibangun dengan tetap meniaga keseimbangan wilayah.
* Jalan agar dibangun dengan tuiuan yang tertentu,belpotensi untuk
pengembangan wtlayah,pengembang n ekonomi ataupun untuk
tuiuan lainnya yang memang sangat diperlukan.
Dengan maksud-maksud diatas,mungkin saia dengan tambahan
pelaksana Lta:u badan y^flg terkait harus
lain,para perencana
^t^r7
mengikutinya sebagai suatu komitmen kerja.
^gar

1.I. LINGKUP

- Buku 2

Petancangan

0 I(riteria Perancangan Jalan, meliputi Konsep f)asar Perancangan


[)asar Teoritis
0 h ualifikasi Perkerasan Jzlan
0 I rlt'men Struktur Perkerasan Jalan
0 l\lt'torla Rancangan Perkerasan Lentur
l i\lct,tlt Rancangan Perketasan I(aku
(i ll,rlr;rrr l)crkerasan dan Pengujiannya
I' r,r,,I( nr I)t'rrrncangan PerkerasanJalan
l',r,l.r l,,rlr:rs;rn y^ng memedukan tambahan penjelasan,biamana
dl*tr41e ;, 1,, r r r.,r l. :r r r I i bcrikan contoh perhitungan.
r

1.2.I. BE,BAN LALU LINTAS.


(1). Sunai lalulintas (trafftc counting)

Untuk mendapatkan pral<traan lalulintas yang representarif,dalam


rangka menghitung ahranlaht lintas,selamaiangka desain ,.n
5,10 atau
^n^
20 tahun yang dipedukan untuk desain struktur perkerasan,dilakukan
survai
lalulintas untuk menentukan :

,)

Lalulintas Harian Rata-Rata tahunan (LHR) pada setiap ruas


jalan.

ii). Identifikasi jenis dan berat sec t^ umum dari setiap

kategori

kendaraan.

iii). Distribusi model lalu lintas pada setiap ruas jalan.


iv). Perkiraan kecepatan operasi normal pada setiap ruas jalan.
'Perhitungan lalu lintas dilakukan dengan cara mencacah/menghitung
kendaraan yang lewat pada pos-pos pencaratan lalu lintas yang telah
ditentukan. Pencacahan/perhitungan dilakukan pada formulir lalu lintas
diisikan sesuai dengan klassifikasi kendaraan.

\waktu pelaksanaan survai lalu lintas tergantung keteritian yang


diinginkan dan target peranc ng n. Umumnya dibagi rn".rjrdi 3 kelompof,

1.. Kategori A.

I)crkerasan Jalan ini,adalah :


0 Metoda lJmum Perancangan

7.2. ISTII.AH DAN PENGERTIANI{YA.

yaitu:

BAHASAN.

Cakupan dari buku I(onstruksi Jalan

Pendahuluan

2.
3.

Kategori B dan
Kategori C
Survai lalu lintas kategori A dilakukan selama 72 jamdengan 3x4 periode
sebagai berikut:
- periode 1: jam 24.00 - 06.00
- periode 2: jam 06.00 - 12.00

periode3:jam

12.00

- 18.00

periode 4:jam 18.00 - 24.00


Survai lalu lintas kategori B dilakukan selama 36
iamdengan 2x3 periode
sebagai berikut

periode 7 : jam 06.00 - 12.00


periode 2: jam 12.00- 18.00
periode 3 : jam 18.00 - 24.00

4,1orl6c41lt<6J7,rJ,4rl

Bt

Kq 2:

PER^NoANqANPER'KERASANJAI-AN

Pendahuluan

Survai lalu lintas kategori C dilakukan selama 24 iamdengan 2x2 periode


sebagai berikut
- periode 7 : jam 06.00 - 12.00
- periode 2 : iam 12.00 - 18.00

CATATAN: Untuk ialan-ialan strategis dapat saia

.Pencacahan jumlah kendaraan untuk setiap arah lalu lintas,harus dibuat


terpisah,kecuali untuk lalu lintas dengan hznya satu arah. Pencacahan selalu
memasukkan han-harr padat,bahkan pada pos persimpangan
padat,dilaksanakan pada jam-jam sibui< pagi,siang dan sore bersamaan
dengan pencacahan lalu lintas pada pos yang berada diruas ialan.
Jam-jam sibuk tersebut adalah :
i.
iam sibuk pagi ^ntar fam 07.00 - 09.00.
ii.
iam sibuk siang antara iam 1'2.00 - 14.00.
iii. j^^ sibuk sore
iam 14.00 - 16.00.
^ntar^ tingkat pertumbuhan,maupun
.Kelas rertcain lalu lintas,kelas kendaraan
dan
beban gandar merupakan pz:i: metef desain lalu lintas yang harus didapatkan
atau diasumsikan berdasarkan data realistis dilapangan sesuai survai ini.
Lokasi Pos Lalu-lintas.
Lokasi pos-pos survai ditentukan terutama pada

a.
b.
c.
d.

Jalan-jalan masuk danialan-ialan keluar kota.


pada jalur-ialur ialan arten dan kolektor.

Titik simpul

Tempat-tempat yang dianggap penting dalam kota'


Simpang yangpadat arus lalu lintas.

.Identifikasi dan pencacahanlalu lintas dalam dua kelompok,yaitu kelompok


bukan kendaraan bermotor,dan kelompok kendaraan bermotor yang
dipecah lagi meniadi kelompok fenis kendaraan sbb.:

- Sepeda motor,scooter dan sepeda kumbang.


- Kendaraan bermotor rcda 3 (seperti bemo,helicak
-

dll.)
Mobil penumpang (seperti sedan,station-wagon,ieeP,combi, opelet,
pickup dan suburban).Yang termasuk kelompok ini adalah semua
kendaraan bermotor roda-4 untuk zngkutan penumpang dengan
maksimum 10 orang termasuk pengemudi. Pickup yang dibuat

untuk mengangkut penumpang termasuk golongan ini iog,


(misalnya pickup opelet,colt-diesel dll.)

ini adalah semua kendaraan yang


digunakan untuk angkutan penumpang,dengan jumlah t.*p"i
duduk yangadauntuk 20 orungatau lebih termasuk pengemudi.
Bis. Yang rermasuk golongan ini adalah semua kendaraan yang
digunakan unruk angkutan penumpang dengan jumlah 40 otangatai

lebih termasuk pengemudi.


- Pickup dan Mobil Angkutan. Yang termasuk kelompok ini adalah
semua kendaraan bermotor rodz-4 ftec,pali truck),yang dipakai
untuk angkutan barung.
I
- Mikrotruck. Yang termasuk kelompok ith adalah semua kendaraan
bermotor rcda-4 ftecuali truck),yang dipakai untuk angkutan barang
dengan tonase 2,5 ton,termasuk mobil tangki.
- Truck dengan 2 as,termasuk mobil tangki.
- Truck dengan 3 as artau lebih,termasuk mobil tangki.
- Mobil gandengan dan semi trailer.
- Sepeda yang ditarik manusia (termasuk becak) dan hewan.
-rKendaraan yang ditarik hewan seperti pedati,sado,delmin dll.
Sedangkan kendaraan lain misalnya:mesin gilas,kendaraan militer
(seperti tank) tidak dihitung.

dilaksanakan waktu

pelaksanaan 7x24 iarn dengan katcgori A.

'

. - Mikrobis. Yang termasuk golongan

Q). Beban Sumba Standar ( Equiualent Standard Axle ).


Beban perkerasan ialan diasumsikan hanya akibat beban hidup yaitu
beban lalulintas sajl-,sedangkan beban mati,relatif kecil dan diabaikan. Beban
rencana lalulintas,merupakan sejumlah repetisi beban sumbu standar.
Beban sumbu standar dalam perancangan perkerasan adalah berupa
sambuf as tungal, mda ganda seberat l8 kips atau 18.000 lbs atau s,l d ton.

beban

Angka Ekivalen (AE) atau Equivalent Axle Load (EAt ) suatu beban
sumbu standar,adalah jumlah lintasan kendaraan as tunggal sebesar 1g kips
yang mempunyai derajat kerusakan @F = damage fzctor),yang sama bila
jenis as tersebut lewat satu kali. Dapat diartikan pula bila suaru as kendaraan
lewat satu kali = as 18 kips lewat AE kali.
Beban sumbu standar mempunyai

DF =

1.

Angka Ekivalen (AE) masing-masing golongan beban sumbu tirp


kendaraan, ditentukan dengan rumus berikut ini:

-i).

AE.u*burunssr

( bebansatusumbutunggaldalamkg\a

8160

t1dyl664w$a7424r1

-ii).
-iii).

AE.u-burandem

AE

.u-r,,

ByIK;L

2 : PERANCAN4ANPERKER^SANJALAN

= o,oao (bebansatu

r.i,r,- = 0,053 (beban

sumulrllnssal aahm*s)*

Pendahuluan

MSTr,-b**ngg"r

MST.,^b,,".a"_

MSTr,_t,

7.2.2.

FjLEMEN PENAMPANG JALAN.


\

Beban Gandar
18000 Lbs. = 18 KIP = 8,16 Ton

Gbr 1.1. Beban Sumbu/Gand^t

(3). Konfgarasi Sambu dan Pembebanan.

Kendaraan sec r^ nyata dllapaingzn mempunyai beban total yang


berbeda,tergantung pada berat sendiri kendaraan dan muatan y^ng
diangkutnya. Beban ini terdistribusi ke perkerasan ialan melalui sumbu
kendaraan,selaniutnya roda kenda rzan bart ke perkeras an ialan. Makin berat
muatan akan memedukan jumlah sumbu kendaraan yang makin banyak,agar
muaran sumbu tidak melampaui muatan sumbu y^ng disyaratkan.
Pembebanan setiap sumbu ditentukan oleh muatan dan konfigurasi sumbu
kendaraan.

Ada beberapa konfigurasi sumbu kendaraan,yaitu:


2. STRG
3. STdRG
4. STrRG

ua

= 8116 ton
= 15 ton
= 20 ton

dengan konfigurasi MST,sebag aimana terlihat pada Gbr.1 .2.

8,6oh dan 5,3o/o.

1. STRT

3,5ton

dalam hal ini,

san sumlllrlltssat datam ks)o

Dari rumus -diatas dapat dilihat bahwa pengguflaan as tandem atau


tridem sangat menguntungkan karena AE atau DF masing-masing hanya

.MST= 10ton .MST= 8ton oMST= 5 ton danoMST=

-Sumbu
-Sumbu
-Sumbu
-Sumbu

Tunggal Roda Tunggal


Tunggal Roda Ganda
Tandem Roda Ganda
Tridem Roda Ganda.

(MST ).
Masing-masing kelas jalan dtbatasi untuk menefima muztan sumbu
rcrberar agar ialan tidak cepat rusak akibat beban berlebih. Ada 5 ( lima )
katcgori MST, yaitu :
(4). Muatan Sarnba Terberat

0). Jalur l-^alu Lintas, adalah bagsan jalan yang digunakan untuk lalulintas
kendaraan (carriage way,traffrc lane), secara fisik berupa perkerasan jalan.
@. r-{ur adalah bagian jalur lalu lintas yang memanjang,dibatasi oleh
markalajur jalan,memiliki lebar yang cukup untuk dilewati suatu kendaraan
bermotor sesuai kendaraan rencana.

(3), Babu Jalan,adalah bagian jalan yang berdampingan ditepi ialur lalu
lintas, dan harus diperkeras,berfungsi unruk lajur lalu lintas darurat,ruang
bebas samping dan penyangga perkerasan terhadap beban ralu rintas.
(4). Median,adalah baglan ialan yang secara fisik memisahkan dua jalur
lalu lintaq .yang bedawanan arah,grna memungkinkan kendaraan bergerak
cepat dan aman. Fungsi median adalah:memisahkan dua aliran lalu lintas
yang berlaw anzn,rv^ng lapak tunggu penyeberang j alan,penempatan fasilitas
jalan,tempat pras^rana pekerjaan sementara,penghijauan, pimberhentian
darrrat, cadangan laj.,r. dan mengurangi silau dari lampu kendaraan pada
malam hiri dari anhberla'wanan.
(5)." ltrengf talad,adalah bagian tepi perkerasan yang diberi
kemiringan,untuk menyalurkan air ke saluran tepi. Dapat juga berarti lereng
kiri-kanan jalan dari suatu perbukitan,yang dipotong ,rrt.rt pembentukan
badan jalan.

(6)- separator,adalah baglan ialan yang ditinggikan pada ruang pemisah


jalur, biasa ditempatkan dibagian luar dibatasi oleh kerb, untuk mincegah
kendaraan keluar dari jalur.

Pulaa l-,alu Linta:(trffic island),adalah bagian dari persimpangan


O
jalan,yang ditinggikan dengan kerb yang berfungsi untuk mengrrahkr.,
lalulintas,juga sebagai fasilitas pejalan kaki pada saat menunggu kesempatan
menyeberang.

(8). Kanal

Jalan(Cbannel),adalah merupakan bagian persimpangan


sebidang, yang khusus disediakan untuk membeloknya kendaraan,&tandai
oleh marka jalan,atan dipisahkan oleh pulau lalu lintas.

8 tlorl6aqwrl&J7'4J,Au B^Kq 2:

PERANo^NqANPELI4ERASANJAI-AN

tambahan(auxilliary lane),adalah merupakan lalur yang


disediakan untuk belok kiri/kanan atau perlambatanf percePatan kendataan.
(10). Jalur tepian (marginal strip),adalah bagian dari median atau sePafator
luar,disisi bagian yang ditinggikan,yang sebidang dengan ialur lalu lintas,
diperkeras dengan bahan yang sama dengan ialur lalu Iintas,dan disediakan
untuk mengamankan ruang bebas samping dari ialur lalu lintas'
(11). Jatar:epeda (bicycle way),adalah ialur khusus pengendara sepeda dan
becak,biasa ditangrrn seyzjx dengan ialur lalu lintas,namun dipisahkan dari
Fasilitas ini
ialur lalu lintas oleh struktur fisik seperti kerb atau gaardrail.
sangat iarang ditemui di Indonesia,paling-paling hanya berupa jalur lanbal
yang dapat merangkap sebagai ialat frontage..
(12). Jalur parkir\ptarking lane/stopping lane),adalah ialur khusus yang
disediakan untuk parkir atau berhenti,yang merupakan bagian dari ialur lalu
lintas.
(13). Jalur tanaman (planted strip),adalah bag1an dan ialan yang disediakan
untuk penanaman pohon,yang ditempatkan menefus sepaniang ttotox,ialan
sepeda atau bahu ialan.
(14). Jalar lalu lintas lambat,tdalah ialur yang ditentukan khusus untuk
kendaraan lambat.
(15). Jalar putaraz(turning lane),adalah ialur khusus kendaraan y^flg
disediakan pada persimpangan untuk perlambatan,perpindahan ialur dan
untuk menunggu pada saat kendaraan berputar.
(16). Jalur percrpatan/perlanbatan (acceleration/deceleration lane) ,adalah
pada saat
ialur yang diiediakan untuk percepatan /perlambztan kendaraan
akan masuk fkelux jalur lalu lintas menerus.
(17). Penisab luar (outer separation),adalah ruang yang diadakan untuk
memisahkan jalur samping dari ialur lalu lintas menerus,atau untuk
memisahkan ialur lalu lintas lambat dari jalur lain.
(18). Pengaturan jalan masuk (access control),adalah suatu kaidah mengenai
hak falan masuk
ialan masuk,yang ditefapkan melalui suatu atufan dan
umum, dari dan ke tempat-temPat yang ber'ada disepaniang ialan'
(19). Ro*g bebas jalan (clearance of road),adalah ruang pengandaian yang
dibirt pada permukaan ialm yang hanya disediakan untuk kendaraan atau
pejalan kakidimana dalam batas ruang tefsebut tidak diiiinkan adanya
itruktor lain seperti bangunan,fasilitas dan utilitas lainnya bukan untuk
dan
ialan,pohon atau benda tidak bergerak lainnya;selain struktur ialan
utilitas falan(dimensi ruang bebas dapat dilihat pada Gbr.2.9.)

(9). Jalar

Pendahuluon
1.2.3.

ELEMEN STRUI(TUR PERKERASAN JALAN.

Q0).

Badan Jalan,zdalahbagsanialan,yangmeliputi seluruh jalur lalu lintas,

trotoar,median dan bahu jalan,serta talud/lereng badan jalan,yang


merupakan satu kesatuan untuk mendukung beban lalu lintas yang lewat
diatas permukaan jalan.
Q1). Anbang Pengaman,laiur terluar Damaja (ihat Buku 1: Geometrik
Jilan Raya),dimaksudkan untuk mengamankan bangunan konstruksi
ialan,terhadap struktur lain untuk tidak masuk kawasan jalan.

t6T

*I

-ii -i il

Gbr.1.2. Konfigurasi MST = 10 tr 8 t,5 t dan 3,5 t.

Q2) Perkerasan Jalan, adalah lapisan konstruksi yang dipasang langsung


diatas tanah dasar badan ialan pada jalur lalu lintas yang bertujuan
""t"[
menerima dan menahan beban langsung dari lalu lintas.
Q3) Perkerasan Jalan l-,entar\flexlble pavement),bilamanabahanperkerasan
terdiri dari campuranf gabungan aggregat dan aspal.

BltK/. 2 : PER,ANCAN4AN

PERKER;{SAN JALAN

Q4) Perkerasan Jalan Kaka (t grd pavement)disebut iog^ sebagai


perkerasan beton semen dimana bahan perkerasan terdiri dari bahan adukan
beton.
(25). Tanah dasar (subgrade),adalah lapisan tanah asli/tidak asli yang
disiapkan/diperbaiki kondisinya,untuk meletakkan perkerasan ialan.
Q6). I-apis Pondasi Bawah (sub-base course) bagian struktur perkerasan ialan,
yang tedetak diatas lapis tanah dasar,untuk perkerasan lentur biasa terdiri
dari bahan batu pecah,stabilisasi semen,stabilisasi kapur atilr bahan
lainnya;sedang untuk perkerasan kaku,berupa lapis beton kurus.
Q7). Iupit Pondaii Atas @ase-course) adalzh lapisan diatas lapis pondasi
campuran
bawah,pada perkerasan lentur dapa.t berupa
^ggiregat ^t^v
aggregat dan aspal;sedangkan pada perkerasan kaku,lapisan ini tidak ada.
QS) l-nph perruakaan (surface course) lapis paling atas dari perkerasan ialan,
pada perkerasan lentur berupa camPuran aggregat dan aspal,pada perkerasan
kaku berupa pelat beton. Secara alternatif dibawah lapis ini ada binder coarse
iuga berupa campuran aspal dengafl ^ggreg t halus.
Q9) I-.apis ruE pengikat (prime-coat) berupa laburan aspal sebagai bahan
pengikat lapis perkerasan baru dengan lapisan atas berikutnya.
(30) I-^apis peruap (tack-coat) berupa laburan aspal sebagai bahan pengikat
lapis perkerasan lama dengan lapisan diatasnya.

1.2.4. ELEMEN NON-STRUT(rUR PERKERASAN JAr-AN.


(31) L.anskap (I-andscape) dapat berupa laiur sepaniang ialan,setempathanya dilokalisir disuatu tempat saja,merupakan jalur
setempat

^tzu
udara,polusi
meredam polusi
untuk
hijau,berfungsi
lingkungan.
artistik
keindahan
lampu
dan
suara,peneduh,penangkal sinar
c t yang dipasang pada permukaan ialan,untuk
(32) Marka Jalan,tanda
^t^v
menandai garis tengah ialan,garis tepi ialan,batas lajur,dan lainJain.
(33) Patok kilometerdznpatok hektometer,patok menandakan batas 1 km dan
batas ratusan meter disepanjang ruas ialan.
(34) Rambu lalu lintas,berupa tanda-tanda lalu lintas pengarah dan petunfuk
bagi pengemudi.
(35). Trotoar,adalah jahx peialan kaki yang tedetak pada Damiia,diberi
lapisan permukaan,diberi elevasi yang lebih titgg, dari permukaan
lrcrkerasan,dan umumnya sejaiar dengan jalur lalu lintas kendaraan.
(\6)..\'aluran tepi sanpingadalah selokan di kiri-kanany^ng berfungsi untuk
nr('n:rrnlrung dan mengalirkan air hujan,limpasan dari permukaan ialzn dan
,l,r, r,rlr st'l<itarnya lalu membuaingnye- ke saluran alamiah(sungai,danau dll.)

Pendahuluan

1.2.s.

BAHAN PERKERASAN JAr-AN

1.2.5.1.

Material

Material Perkerasan yang umum digunakan di Indonesia,adalah:


c a.Material untuk Lapis Permukaan :
* Struktur ialan dengan campuran aspal
* Struktur jalan dengan beton semen(perkerasan kaku)
slab/pelat beton.
o b. Material untuk Lapis Pondasi Atas :
* Agregat Kelas A.
* Stabilisasi tanah dengan semen,kapu\atatr dengan bahan
kimia.
x Cement Treated Base.
o c. Material untuk Lapis Pondasi Bawah:

* Agregat Kelas B.

Stabilisasi tanah dengan semen, kapur,atau dengan bahan


kimia.

* Struktur beton

semen kurus (perkerasan kaku).

Jens Lapis permukaan


Q7). Bartu,Labuan Aspal Satu Lapis,terdiri dari laburan aspal y^ng
dicampur dengan 8 pph kerosene dan ditutup dengan batuafl
penutup,ukuran nominal 13 mm. Digunakan untuk lalu lintas ringan sampai
1.2.5.2.

sedang.

Q8). Burda,Laburan Aspal dua Lapis,terdiri dari laburan aspal dicampur 8


pph kerosene ditutup dengan dua kali batuan penutup.
Q9). Lqen Lapis Penetrasi Mac Adam,perkerasan untuk pe:.at^ atau untuk
permukaan jalan,terdiri dari lapisan baruan pokok,batuan pengunci dan
batuan penutup,yang dicor dengan aspal panas sehingga membentuk suatu
lapisan yangpadat.
(40). lasbutaglapis Asbuton Agregar,untuk lapis perkerasan perat^
^tz,.
lapis permukaan,terdid dari campuran aspal alam Asbuton,dicampur dengan
t dan bahan modifier,kemudian dihampar dan dipadatkan sebagai
^greg
perkerasan campuran dingin (cold-nix).
(41). I-zsbutag Mikro,mengglnakan Asbuton Mikro,bahan Asbuton yang
sudah dihaluskan,dicampur secarz dingin.
(42). AcAspbaltic conretq merupakan lapis permukaan yang terdiri dari
campuran aspal dan agaeg t yang dicampur secara panas (hot-mix)dlhampar

l2 NdnGGqUtlcJ Ml,4u

Bvl<,y.

2 : PER^NoANqAN PERKER,4S,4NJ,+L-{N

dan dipadatkan membentuk perkerasan yang kedap air. Digunakan untuk


lalu lintas berat.

(43). HRS,Hot Rolled Sbeet,mentpakan campuran hot-mix,sama seperti AC,


dengan gradasi seniang (g@ gradeS.
hanyamenggunakan bahan
^gregat
(44). DGEM,Dense Graded Emalsion Mixes,perkerasan untuk permukaan yang

yang bergradasi rapat,


merupakan campuran aspal emulsi dengan
^gregat
dicampur kemudian dihampar dan dipadatkan secara dingrn.
(45). OGEM,Operu Graded Emahion Mix, sama seperti DGEM hanya
menggunakan agtegat dengan gradasi terbuka.
(46). Slarrl Seal,adalah lapis tipis petkerasan untuk permukaan,merupakan
bubur campuran aspal emulsi dan abu batu,yang dihamparkan pada lapis
perkerasan.

(47). SMA,Split Mastic Asphalt,adalah campuran beton aspal menggunakan


gradasi terbuka,dengan rongga campuran cukup besar' Rongga campuran ini
diisi aspal sehingga kandungan aspal cukup tinggr. Aspal yang digunakan
aspal minyak,yang digunakan pada beton aspal biasa. Kadar aspal yang
tirgg akan mengakibatkan flow camparan aspal yang tinggi pula,sehingga
memungkinkan perubahan plaStis permalren,yang akan mengakibatkan
ruttingpada permukaan jalan. Untuk menghindari hal tersebut,campufan
diberi bahan stabilisasi yang berupa sef^t selulose (misalnya dengan merk
dagang:Technocel,Viatop, Roadcel,Custom Fibre dll). Dalam pelaksanaan
serat sellulose sejumlah kurang lebih 0,3% berat campuran,dicampur dengan
agreg t (drymix) selama 15 detik, sebelum dimasukkan kedalam pwgrnill
(mesin pengaduk campuran pada AMP- lihat Buku 3 : Struktur dan
Konstruksi Perkerasan J alan).
(48). HSMA,High Sffiess Modalus Asphalt, sec rz umum sama seperti SMA
t untuk HSMA mempunyai gradasi khusus,demikian pula
diatas,hanya
^greg
aspal yang dipakai,mempunyai sifat-sifat khusus yang ditentukan dalam
Spesifikasi. Pada pelaksanaan pencampuran di AMP,tidak diperlukan lagi
bahan additif. Dengan demikian prosedur PencamPuran mateial HSMA
sama dengan prosedur pembuatan AC biasa.
(49). BMA,Batonite Mastic AE halt,sebagarmana HSMA,BMA iuga merupakan
campuran dengan agrcgat,sifat camPuran dan aspal yang ditetapkan secara
khusus dalam spesifikasi. Prosedur pencamPufan sama seperti pencampuran
AC biasa. Aspal BMA adalah aspal hasil olahan dan 67oh bahan aspal buton
(Asbuton),28% aspal minyak pen 80/100,dan 5o/o modifier. Secara
pemasafan BMA tersedia berupa aspal dengan susunan material 50%o
bitumen, dan 5Oo/o filler mineral. Mengingat BMA mengandung 50%o filler,
dalam pelaksanaan bila digunakan tangki suplai aspal AMP biasa,harus
r filler dapat dipompakan bersamaditambahkan pompa aspal khusus
^g

Pendahuluan

l3

sama dengan aspal. Demikian pula pada tangki aspal,pedu ditambahkan


pengaduk agar tidak terjadi segregasi aspal dengan filler,pada saat
pemompaan aspal * filier ke pugmill.
(50). Beton Aspal Mldirted dengan Cberncrete (Ac-Acl0,campuran dan gradasi
AC-ACM sama dengan campuran dan gradasi beton aspal biasa, demikian
pula aspal minyak yang dipakai,hanya diberikan additif chemcrete @ahan
kimia) sebanyak 2oh dari berat aspal yang ada dalam campuran. Pada
pelaksanaan bahan chemcrete ditempatkan pada tangki khusus,kemudian
dialirkan dengan pompa melalui pipa pemasok aspa[ kedalam pugmill.
(51). Beton Arpal Modfied dengan Gilsonite (AC-Gil.),sama dengan campuran
dan gradasi beton aspal biasa,demikian pula aspal minyak yang dipakai.
Hanya campuran diberi bahan additif Gilsonite,sebanyak 8oh dz:il. bent
aspal dalam campuran untuk weaing coarse - lapis permukaan aus;dan 1,0o/o72oh dari berat aspal dalam campuran untuk binder czurse - lapis permukaan
binder. Dalam pelaksanaan dilapangan,pemberian additif gilsonite,dilakukan
dengan mencampur bahan dengan
(drymix) selama 15 detik, sesuai
jumlah prosentase diatas,sebelum ^gregat
dimasukkan langsung kedalam pugnill
(mesin pengaduk campuran pada AMP- lihat Buku 3 : Struktur dan
Konstruksi Perkerasan).
Jenis perkensan pada butir (47) sampai (51),adalah jenis perkerasan
khusus,yang digunakan oleh Bina Marga pada ruas-ruas jalan dengan kondisi
lalu lintas sangat padat dan frekuensi sangat tirgs dalam rangka mengadopsi
perkembangan teknologi dalam bidang jalan.
1.2.5.3. Kondisi Perkerasan Jalan
(52) Segnn Jalan Homogen adalah sepotong ruas ialan secara fisik mempunyai
karakteristik y^ng sempa yaitu karakteristik:volume lalu lintas
(I-HR/AADT),lebar perkerasan ialan,tingkat kerusakan ialan(SDf) dan
kekasaran permukaan ialan (IR!.
(53) Suface Distress Index (SDI)
tingkat kerusakan permukaan
^ta:u
ukuran
gabungan
kondisi
kerusakan
permukaan jalan,meliputi
ialzn,adalzh
bekas-bekas roda,retak-retak,pelepasan butir,lubang-lubang,kerusakan tepi
dan kekasaran permukaan.
(54) International Roagbnus Index QRI) angka skala dari kekasaran permukaan
yang mengakumulasi bentuk kekasaran disebabkan depression(amblesan)
akibat berbagai faktor,yang menunjukkan kenampakan permukaan yang

tidak mulus,amblesan kecil,amblesan ber-ulang-ulang sampai amblesan


dalam.

l1 XOnCG4UT$,rr41J'yl

Bt;tKw

2:

PERANoANqANPEeKER,+SANJAu+N

(55) Indek: Pennakaan[P),adalah nilai kerataan dan kekokohan permukaan


perkerasan dihubungkan dengan tingkat pelayanan yang diberikan oleh
ialan.
(56) Pruent Seniceabiliry Index QSl),rating(peringkat) dari kemampuan ialan
memberikan pelayanan terhadap lalu lintas dalam tingkatan memberikan
kenyamanan bag pengendara.
(57) I n di kator Ki neja J alan adalah rating kenampakan perwuiud zn ialan dalam
hubungan kinerja suatu ruas ialzn. Indikator kineria ini merupakan

gabungan dari IR[,Indeks BOK@iaya Operasi Kendaraan) dan kecepatan


kendaraan.Sebagai contoh kinerja jalan=l arinya permukaan ialan
mulus(IR[ rendah) dan tidak ada kemacetan(kecepatan tinggi) memberikan
bizya operasi kendaraan rendah.
(58) Data Jalan terdir dari Inventory Data,Strength Data,Condition Data
dan Project Data. Data tambahan bisa berupa Administrative Data
@rovincial Data,rMilayahData dan Seksi Data) dan Cost Data(unit cost,road
user cost=BOK dX.)
(59) Inaentory Data terdti dari deskripsi ruas,DRP@ata Reference Point) dan

RNIS.oad Network Inventory).

(60)

Strengtb

Data terdiri dari Deflection Dzta dan CBR/Ketebalan

Pendahuluan

15

(66) Rauettingkerusakan berupa lepasnya butir agregat bisa akibat pemadatan


kurang,agregat kotor,kadar aspal kurang atau pemanasan campuran tedalu

ti.ggr.
(67) PotboleQubang),kerusakan perkerasan berupa terbentuknya mangkok
atau lubang yang dalam.Dapat disebabkan aspal kurang,butir halus terlalu
banyak atau terlalu sedikit,penguncian agregat kurang,drainase tidak baik
(68) Depressio,z(amblesan),dengan ata;u t^flpa retak dengan kedalaman lebih
dari 2 cm.Biasanya akibat pemadatan kurang,tedalu banyak agreg t
halus,terlalu banyak aspalJeveling lapis dibawahnya jelek
akibat
setdement lapis dibawahnya.

^t^v

(69) Bheding ftegemukan),kerusakan perkerasan akibat kadar aspal terlalu


tinggi,lapis resap pengikat
pengikat terlau banyak at^o tedalu
^t^E
sedikit,butir halus campuran kurang.
Q 0) C m ck(retak),dapat berupa retak rambut,retak buaya,retak pinggir,retak
refleksi,retak selip,retak susut atau retak melebar.Banyak penyebabnya mulai
dari bahan kurang baik,tanah dasar kurang stabil,air tanah,pondasi tidak

baikJapis permukaan lapuk,penyusutan tanah,sokongan

samping
hilang,setdement,tanah dasar ekspansip,perubahan volume akibat tedalu
banyak aspal dengan penetrasi rendah,agregat halus tedalu
banyak,pem adaLtafl kurang dll.

Perkerasan.

(61) Data

Kondisi Jalan,terdiri

dari RCSfi.oad Condition Survey)

Data,Roughness Data, Peninggian Badan Jalan (grade raisir$ data dan data
iembatan kecil.
(62) Project Data, terdiri dari Committed Project,On-going Project,Road
Maintenance Data dan Road Condition Data.
(63) Ratting (alur),kerusakan permukaan jalan berupa deformasi tetap dari
perkerasan ditandai dengan alur-alur memanjang sepaniang lintasan ban
kendaraan.Mungkin akibat formulasi iob-mix felek (stabilitas rendah,terlalu
banyak aspal,atau terlalu banyak butir halus),aspal terlalu lunak sehingga

sensitif terhadap panas,lapis perkerasan kurang padat,hilangnya gesekan


,lnt,lra agregat,lalv lintas melebihi kapasitas atau cluac

(64) Stripping(pengelupasan), kerusakan permukaan jalzn berupa


pengelupasan lapis permukaan akibat ikatan afltara lapis permukaan dan
dibawahnya kurang atau akibat lapis permukaan terlalu tipis atau lapis
1rt'rmukaan tedalu banyak kadar aspal atau akibat air permukaan.
(t,\) .\'bouing(sungkur),kerusakan berupa amblesan dan deformasi melintang
l,,rrl;r sisi luar ban.Bisa akibat beban lalin tedalu besar,pemadatan kurang
,rr.rrurr;rtt'r'ial tidak memenuhi syarat.

1.2.6.

BANGUNAN PEI.ENGKAP DAN

PERLENGKAPAN

JAr-AN.

a). Bangunan Pelengkap Jalzn,adalah konstruksi yang berhubungan


ialan yanglebih bersifat struktural seperti:

dengan

embatan,Gorong-gorong,Bangunan Pengam an J alan (G aide B lo ck,G ai de


Post,Guard Raill,Saluran Tepi,Tembok Penahan,Bangunan Pengaman

b)

Sungai/Laut yang berdampingan dengan jalan @rcniong,Nprap,


tanggul,mercu,konstruksi pemecah ombak) dll.
PerlengkapanJalan (Road Famiture),konstruksi dan struktur yang bersifat
fasilitas jalan,tidak tedalu struktural,seperti:
Trzffic Light,Rambu,Marka,Kerb,Trotoar,Papan Nama Jalan,Lampu
Penerangan Jalan,Papan petunjuk Legenda Kota/Angkutan, Papan
Petuniuk Lalu Lintas, fasilitas fisik lanskap dan lainlain.

tOlr6t4l'lt<G;t 1,AA/ttl

Bt k'tr 2 : PERANCAN4AN PERKERASANJAL*N

17

cukup,dikaitkan pada biaya yang dikeluarkan untuk pembangunan dan


pemeliharaan ialan,dengan nilai tambah sesudah falan dibangun.

2.1.

KnuaruA ?en$ncqnhqn
?eilEnqsf,tc tq$n

KRITERIA DASAR PERANCANGAN

2.I.1. TEORI PENYEBARAN

GAYA.

Penyebaran gaya pada lapisan struktur perkerasan adalah sama


dengan penyebaran struktur pada umumnya,jelasnya lihat Gambar 2.7.

ecara umum,perkerasan jalan ruya harus cukup kuat terhadap

tiga tinjauan kekuatan

(1).

@.
(3).

Secara keseluruhan harus kuat terhadap beban lalulintas


yang melaluinya.
Permukaan jalan harus tahan terhadap keausan akibat
ban kendaraan,air dan hujan.
Permukaan jalan harus cukup tahan terhadap cuaca dan
temperatur,dimana jalan itu berada.

Gaya yang bekeria

Bidang konaak ban karet


(tampak atas)

Bila tidak memenuhi persyaratan diatas,terutama butir 1),maka perkerasan


secara perlahan akan mengalami deformasi akibat beban lalulintas,dan ini
merupakan awal dari kerusakan perkerasan.Dan bila tidak memenuhi
persyaratan 2), permukaan akan rusak diawali dengan munculnya lobanglobang mungkin semula kecil saja,makin lama makin besar dan dalam.
Apabila tidak tahan terhadap 3),berakibat melelehnya permukaan, atau bila
tidak akan terjadi oksidasi dalam waktu yang relatif pendek,selanjutnya akan
teriadi kerusakan secara berahap.

Umumnya desain perkerasan didasarkan pada metoda empiris


mengacu pada teori analisa tegangan pada perkerasan. Berdasarkan hasil
y ang adz, dikembangk an lag; sesuai dengan penemuan-penemuan baru.
I)isamping tiga pertimbangan diatas,masih ada satu pertimbangan lain,yaitu
\';urg mcnyangkut nilai ekonomis perkerasan ialzn,yang sudah barang tentu
Ir,rr rrs <lipertimbangkan untuk mendapatkan suatu 'benefit' yang

Gbr 2.1 Penyebaran Gaya

Penyebaran g y^ pada struktur perkerasan iilan sepeni padz


Gambar 2.1, dipengaruhi oleh bidang kontak roda kendaraan pada
permukaan ialan yzng bentuknya menyerupai bentuk lonjong.
Penyebaran ga,ya pada perkerasan lentur sampai ketanah dasar dan
tebal perkerasan diberikan sampai dengan kondisi kemampuan tanah

I Kritcrio

Perancangan Pirkerasan Jalan

,<on6cailt$,J 14J.1fi

Btvtl<y. 2 : pER ANCAN-?AN PER.KER.4.SANJAL 4N

t9

lenerima beban ata;u teg ng n( Gbr.2.2.a.),sedangkafi pada perkerasan


aku,gaya sepenuhnya dipikul oleh pelat beton,jelasnyahhat Gbr 2.2.b.
Beberapa teori pedapisan muncul menganalisis kondisi ini,antara lain:

a.Penlcbamao

Ga1,a

Pada Perkemsan

D_

1,5 P. a"

2E

(a2

-tz2 \trz.

2.1.1.2. Teori Burmister.


Menindaklanjuti teori Bossinesq,hanya berbeda kriteria
- Dengan anggapan hao lalers.
- Setiap lapis,homogen,elastis dan isotropis
- Formula defleksi :
1.,5 p. az
D - ------F, ( untuk lentur )

E2

I:nrur

dimana: E,
Ez
F2
a

= modulus elestisitas perkerasan


= modulus elestisitas tanah dasar.
= koefisien defleksi kedua lapisan.
= jarak beban dari titik pusat radial.
Bilamana modulus E, = E, persis sama dengan Boussinesq.
CI'

b.. Penyebammn Gaya


Padr Pctkcmsan Kaku

2.1.1.3. Teori Berlapis

Banyak (Multi Layer Theory).

sudah menganggap perkerasan dan tanah dasar sebagai

satu

kesatuan yang terdiri dari banyak lapisan.

Gbr 2.2 Penyebaran Gaya Pada Perkerasan Lentur dan


Kaku

2.1.7.7.

Teori Boussinesq.

- Material dianggap homogen,elastis dan isotropis


- Perkerasan hanya dianggap sebagai 'single laler'.
- Penyebaran tegangan parabolis, dengan sebaran mengikuti formula

berikut:

Formula memberikan kondisi regangan dalam 3 dimensi

e,=7fEt o,-*(o,*o,)}
e,=1fE{q-p(o,+o,)}
et= 1.fE { o,- l, ( q + o, )}.
z,t,r berturut-turut dalam arah vertikal, tangensial dan radial
Rumus yang sebenarnya merupakan formula umum tegangan
regangan yangbanyak kita jumpai di struktur badan kaku lain.

3p
ar=

2z{1+51/z),\,/,.
Penyebaran tegangan tergantung kedalaman,dan radius jarak beban.
- Mengabaikan pengaruh media yang menyebabkan perubahan

Lanis Perekar

lapis

Laois Pcrmukaan
Lanis Pondasi Atas

Resap

Pengikat

tegarrgzrr.

Dalam peflgembangan lebih lanjut, formula menambah faktor


defleksi:

Gbt.2.3 Struktur Lapis Perkerasan Lentur

Kriltrr,t

,<Orl664l0<ettrefi

l'(t1ttt<.ttrgun Perkerasan Jalon

Dari gambar diatas dijelaskan bahwa proses disain secara garis besar
dibagt dalam empat tahap,yaitu :
1.
Variabel input sebagai basis dasar rancangan (fundamentall,terdiri
dari penganalisaan:
x Tegangan Regangan dalam struktur

(---7
L --J

* Analisa Pembebanan Struktur akibat Lalu Lintas


* Tiniau fuga faktor lingkungan, fang akan memberikan faktor

LoPlt do.or.

Gomb.

t - PEMANCARAN

pengaruh regional.

B[-:BAN RODA YG MEL'\Lul

Variabel input lainnya adalah jenis material y^ng akan memberikan


parameter rancangan : ienis material tanah dasar,lapis pondasi dan lapis

PERKERASAN

i--/

GoTTb.

permukaan.

2 l-AK ADA FENYEBARAN E}EBAN MEL;\LU STRUI<TUR


PRKERASAN YANG BASAH
I
1

ri

Gbt.2.4. PenYebaran GaYa akibat

pengaruh adanYa air.


Pada perkefasan lentur (Gbr.2.3.),lapis permukaan bisa terdiri dari
lapis surface coilrse dan binder,lapis pondasi aras,lapis Pondasi bawah

dan tanah dasar. Karena masing-masing bahan mempunyai nilai


karakteristik sendiri-sendiri,misalnya nilai F,(modalus elastis),1t"(zngka
Poisson),ketebalan berbeda,isotropis dan homogenitas bahan, dan
friksi yang mungkin tefiadi pada masing-masing batas lapisan.Pada
kondisi lapangan dimana muncul permukaan air,teon Penyebaran
mengalami sedikit modifikasi,sebagaimana terlihat paLda' Gbl 2'4'

2.L.2.

PROSES PEBANCAhIGAN (DESIGN

B^P-t^ 2 : PERANCAN4AN PERKERA.SAN],4L*N N

PROCESS)

STRUIffURJALAN
Proses disain struktur pefkefasan haruslah memperhatikan aspek aspek secara keseluruhan mulai dari kondisi tanah dasar,lalu - lintas,

lingkungan, sumber daya alm yang berkaitan dengan material, sampai


d.ngrn p.mbiayaan dan proses pemeliharaan. EJ. Yoder dan M.W. Witczak
dalam bukunya Principles of Pavement Design (edisi kedua), memberikan
gambaran proses disain seperti pada Gbt.2.5.

2.
Dari variabel input diatas akan menentukan arah proses selanjutnya
yaitu'proses pengambilan keputusan' berdasarkan variabilitas input tersebut,
dengan memutuskan nilai - nilai disain yang bagatmana yang akan
ditempuh,yang akan memberikan risiko alternatif biaya yang ber-beda-beda.
Pada tahapan ini kondisi pendanaan sangat mempengaruhi disain mana yang
akan dipilih.
3.
Pada tahapan ini,setelah melalui proses pemilihan dan pengambilan
keputusan pada langkah Z,berdasarkan aspek pada butir 1 diatas, akan
terpilih jenis disain-disain struktur yang tepat sesuai kriteria yang ada. Hasil
pilihan struktur pada butir 3,harus dilakukan pemeriksaan lebih rinci yang
mengarah pada proses pemeriksaan kineria struktur apakah akan cukup baik
menerima beban yang ada, atau melampaui persyarztan standar. Disini
dilakukan evaluasi dan re-evaluasi pemilih^n yang telah dilakukan di langkah
7,2dan 3. Sudah dipertimbangkan pula masa pemellharaan dan rekonstruksi
selama umuf rencana, apakah memang memadai dengan semua asumsi yang
ada. Blla tidak sesuai lakukan perubahan dan kembali ke langkah 3 dengan
merubah pengambilan keputusafl yang sudah diambil, tentunya dengan
merubah pula asumsi-asumsi yang diambil pada langkah L dan 2. Demikian
lakukan proses ulang,sampai memenuhi semua syarat kriteria perancangan.
Tahapan - tahapan ini harus terinventarisasi dengan baik dalam
suatu pangkalan data (dala base),sehingga aliran proses perancangan dapat
tersusun dengan baik. Dikemudian hari bilamana terjadi kesalahan, data ini
dapat difadikan bahan kajiankembak(reaiew).Secara lebih luas lagl data dapat
difadikan bahan kaiizn untuk penelitian dan pengembangan struktur
perkerasan seca;ta spesifik pada lokasi lain,dengan mengambil formulasi dari
data yang sudah diamati dan diteliti tersebut.

2, Kriteria Perancangan Perkerasan

,aoil6Gqw<&t1,11J+t,

Jalan

Bt

'"t^

a:

pERANoAN/TANPER.KERASANJAL

Pendekatan pertamarmengasumsikan akibat beban sumbu ekivalen,


yang merupakan ekivalensi dari beban lalu lintas yang terdiri dari konfigurasi
multi roda yang dimiliki oleh kendaraan desain. Disini dianggap kendaraan
desain adalah kendaraan yang paling berat yang akan mirusak struktur
perkerasan tanpa meniniau peranan dari kendaraan lain. Asumsinya adalah
bilamana struktur cukup kuat terhadap kendaraan desain yang paling
berat,otomatis kendaraan dengan variasi berat yang lebih rendah- akai
mampu dipikul oleh perkerasan. variabel lain adalah tanah dasar yang
merupakan tempat tumpuan struktur perkerasan. Ada korelasi (seperti
ditunjukkan pada Gbr. 2.6a, yaitubrla daya dukung tanah meningkat,jumlah
beban sumbu yang dapat ditampung akan meningkat pula,namun tebal
struktur perkerasan otomatis akan meningkat pula. Metoda pendekatan
ini,dianut oleh beberapa institusi diantarznya US Army corp oi Engineers
yang berbasiskan metoda cBR. Indonesia memilih metoda ini untuk
ranc ngzn perkerasan lentur.

bertomboh *r,

beriomboh-.
Beban sumbu roda Repetisi hancur

C
C)a

a
b

=_t_

{-E.J. Yoder. M.W. Witczak

cd

PF

\r -

./

) ts

tonoh bertombo

<D=
(D c!
a1i

o0)
_o-o
o)

I
Sumber: Yoder-Witzak:Principles of Pavement Design

Gbr 2.5. Proses-Perancangan Struktur Jalan

2.2. PENDEKATANMETODAPERANCANGAN.
Ada dua metoda utama,yaitu

a). Pendekatan metoda desain yang didasarkan pada beban kendataan


rencaflaryung akan menyebabkan tingkat kerusakan,yang dibatasi pada
tingkat kerusakan yang diijinkan.
b). Pendekatan metoda desain yang didasarkan pada jumlah repetisi
kendaraan standar,yang iuga dibatasi sampai tingkat kerusakan yang
diiiinkan.

Gbr.2.6. Pendekatan Metoda.

Pendekatan kedua, meflganggap selama umuf rencana, akan zda


sejumlah repetisi beban sumbu standar pada perkerasan yang terletak pada

tanah dasar yang bervariasi kekuatannya(Gbr.2.6b.). pada akhir masa


pelayanan/umuf rencana, struktur perkerasan diperkirakan akan mengalami
batas kerusakan yang diijinkan. Pada metoda pendekatan ini,dipJukan
perhitungan faktor kerusakan Qlaruagrng factof untuk berbagai berat beban
sumbu standar yang ada dalam konfigurasi seluruh beban lalu lintas.
Jumlah
perkalian antara damaging factor dengan volume setiap jenis kendarain akan
menghasilkan repetisi beban sumbu srandar, yang akan menenrukan tebal
perkerasan. Metoda pendekatan ini, biasanya dipakai untuk merancang

2{ Kriteria

merancang perkerasan kaku.

KONSEP PERANCANGAN PERKERASAN JALAN

per^ncang n ialan secafa garis besar dapat dibedakan dalam


Konsep
-yalro
r p"r*.r.rganialanbaru dan peningkatan ialanlama.
dua kelompot

2.3.1. PERANCANGAN JAr-AN BARU.


Sas

aran dari petanc

z.
b.
c.
d.
e.

^ngaLn

ialan batu dapat berupa

25

c.

struktur pefkefasan dengan beban lalu lintas campufan' beragam dari ienis
kendaraan,volume dan macam-macam konfigurasi sumbu. Metoda
NAASRA $rlational Association of Australia
Pendekatan ini d'iikuti oleh
btate Road Authorities). Indonesia memilih metoda pendekatan ini,dalam

2.3.

B^KA 2 : PERANoAN4ANPER.KERASANJAL^N

xo?r6c4ut16J tr,AJ,An

Perancangan Perkerasan Jalan

Pembukaan lahan Potensial baru


Pengembangan wilaYah
Pembukaan iaringan transPortasi darat baru
Pengemban gan tatz,ruang
Membuka daeruh Yang terisolir
Pada \dasarnya dalam perancangan ialan baru,umumnya yang
keseimbang^n t^ta ruang wilayah yang sudah ada'
diutamakan
Konsistensi fr..rg.-brngrn tidak merubah peruntukan lahan yang sudah
dengan p"rr"-prtun lokasi ialan yang sesuai diusahakan
ada. Mala
membantu /erbaikan peruntukan lahan yang sudah ada'
'J
,
,
.-t ^.-^^^- L^^-^
pola f,],ng
Jl, p.r^.,.r.,gan falan dan perkerY".LrT: .*:19k":
dan
prediksi
ada dan poia-pola y^nglk^n dikembangkan. Prediksi lalu lintas
perkembang^n poi^ tiansportasi harus diarahkan pada sistem yang akan

Jalan lama dengan perubahan karakteristik lalu - lintas sehingg;a


struktur petkerasan yang ada tidak mampu memikul beban lalu lintas.
d. Teriadinya kerusakan pada struktur perkerasan akibat kondisi alam,
bencana alam,atau penyebab lainnya.
e. Kapasitas jalan sudah tidak dapat menampung arus lalu - lintas.
Kriteria perancangan dan parameternya akzn berbeda sesuai dengan
sasaran dan kondisi yang ada. Umumnya menggunakan data dasar yang
semula, dengan beberapa modifikasi bagian - bagian yang sudah tidak
memenuhi syafat.
Termasuk pada kategon in adalah petancangan bagi jalan-jalan
untuk program peningkatan jalan, pemehharaan ialan, rehabilitasi jalan,
rekonstruksi jalan dan pelapisan ulang jalan.
Pada Buku 3 : Struktur & Konstruksi Jalan akan lebih banyak
dibahas mengenai hal ini.

2.4.

KRITE,RIA PERANCANGAN PERKERASAN JAI-AN


Dalam perancangan perkerasan, dengan menggunakan metoda

manapun,selalu ada 3 ( tiga ) parameter desain,yaitu

(1).

PEMBEBANAI\T LALU LINTAS


( lihat Bab 1,.2.1,.

(2)

) didepan.

UMAR RENCANA

Umur rencana ditetapkan sesuai dengan progfam penanganan jalan


yang direncanakan,mis alnya

.
.

PembangunanJalan Baru,untuk masalayan 20 tahun.


Peningkatan Jalan,untuk masa layan 70 tahun dan
Pemeliharaan Jalan,untuk langka 5 tahun.

dibangun.

(3).

2.3.2. PENINGKATAN
JALAN LAMA/,1

Klassifikasi Jalan menurut Kelas Jalan dapat dilihat pada Tabel 2.1a
(untuk j^l^n antar kota) dan Tabel 2.1b.(untuk jalan perkotaan) dan Tabel
2.1c. (untuk jalan Kabupaten).

Sasaran dari perancangaflpen{ngkatan ialanlzma dapat berupa

a.
b.

Struktur perkerasan ialanlania sudah melampaui masa pelayananfiya

(umur rcnc t:rz),yung memedukan rekonstruksi baru'


Struktur perkefasan ialanlama sudah melampaui masa pelay2;nzntry^
(umur rencana),namun masih berada dalam kondisi yzng hanya
memerlukan rehabilitasi dibeberapa tempat saia'

2.5.
1).

STANDAR

DA r I(ELASIALAN.

PARAMETERPERANCANGANPERKERASANJAI-AN.

I{ENDARAAN
Pengelompokan kendaraan untuk kepeduan desain struktur perkerasan
I(LASSTFIT(ASr

jalan, dibagi atas :

I
?fi

XO'I6C,4UN6A

Kriteria Perancangan Perkerasan Jalan

B^K^ 2 : PERANCANqAN PER-KERASANJAL*+N

M24N

Tabel 2.1c. Klassifikasi


FUNGSI

(Sumber:TPGJAK-No.038/T / BM / 1,997)
KE,LAS

VOLUME

MUATAN SUMBU TEBBERAT

T.ALU LINTAS

>10

( dalam SMP )

(MST*ton)

I
II

Aneri

10

Kolektor

TIIA

I
I

I,okal

IIIB
IIIC

IIIA

1i

;i

SE,KUNDER:
r Jalan Lokal

> 500
201 - 500
50

III A
III B1
III 82
ruC

200

<50
TABEL 2.1b. Klassifikasi lalan Perkotaan
o JALAN TIPE

(PcngaturanJalan Masuk : Pcnuh)

KELAS

FUNGSI

PRIMER:

SEKUNDER:

o JAI-AN TIPE

Kolektor

I
il

Arteri

o Arteri

II ( PengaturanJalan

F'UNGSI

PRIMER:

SEKUNDER:

Masuk: Scbagian atau tanpz pengaturan )

VOI,UME. I-ALU LINTAS


(dalam SMP )

o Arteri

o
r

Kolektor

Arteri

alan Kabupaten
- 1.992 Dirjen Bina Marga)
KtrI-AS
KECEPATAN
( km/ium )
MEDAN

(Sumber : Petunjuk Perencanaan Teknis


Jalan Kabupat en

Tabel Z.la.Kraltrfikasi Kelas lalanAntat Kota


FUNGSI

10.000
10.000

>

20.000

KELAS

I
I

Ii

>
<

II
III

e Jalan Lokal

>
<

6.000
6.000
500
500

40

30

40

30

30

40

30

30

30

30

2A

l)
I(endaraan roda tiga @emo,helicak dll.)
ii). Sedan,MinibusJeep dll.
iii). Kendaraan angkutan penumpang kecil (oplet, dll)
i"). Bus mikro
v). Bus.
vr) Kendaraan angkuran barangkecil ( pick-up, dll )
Truk mikro Q as,4 roda )
"ii).
vin). Truk besar Q as,6 roda. mobil tangki, dll. )
i"). Truk3-as
Truk4-as
,.
Truk Gandengan (4 as atau lebih)
"i). Sepeda Motof.
"ii). Kendaraan
bermotor (sepeda,becak,pedati,gerobak dll.)
"iii).kendaraan yangtidak
I(elompok
umum
2).

PETUA^VLPATVGIALAN

Potongan melintangJalan terdiri dari

lu

IV

a). Bagian J alan yang merupakan daerah penlluasaan jalan tercliri dari:

i.
Sumber : Standar Perencanaan (ieometrik untuk Jalan Perkotaan

50

jalan adalah sebagaimana y^ng tampak pada Gbr.2.7.

o I(olektor

dipakai untuk p"rnirung n perkerasan

< 20.000

27

1988

DAMAJA , daerah manfat jalan, dlbatasi oleh :

'

lebar

batas ambang pengaman lalan clikcdua sisi jalan.

- tinggi^nt^r^
5,00 meter diatas permukaan perkerasan pada
1alan.

sumbu

T
A

Kriteria Perancangan Perkerasen Jalan

ll.

xovrcc&w<al MJ.A?|

BAKA 2:

MOBll. PENUMPAI,IG - 2 ton

IRUC(KEClL2sumbu-6bn

- kedalaman ruang bebas 1,5 meter dibawah muka ialan.


DAMIJA, daerah milik jalan, dibatasi oleh :

NCAN.^ N PER-KER^.SA

TRUCK BESAR

N J,AL-A N

2 sumbu - I3 ton

H/
rr-\ ------:T----:-

lebar yang sama dengan DAMAJA ditambah dengan ambang


pengaman jalan, dengan tinggi 5,0 meter dan kedalaman 1,5 m.
iii. DA\7ASJA, daerah pengav/asan ialandaerah ruang sepaniang
jalan,diluar DAMAJA, dibatasi oleh :

- ti"gg, dan lebar

PER,A

IRUCK GANDENG
STRT
BUS -

STRT

8 ton

lruck

STRT
TANDEM 3

STRT

STRG

5 sumbu-30 ton

sumbu-20 ton

tertentu,diukur dari sumbu jalan,sebagai

berikut:

HI

61 7+7J

Arteri minimum 20,00 meter.


(2). Jalan Kolektor minimum 15,00 meter.
(3).Jalan Lokal minimum 10,00 meter.
(1). Jalan

- didaerah tikungan ditentukan oleh jarak pandang bebas.

STRT

STRT

STNT
STdRG

IRUCK GANDENG 5 sumbu-4o T

5T

SIdRG

5T

STRT SIRT

TRUC( GAI,IDENG 6 sumbu -50 T

KEIERANGAN :

Ketentuan mengenai Bagan JaIan,DAMAJA,DAMIJA, DAWASJA,


dan peruntukan penempzt^rr utilitas dan fasi-litas yang dibolehkan,
diatur pada Peraturan Pemerintah RI no. 26/1985 pasal 27,
sebagaimana ditunjukkan pada Gambar 3.3.

STRT

STRG

SUMBU IUNGGAT

STdRG

SUMEU TANDEM

SIRT

SIdRG

ROM GANDA (ticlok diitustosikon

Jalur lalu lintas


- Median dan jalur tepian (kalau ada)
- BahuJalan
- Jalur pejalan kaki (trotoar)

Jalur hiiau
- Ambang pembatas (frontage road)
- Jalur parkir
- Batas luar Jalan (outer separation).
- Selokan dan lereng.
-

r(u l0Tl0r

7J_ ?J

SMG SIRG

STRG STRG STRG

Gbr.2.7.Jenis tipe kendaraan untuk rar,cangan

ii.

Jalur lalulintas dapat terdiri atas beberapa lajur.


dapat terdiri dari:
L. 1 jalur :2lajur - 2 arah (2/2TB)

iii. Jalur laluiintas

Jalur lalu lintas adalah bagSzn jalan yang digunakan untuk lalu
lintas kendaraan (cariage way,traffic lane),secara fisik berupa
perkerasan jalan.
- Median,
- Pulau jalan (island ),
- Bahu,
- Separator,atau trotoar.

6t

SIIRG = SUMBUIRIDEM

jalan:

Batas jalur lalulintas dapat berupa

lor l0T

RODA GANDA

i.

6tzl u

RODA TUNGGAI.

RODA GANDA

b). Elemen

SUMBU TUNGGAI

b. l jalur:2la|u-7 arah(2/1TB)
c. 2ialur:4lajw -2 arah (4/28)
d. 2ialrur.: nlajur -2arah(n/28),
dimana: n =jumlahlajur
TB = tidak terbagi.
B = terbagr.

Median,bagian bangunan jalanyangsec rz fisik memisahkan


dua jalur lalulintas yang bedawznan arah,berfungsi untuk:
- memisahkan dua aliran lalulintas yang berlawanan arah,
- ruang lapak tunggu penyeberangjalan,

2S

T
30 Krileria

t1ou6z4ut<e,7424n

Perancangan Perkerasan Jalan

4).

- penempatan fasilitas ialan,


- tempat prasa;tan keria sementara,
- penghiiauan,
- tempat berhenti danxat ( iika cukup luas ),
- cadangan laiur ( untuk Pengembangan iumlah lafur )
- pedindungan terhadap silau lampu kendaraan bedawanan

Bt Kq 2: PER4NoAN4ANPER.KER,4.S,4NJ,4L N

KECEPATAAI RENCAAIA
Kecepatan rencana, untuk jalan antzr kota dapat dilihat pada Tabel
2.3.

Jalan dua arah dengan empat laiur ata,t lebih perlu dilengkapi
median,dibedakan meniadi :
- median yang direndahkan: ialur tepian dan bangunan
- pemisah jalur yang direndahkan. Lebat minimum median yang
direndahkan 7,00 m.
median
yang ditinggikan: ialur tepian dan bangunan pemisah
jal:ur yang ditinggikan. Lebat minimum median yang ditinggikan

r,s

s,so

i.5o ,fl

r3,00

,"".mg*

t,id'

s,so

50,00

Gbr.2.8. Elemen Penampan g J alan (tipikal)

2,00 m.

Lebar minimum median dan ialur tepian (marginal stip)dapat


dilihat padaTabel 2.2.
Pada Gbr. 2.8. dapat dilihat tipikal penampang ialan perkotaan
(urban) dengan beberapa elemen ialan.

Tabel2.2.l*bat median
Klassifikasi Ialan

Irbar Min. Median

(rn)

kbat

ialur tepian

Arteri Primer ( Full access con*ol )


Kolektor Pimer/ Arteri Sekunder
( Partial atau Non Access Control )
Arteri Primer / Kolektor Primet / Arteri

2,50

0,75

2,00

0,50

Sekunder
(partial atau non-access conuol )
Kolektor Primer ,/ Arteri Sekunder / Kolektor
Sekunder ( Patial atau Non'access control ).
Kolektor Sekunder/ f,okal Sekunder
( Partial atau Non-access conuol )

2,00

0,50

2,0a

0,25

1.s0

0.25

k-Omnn

Sumber: Standar Pcrencanaan Geometrik Jalan Perkotaan

3).

RUA\{G BEBAS r(ENDARAAN

Didalam fuang bebas kendaran tidak diperkenankan

adanya

bangunan, fasilitas utilitas,pohon dan benda-bend y^ng tidak begerak.


^
Penempatan utilitas didaerah penguasaan ialan ditetapkan
berdasarkan PP.No.26 / 1 98 5 sebag aimana tercantum pada Gbr.2.9 .
Dimensi ruang bebas dapat dilihatpada Gbr. 2.10.

31

Gbr.2.9. Daerah Penguasaan Jalan dan penem patafl

utilitas.(

Sumber: [)irlen Bina l|{arga)

fro:

:12

KrilL,ria Perancangan Perkerasan Jalan

I
T

uemSn$nuwtn
?enUen$sl|r, CAHt

A. tr{n

tatq

f. Pb. w.trlr .*.

E. ttr.rrlt

c" tl.nlrft lrlr ktrt rs{

drrl {rbGmnlm

p" n aF

}fH.

H, l}ifffi

Xtll litth

erbeda dengan konstruksi bangunan yang lebih


banyak mengacu pada prinsip kekuaran struktur
material padat,. peffya;r tzfi konstruksi jalan lebih
banyak mengacu pada teori elastisitas untuk srruktur semi-padat.

J.ad t(ffitr

DaiarJrnl

l. t'a.rlrfi f*h

+ oG*!

r.i.+a( lfr'tfi

Jre, h.rarffit

r:EEAAIIAiI P*t}A JAL/TN NAYA

Gbr.2. 10. Ruang Beb as J alan Raya(so-ser:

Standar No

.13

197 0)

Tabel2.3. Kecepatan Rencana


dan Klasifikasi Medan Jalan
KECEPAAN RENCANA , Vr , Km/}am

i Densan Klasifikasi Fu

FUNGSI
Arted
Kolektor
Lokal

Datta;r

Bukit

Pegunungan

60-80
50-60
30-50

40-70
30-50
20-30

70

12fr

60-90
4A-70

seperti kita ketahui struktur perkerasan jalan terdiri dari beberapa lapis
elemen struktur perkerasan.Pada struktur perkerasan lentur terdiri dari
tanah dasar (subgrade),lapis pondasi bawah(subbase course),lapis pondasi
atas(base course) dan lapis permukaan(surface course).Pada srruktur
perkerasan kaku terdiri dari lapis tanah dasar,lapis pondasi bawah dan pelat
beton. Setiap elemen mempunyai nilai elastisitas bahan E sendiri-sendiri.
Hingga boleh dikatakan elemen strukrur perkerasan merupakan gabungan
dad komposisi bahan,yang masing-masing berbeda elastisitasnya. Sehingga
sebenarnya anahsa kekuatan lebih rumit dan komplek dibandingkan
konstruksi bangunan. Analisanya lebih banyak berupa pendekatan
berdasarkan teori-teori elastisitas yang ada. Dengan demikian persyararan
konstruksi untuk konstruksi jalan,lebih banyak mengacu pada persy^r^t^n
toleransi terhadap suatu nilai kekuatan yang ditetapkan. Bab ini akan
menguraikan Elemen Stuktur Perkerasan Jalan,baik perkerasan lentur
maupun kaku. Secara lebih lengkap Struktur dan Konstruksi Jaian akan
dibahas pada Buku 3.

3.1. KELOMPOKSTRUKTURJAT-ANLENTUR.
Struktur perkerasan jalan lentur dibuat secara bedapis terdiri dari
elemen perkerasan: lapisan pondasi bawah (sub base course) - lapisan pondasi

fl
I

t1ou6c4ut16t74t4%

BLl:k'L4

2 : PER/4NCANqAN PERKeRASANJ,AL-AN

(baff clnr.re) - lapisan pemukaan (saface


^tzs
tanah dasar (sub grade),ielasnya lihat Gbr 3.1.

czxtrse)

35

yang dihampar p^d^

Masing - masing elemen lapisan diatas termasuk tanah dasx secara


bersama - sama memikul beban lalu - lintas.Tebal sffuktur perkerasan
dibuat sedemikian rupa samPai batas kemampuan tanah dasar memikul
beban lalu - lintas,atau dapat dikatakan tebal struktur perkerasan saflgat
tergantung pada kondisi atau daya dukung tanah dasar.

Lapis Perekat

Elemen Struktur Perkerosan Jalan

Lapis Permukaan

Tidak semua jenis tanah dapat digunakan sebagai tanah dasar


pendukung badan ialan secara baik, karena harus dipertimbangkan beberapa
sifat yang penting untuk kepentingan struktur jalan,seperti :
- daya dukung dan kestabilan tanah yang cukup
- komposisi dan gradasi butiran tanah
- sifat kembang susut (swelling) tanah
- kemudahan untuk dipadatkan
- kemudahan meluluskan air (drainase)
- plastisitas dad tanah
- sifat ekspansive tanah dan lainlain.

Lapis Pondasi Atas


Lapis Resap

Pemilihan jenis tanah yang dapat dijadikan tanah dasar melalui


penyelidikan tanah menjadi penting karena tanah dasar akan sangat
menentukan tebal lapis perkerasan diatasnya,sifat fisik perkerasan di
kemudian hari dan kelakuan perkerasan seperti deformasi permukaan dan

Pengikat

Gbr 3.1. Sttuktur Lapis Petkerasan L,entur


3.1.1. ELEMEN TANAH DASAR GaB GRADE)
Kekuatan dan keawetan konstruksi perkerasan jalan

sangat

sifat dan daya dukung tanah dasar.

tergantung dari sifat Umumnya persoalan yang menyangkut tanah dasar adalah sebagai berikut

Perubahan bentuk tetap (deformasi permanen) dari macam tanah


tertentu akibat beban.
b. Sifat mengembang dan men)'usut dari tanah tertefltu akibat
perubahan kadzr au.
c. Daya dukung tanah yang tidak mera;ta dan sukar ditentukan secara
pasti pada daerah dengan macam tanahyang sangat berbeda sifat dan
kedudukan rry a,^t^rt akibat pelaks anaan.
d. T,endutan dan lendutan balik selama dan sesudah pembebanan lalu lintas dari macam tanah tertentu.
e. Tambahan pemadatan akibat pembebanan lalu - lintas dan penurunan
yang diakibatkannya,yaitu pada tanah berbutir kasar@ranular soil) yang
tidak dipadatkan secarabaik padz saat pelaksanaan.
a.

lain sebagainya.
Para perancang dan pelaksana harus mengerti betul bagaimana sifat
dan karakteristik tanah dari bahan mateial tanah dasar. Disiplin ilmu
mekanika tanah dan geoteknik sangat membantu untuk mengantisipasi
perilaku dari tanah dasar,sebelum benar-benar dipilih sebagai subgrade
(pertimbangan peruncangan) dan sebelum dilaksanakan pengerjaannya
sebagai struktur perkerasan yang paling bawah(pertimbangan pelaksana).
Beberapa pedoman praktis dalam r^nc ngal tanah dasar dapat
dilihat pada Lampiran A-1 yang merupakan sifat spesifik tanah untuk
klassifikasi dari Cassagrande,yang sekaligus menunjukkan rating sebagai
tanah dasar, sedangkan pada Lampiran A-2 merupakan petunjuk dari
Highway Research Board USA untuk mendapatkan raing tanah dasar
berdasarkan sistim klassifikasi 'Group Index'(GI) atau kadangkala disebut
sistim Unified Classification.

3.I.2. ELEMEN
coaRSo

I.APIS PONDASI BAWAH

(SUB-BASE

Lapis pondasi bawah (subbase) adalah suatu lapisan perkerasan jalan


yang terletak zntara lapis tanah dasar dan lapis pondasi "aras" (base),yang
berfungsi sebagai bagian perkerasan yang meneruskan beban diatasnya,dan
selanjutnya menyebark^n teg ngan yang terjadi ke lapis tanah dasar.

fr

BwKq 2 :

t1o%6c8nr$1tr414t1

Elemen Struktur Perkerasan Jalan

PE|e,\NCANqAN PETaKER^S,+NJAL^N

Lapis Pondasi bawah dibuat diatas tanah dasar yang berfungsi

2.

diantaranyz sebagai:

^.
b.

Sebagai bagian

MAKADAM BASAH
o

dan menyebarkan beban roda.


Meniaga efisiensi penggunaan material yang relatsf murah agar
lapisan lapisan selebihnya dapat dikurangi tebalnya

(penghema tan biay a kons truksi).


Untuk mencegah tanah dasar masuk kedalam lapis pondasi.
t pelaksanaan dapatberizlanlancat
Sebagai lapis pertam^
^g
Hal ini sehubungan dengan terlalu lemahnya daya dukung tanah dasar
terhadap roda - roda alat - alat berat atil) karcna kondisi lapangan yang
memaksa harus segera menutup tanah dasar dari pengaruh cuaca.
Bermacam - m c m matenal setempat (CBR > 20 oh, PI < 1070)
yang relaaf lebih baik dari tanah dasar dapat digunakan sebagai bahan

BAHAN

1,2

3.

MAKADAM KERING
Sama dengan Makadam Basah,hany^
halus tidak disiram
^gregat
dengan air tapi disemprot dengan compressor
angin.

yaitu:

Tabe 3.1. Persvarat^n Gradasi Makadam

Pondasi bawah yang menggunakan batu pecah,dengan balas


pasir.

f.

Tipe Agregat

Pondasi bawah yang merrggunakan sirtu yang mengandung


sedikit tanzh.
Pondasi bawah yang menggunakan tanah pasir.
Pondasi bawah yang meflggunakan
^ggregat.
Pondasi bawah yang menglgunakan material ATSB (Asphalt
Treated Sub-Base ) atau disebut Laston Bawah (.apis Aspal
Beton Pondasi Bawah)
Pondasi bawah menggunakan stabilisasi tanah.

Ukuran
Sariagan(mm)

Agregat Kasar 7,5

100
50

35*7A

t,)

19

Asreeat Kasar 9-5

1r0

0,425

Batu belah berukuran

0.075

tirgg

^ntarl-

1,5-25

cm atau

2s/30.
Batu pengunci/pengisi ( pecahan batu-batu kecil
3/5 ztau 5/7
Balas berupa pasir.
Agregat penutup berupa sirtu.

100

0*15

0*5

100
100
95 100
35 *70

0-5
100

4,75

b.

95

25

1. PONDASI TELFORD

f5*8cm)

lewat sarinoan

63

29

Tetral Lapisan Padat

(/-10cm)
Yo

Pondasi bawah menggunakan batu pecah dengan balas pasir.

r BAHAN

- Maks 35

Batas Cair ( AASHTO TB9 )

Ada berbagai jenis lapis pondasi bawah yang sering dilaksanakan,

c.
d.
e.

Memenuhi persyaratan gradasi berikut ini:


- Agregat kasar juga harus memenuhi syarat Abrasi
Agregat ( AASHTO T96 ) - Maks 40
- Agregat halus memenuhi syarat :
Indeks Plastisitas ( AASHTO T90)- Min 40 Maks

pondasi bawah.

b.

(waterbound macadam)

dari konstruksi perkerasan untuk mendukung

c.
d.

z.

!7

70*9s
45*65
33*60
22* 45
r0-28

Pondasi bawah )rang menggunakan sirtu )rang mengandung sedikit


tanah.

r BAHAN:

B^K^ 2:

lg xou6a4UtlSJr4J,4yl

Sirtu yang tidak mengandung lempung,aman dan

langsung digunakan sebagai pondasi bawah.


Sirtu yang hanya sedikit mengandung

Elemen Struktur Perkerasan Jalan

PER/.tNoAN4IkNPERKER/tSANJAL-+N

Memenuhi persy^t^t^n bahan sebagai berikut

Tabel 3.3. Persya r^tan Bahan Aggregat.

lempung,bagus dan bisa langsung dipakai. Ada


baiknya periksa prosentase lempung.
Sirtu yang cukup banyak mengandung
lempung,periksa kadar lempungnya. Bilamana
kadar lempung < 14o/o zm fl digunakan,bila >
1 4o/o lakts,kan b lendingdengan batu pengisi(stuns laa!

SITAT
Abrasi dari Agregat Kasar
( AASHTO T 96 *74)
Indeks Plastisitas
( AASHTO T 90 * 70 )
Hasil Kali lndeks Plastisitas dengan
prosentase lolos # 75 micron

Pondasi bawah yang menggunakan tanah pasir.

BAHAN

39

Batas Cair
( AASHTO T 89

* 68 )

KELAS A

KELAS B

a*40%

0-

0-6

4- t0

50%

25 maks

0-35
* 5o/o

Bagian yang lunak

Pasir dengan gradasi baik,tidak berkontaminasr

CBR
( AASHTO T 193 )

80 min

35 min

dengan bahan organik,atau bahan halus lainnya'

Rongga dalam Agregat mineral

l4 min

pada kepadatan rnaksimum

l0 min

Ketersediaan pasir dalam iumlah banyak dilokasi


saflgat mendukung penggunaan metoda ini.
Pengeriaannyapun dapat dilakukan secara manual.
Penggunaannya fuga memperhatikan erosi akibat

(AASTiTO T 112* 78 i

air.
Pondasi bawah yang mengunakan aggregat.

d.

BAHAN

Memenuhi persyaratan gradasi agg3tegat B berikut


ini:

Gradasi
Ba
Tabel3.2. Persyaratan lJmum Batas
PERSEN BERAT LOLOS
KELAS B
KELAS A

MACAM AYAKAN

(mm)
o-,

100

100

17q

100

67 - 100
40 - 100

2,36

'65 - 81
42-60
27 -45
18-33

,18

t1-25

19,0

9.5

475
1

0,425
()r)75

25-80
16-66
10-55

6-45
-

6-1.6

.1

0-

0-20

-r-)

Pondasi ini-dikenal sebagai IASTON BA$7AH


- Lapis Aspal
Beton Pondasi Bawah,menggunakan bahan bat, pecai, (cruied
stone) atau bisa juga dari sirtu pecah mesin (crushed pit run).
Aspal yang digunakan jenis penetrasi (pen) B0 atau pen_60.
Persyaratan -persyar^tan untuk agregat dan aspal mengikuti
N SPM Qri orma,S tandar, petun j uk dan Manua r) y ang ada.yaitu luku
petunjuk LASTON No. 04lpT /B/1983.

BAHAN

f.

Pondasi bawah vang menggunakan Stabilisasi

Stabilisasi yang umum dikerjakan pada konstruksi jalan adalah


stabilisasi dengan menggunakan bahan semen-tanah,semen-agrcg t
^tau
kapur- tanah.Elemen struktur yang distabilisasi adalah lapls 'pondasi
bawah,lapis pondasi atas atau lapis tanah dasar yang *"-r.rg disarankan
untuk itu. Pengertian disarankan adarah diminta oleh-Direksi atau memang

Elemen Struktur Perkerosan Jalan

40

t@n6t4tt6aM.tru

BL

agregat
tefcantum dalam kontrak,karenz sfl.rktuf tanah yang spesifik,matefial
memang
yang tidak tersedia dilokasi atau akibat khusus latnnyz yang
meir"rlokrn stabilisasi. Stabilisasi adalzh proses Pencampufafl bahan
dicampur dengan sefumlah ait untuk
stabilisasi dengan t^n h
^greg^t
^t^\
indikatot
mendapatkrn pr.rrrgrn kadarui, opti-" dan kepadatan sebagai
dapat
kekuatan potensial struktur falan (sheruoood et all). Stabilisasi
menaikkan beberapa unsuf sifat material bahan ialan dan tanahdituniukkan

oleh:

masih ada sisa kekuatan struktur walaupun ienuh air


lendutan permukaan berkurang
tahananterhadap erosi meniadi naik
material pendukung berbutir halus tidak dapat

berkontaminasi

dingan bahan yang

Tabel

JENIS STABILISASI

Semen

Kapur
Kapur - Pozzolan

KUAT T'EKAN BEBAS (It{Pa)

DESKRIPSI
(1)

3$

CBz

Lapis pondasi atas, distabilisasi (2)

1,5

CS

Lipis'po.rdasi bawahdistabilisasi

CB1

lapis fondasi atasdistabilisasi

0,75

* 6,0
* 3,0

1,50

10<PI<=20

Ya

PI>20

Ya

Ya

Yz

Ya

Tidak

LOLOS #0,075 MM. < 25%

PI<=6

PI<=10

PI>10

Ya

Ya

Tidak
Ya

Ya
Ya

Yz

PP<=60

CATATAN: PI = PI.ASTICITY INDEX ( Batas Plastis ), PP = Plasticity PRODUCT = PI x 7o lolos #


mm

0,075

Tabel3.6. Sifat Material Minimum yang dapat distabilisasi.


BS

SIEVE (mm)
53
37,5
2A
5

2
0,425

elemen iatzn tergantung pada posisi

r Road Note

LOLoS #0,075 MM. > 25%


PI<=10

material berstabilisasi dengan kapur cocok uotuk


platform lantar kerla dimana dibawahnya berupa

Tabel3.4. Syarat Kekuatan Elemen StruktutJalan dengan


Stabilisasi

efektif

SIFATTANAH

sudah

Syarat minimum n.o*L':'ff:o


retakan'
elemen dan lalu lintas,tapi paling tidak,harus tahan tethadap
rtt.""r", standar orr..re^. Road Note 31 berikut ini pada Tabel 3'4'
stabilisasi'
merupakan s'iaratkekuatan elemen struktur i alan menggul+'"
tanah
untuk
pemilihrn fenis stabilisasirdidasarkan pada nilai plastisitas
NAASITA
kelempungan,dan analisa gradasi u-ntuk tanah kepasiran' Menurut
3.5.
Tabel
dilihatpada
dapat
yrrg dlraJpsi oleh oversJas Road Note 37
standar minimum material yang dapat distabilisasirdikompilasi
3.6'
berdasarkan overseas Road Note 3L adilah berdasarkan Tabel

3.5. Jenis dan batas stabilisasi yang


umber Road Note

distabilisasi
modulus elastisitas bahan konstruksi berbutir kasar
diatas material terstabilisasi meniadi naik

KODE

4l

Kq 2 : PER;4NCANqAN PEPKERI4.SANJAL^N

a.074

f: Road Note 3
Sumber:
PERSENTASE MASSA AGREGAT YANG LOLOS SARINGAN
CB1
CBz
CS

100
85 100
60 -90

B0

100
* 100

55-90
25*65
15-50

30-65
20-sa
10*30
5-15

10 -30

5-15
Nilai Maksimum yalrq diiiinkan

LL

25

30

PI

10

LS

20

CATATAN : f)isarankan material mempunyai kocfisicn keseragaman =5 atau lebih

STABILISASI SEMEN

I(ekuatan stabilisasi didominasi oleh sifat asal tanah dan hidrasi. Bila
kadar semen bertambah kekuatan akan bertambah. I(ekuatan bertambah
pula sebagai fungsi waktu. Untuk mencari kekuatan kepadatan kering pada
kadar air optimum,dibuat contoh dengan variasi kadar semen 2o/c,,4oh,6,Yo
dan \oh. Lakukan pemadatan segera contoh jadi,karcna semerr akan segera
mengeras. Lakukan pula percobaan untuk contoh yang dibiarkan 2 iam
sebelum ditumbuk dengan mesin pemadat 150 mm,hammer 4,5 kg dan
dilakukan curing 7 hari lembab dan 7 hari rendaman.Can kekuaran pada

rdn6c4uNaJMt4u

El/ty.t

l 2 : PER/qNC/+NqAN PeRKER^SANJAL^N

Elemen Struktur perkerasan Jalan

43

97oh kepadatan kering maksimum yang merupakan standaf kepadatan

?.
b.
c.

dilapangan.

STABILISASI KAPUR

Jika kapur dicampur dengan tanah kohesif,maka nilai plastisitas


akan menurun. Penurunan ini tefgantung pada waktu dan memberikan effek
kadar at optimum bertambah dan kepadatan kering berkurang bila
dilakukan percobaan pemadatan. Ini berarti ketedambatan pemadatan
dilapangan,akan mengakibat kan berkurangnya kepadatan,otomatis
berkurang pula kekuatan dan daya tahdn.
Jenis kapur yang diperdagangkan dan baik untuk stabilisasi adalah
Ca(OH)r,kapur tohor dengan hidrasi tinggi,atau Ca(OH)rMgO,mono
hydrated dolomitic lime atau CaO,quick lime atau CaoMgO,dolomitic quick
lime.

Prosentase kadar kapur yang digunakan,dicari dengan prosedur


seperti yang dilakukan untuk semen. Masa curing kapur zdalah 2l hari
lembab dan 7 hari rendaman. Pada iklim tfopis contoh dibiarkan pada suhu

BAHAN

/ '

hfis permukaan
Meneruskan Iimpahan gayararrt rintas ke lapis pondasi
bawah.

Bahan - bahan untuk rapis pondasi atas,umumnya


harus cukup kuat
dan awet sehin6ga dapat menahrn t"br. roda. sebelum
menentukan suatu
bahan.:l*k drgunakan sebagai rapis pondasi atas,hendaknya dilakukan
penyelidikan dan pe*imbangan r.uxt
- baiknya sehubungan dengan
persyaratan teknik yang ada.
Bermacam

macam bahan alamfbahan setempar (CBR > 50 yo, pI


sebagai bahan rapis ponda.i
n rain: baru
pecah' kerikil pecahdanfatau stabilisasi tanah dergur..^"r,
"tr."rrrt,
atau kapur.
Secara umum dapat berupa:
a. Pondasi
y^ngmenggunakan material pondasi Telford
^tas
b Pondasi atas
yang menggunakan material uggr.gr,.

< 4%) dapat digunakan

25" C.
o

Sebagai bagian perkerasan yangmenahan beban


roda.
Sebagai pedetakan terhadap

./'

Pondasi
yang menggunakan _r,.[r] "efn (Asphalt
-atas.
Treated Base) atau disebut iaston (I-apis Aspal Beton)
Atas.
Pondasi aras menggunakan stabilisasi material.

a.

Beberapa bahan tanah,reaktif terhadap stabilisasi semen atau


kapur,harus dipilih dan disesuaikan dengan spesifikasi. Tidak semua bahan
tanah dapat dipakai untuk stabilisasi(fabel 3.5.) Jenis CS adzlah yang
digunakan untuk lapis pondasi bawah.
Stabilisasi selain dilakukan pada Lapis Pondasi Bawah,iuga dilaksanakan
untuk Lapis Pondasi Atas.

permukaan dan beban-beban roda yang bekeria diatasnya dan menyebarkan


tegangan yang terfadi ke lapis pondasi bawah,kemudian ke lapis tanah
clasar.

Lapis pondasi atas dibuat diatas lapis pondasi bawah yang berfungsi
(liantaraflya

- Batu yang digunakan dapat terdiri dari batu kali atau batu

gunung, yang disusun beraturan secara vertikal.


- Disela-sela batu diisi dengan batu pengunci,dengan
a[lar susunan batu terkunci dengan cukup

3.7.3. ELEMEN r-APrS PONDAST ATAS (BASE COARSE)


Lapis pondasi atas(I-PA) adalah suatu lapisan perkerasan ialan
lapis permukaan dan lapis pondasi "bawah"
yang tedetak
^ntar^
sebagai bagian perkerasan yang mendukung lapis
berfungsi
(subbase),yang

BAHAN

maksucl

kr^t Ja., kokoh.

- Selanjutnya dihampar pasir kasai dan dipa<Jatkan.


b.

BAHAN

-. Material agregar yang digunakan,untuk pondasi


atas adaiah
dari batu pecah yang bergraclasi tertentu. iJot., pecah
tersebut

berasal

dari proses di

cru.rhing

pemecahan,penyaringan,penrisahan

plant,meialoi tahapan

dan

pencampuran,

44

E;.;rr<.;'

NoilggquxetMt4n

2 ; PERANCAN(AN

PER-KER,4SANJAL-AN
Elemen Struktur Perkerasan Jalan

sehingga menghasilkan suatu bahan y^ng

45

sesuai dengan
.

persyaratan'persyzr tanspesifikasi-yang telah ditentukan'


'- Kl"s.ifik^.i Agregat Lelas A,biasa dipakai untuk Lapis
Pondasi Atas(ihat Tabel 3.2. danTabel 3'3')

mempunyai satu bidang pecah.

b. Pasir harus non-plastis,bersih dari bahan-bahan


dan bahan-bahan lainnya yaflg tidak

lempung,organik

dikehendaki,serta mempunyai sand equivalent minimum 50%.


(AASHTO T-176).
O

BAHAN

ii). Bahan Pengikat:

i). Agregat

a.

Aspal keras yang digunakan adalah dari jenis pen.6O/70 atau


Pen. 80/100 yang memenuhi persyaratan.
b. Aspal c lr y^ngdigunakan untuk lapis resap pengikat (primecoat) terdiri dad jenis MC-30,MC-70,MC-250,aspal emulsi
dari fenis CMS atau MS yang memenuhi persyaratan.
c. Aspai cair yang digunakan .r-ntuk lapisan pengikat (tackcoat),
adalah dari jenis RC-70,RC-250,aspal emulsi jenis CRS,atau
RS yang memenuhi syant.

digunakan berupa, sirtu hasil pecah mesin


a. Agregat yang
"ata,r"batu

(cru shed stone)'yang bersih dari

pecah
1..o.il.igrarrel)
L*p.r.rgiU ahan organik dan bahan-bahan lainnya yang tidak

dikehenJaki, serta memenuhi persyaratan berikut:

Tahel 3-7- Persvafatafi Gradasr Agtegat ATB


% BERAT
UrcUNAN SARINGAN
SARINGAN
LOLOS
(mm)

2(0
19,0
13,0

o(

4,75
2,36
0,6
0,15
0,075

100
95- 100
(16
100

52 -78
47 -57

42-

d.

Pondasi atas )zang menggunakan matefial stabilisasi.


Qihat Stabilisasi Pondasi Bawah diatas)
o

BAHAN

56
54

*
4-31

1,3

Bahan peng-stabilisasi digunakan semen atau kapur (ihat


Tabel 3.5. dan Tabel 3.6.)
Jenis CB1 dan CB2 adalah untuk lapis pondasi atas(lihat

Tabel3.4.)

3-8

500
- I(ehilangan berat akibat abrasi mesin Los Angeles pada

PtJtzran 40oh
aspal 95o/o
Kelekatan
^gtegatterhadap
25%o'
maksimum
- Indeks kePiPihan
maksimom 3olt
air
- Peresapan
^greg^tterhadap
- Gompulun l"-p""g dalam ^greg t-maksimum 25%o
- B.raileni. ."-, (apparent) agregat minimum 2'5
no' 4'harus
- Minimum agaegatkr.ut y,'g tefiahan saringan

3.7.4. EI N148I\I LAPIS PERMUKAAN(SURFACE COURSq


Fungsi lapis permukaan antara lain

a.
b.
c.

Sebagai bahan perkerasan

Sebagai lapisan rzpa;t

kerusakan akibat ctJlc ^t


.

untuk menahan beban roda.


untuk melindungi badan jalan dari

Sebagai lapisan aus (weaing coarse)

Bahan untuk lapis permukaan umumnya adalah campuran bahan

t d^n aspal,dengan persyaratan bahan


^greg

yang memenuhi

lapisan dapat bersifat kedap air;disamping

itu

Penggunaan bahan aspal dipedukan sebagaibahan pengikat

standar.

dan agar
^grcg
bahan
aspal sendiri

B;I^I.IA 2 : PER,4NCAN4AN PET'KERASAN JALAN

16 t<o?t6GRUX6rMJ,Alt

Elemen Struktur Perkerasan Jalan

mempertinggi daya dukung


memberikan bantuan tegangan tarik,yang berarti
lapisan terhadap beban roda lalu - Iintas'

FUNGSI BURDA:
sama dengan BURTU
SIFAT BURDA :
sama dengan BURTU.

Pemilihanbahanuntuklapispermukaanperludipertimbangkan
dicapat manfazt
kegunaan,u-.., ,..,.rrra,serta pentahapan konstruksi'agat
yrig ..b.r^r - besarnya datbiayayang dikeluarkan'
Permukaan adalah:
Bahan yu.g r,,'" digunaian untuk Lapis

Beton)
Asphaltic Concrete=AC(I-ASTON=Lapis Aspal
Rolled
HRS(Hot
Hot Rolled Asphalt (HRA) dalam hal ioi
Sheet)=1tr1,\-SfON papis. Tipis Aspal Beton)
LASBUTAG papis Aspal Buton Aggregat campuran
dingtn)

- I-\PEN
- t-A.TASBUfrl pupit Tipis Aspal Buton Murni)
- LATASIR Q-apis Tipis Aspal Pasir)
- BURAS (I-aburan AsPal)
- BURDA-1L,b"a' Aspal Dua Lapis) dan BURTU Q-abur
Makadam)
Q-aPis Penetrasi

47

Tabel3 .8. Persvaratan Gradasi


SARINGAN
TIPE I
TIPE

II

t untuk BURTU.
TIPE III
TIPEIV

100
3/t

( 19,1 mm )

90

100

100

Vzu

{ 12,7 mrn

CI*25

"
no.4
no.8

( 9"52 mm

0-8

0*30

0*5

( 2,36 mm )

no.200

(0,074mm)

0*8
0*5
0-2

3/8

(5

mm)

90

a-2

Ukuran Nominal (mm )

2A

100

100

90

100

100

0-8

- 100
0- 10

o-2

a-2

0 -30

12

75

AsPal Satu LaPis)'

SMA (SPlit Mastic AsPhalt)


BMA (Iiutonized Mastic Asphalt) dll'Sifatspesifikdaribeberapaelemenpermukaantersebutdiielaskan
dibawah ini.

lapis penutup yang


3.1.4.1' Buttu : (I-aburan Aspal Satu Lapis)'adalah
lapis
terdid dari lapis)n aspzl,yaig ditaburi dengan satu
^greg^t
20 mm'
bergradasi setagam,dengan tebal maksimum

FUNGSI BURTU :
- membuat Permukaan tidak berdebu,
- mencegah masuknya air dart permukaan perkerasan'
- -.rrrpobaiki tekstur permukaan perkerasan
SIFAT BURTU
- kedap air
- kenyal

100

xA"
th"

(19,1 mm)

(12,7 mm)

3/&' ( 9,52 mm )
t:o.4 (5mm)
no.8 ( 2,36 mm )

tidak memPunYai nilai struktur


tidak licin

,0

100

100

0*25
0-8

100
90

100

90

- 100

0-30

100

0*5

0*30

0-8

a-2

0-8
0*2

0-5

0-10

0-2

a-2

ao.200 ( 0,074 mm )

Ukuran Nominal ( mm )

: (Laburan Aspal Dua Lapis)'adalah iapis penutup


lapis
yang terdiri dzir lapisan aspal,yang ditaburi dengan
^gfeg^t,
35 mm)
ait&1uU., dua kali ,rru,ubert"rutan (iebal padatmaksimum

3.1.4.2.'Burda

Tabel 3.9. Persyar^tan Gradasi


at untuk BURDA.
SARINGAN
% LOLOS
TIPE I
TIPE II
I-APIS I
LAPIS II
I-APIS I
LAPIS N

2A

,12

75

1CIo

3.1.4.3.. Lapen: (Lapis Penetrasi Makadam),merupakan lapis perkerasan


yang terdiri dari agregat (batu) pokok,dan batu pengunci, bergradasi
terbuka dan seragam,yang diikat oleh aspal dengan cara disemprotkan

Ey.KI 2 : PER,4NC,4N(AN PERKERASANJ.+T4N

xon6t4uN6J 74A4il

lllemen Slruktur Perkerasan Jalan

rrtasnya,dan dipadatkan Iapis demi lapis. Bila akan dipakai sebagai lapis
-'rrrukaan diberi laburan aspal dengan batu penutup.

Tabel 3.10. Persy

FUNGSI LAPEN
- dapat digunakan sebagai lapis permukaan,atav

(4-5

cm)

POKOK
MELEWATI

/f mm
60 mm

kekuatan utama didapat dari mekanisme saling mengunci


batuan pokok dan pengunci
(interlockin!,
^fltata
mempunyai nilai struktural
cukup kenyal dan

50 mm

40 mm

z) mm
1) mrn

mempunyai permukaan kasar.

BAHAN

(5-8cm)

AGREGAT

kurang kedap air

gradasi: LAPEN

TIPE RATII

- sebagai lapis pondasi.


SItrAT LAPEN

^ratar

( 7-10 cm )

SIFAT

49

100
90 * 100
55 - /t'

0- 15
0*s

95

100
100

35

-70
0-15
0-5

95

100
100

0-5

AGREGAT
PENGUNCI
MELE'i${/ATI

25

rnfr

- Agregat Pokok

18 mm

- Agregat Pengunci
- Agregat Penutup ( untuk lapis permukaan ).

9mm

,, lrrn:rli,rliaduk,dihampar dan dipadatkan secara

I]UNGSI I-ASBUTAG

dingin

(cold mix)

sebagai lapis permukaan ataa lapis aus.


rnclindungi lapis dibawzhnya dart atr da'n csaca
r r c nvediakan permukaan y ang r^ta
r

SIIINT LASBUTAG:
I'r'rlrt;l air,

100
* 100

95

0-5

100
100

0-5

AGREGAT
PENUTUP

MELEWATI

PERSYARATAN AGREGAT:
I(eausan pada 500 putaran mln 40oh.
^. Indeks Kepipihan maksimum 2570
b.
c. Kelekatan terhadap aspal > 95oh
d. Bagan- bagian batu yang lunak maksimum 570,
e. Gumpalan-gumpalan lempung maksimum 0,25o/o.

'.1.4.4.. Lasbutag: papis Asbuton Agregat),merupakan lapisan yang


rrtliri dari campuran antara agregat,asbuton dan bahan

95

72mm

9mm
4mm
2mm

I
{

l{

85

100
100

85

10-30

100
100

10-30

0-10

0-

percmajaan asbuton,memedukan

kestabilan teqpengaruh cuaca dan lalu lintas,


kedap air,
cukup kcnyal.

waktu

10

setting,sehingga

3'l'4.5. o Buras: (I-aburan Aspal),merupakan lapis penutup


terdiri dari
lapisan aspal taburan pasir dengan .ri,r.r.,
tudr maksimum 3/g inch.
FUNGSI BURAS :
- tidak berdebu,
- kedap air,
- tidak licin, dan
- mencegah lepasnya butiran

^greg^t

akibat l^lu lintas.

flo xo?t6c4ux6J7,At4n

Eutk,u.

2 : PER,ANCANqAN

PER,KER,ASANJALAN

Elemen Struktur Perkerasan Jalan

SII;NT BURAS :
- tidak mempunyai nilai struktutal,
- kedap air,
- tidak licin,
- mengikat butir halus,dan
- kenyal.

r Latasit: (I-apis Tipis Aspal Pasir),merupakan


terdiri dari aspal keras,dan pasir alam bergradasi

lapis penutup yang


menerusdicampur,
dihampar dan dipadatkan,pada suhu tertentu dengan tebal padat 1-2 cm.

3.1.4.7.

o Latasbum:

(I-apis Tipis Asbuton Murni),merupakan lapis


yang
terdiri
dari
campuran asbuton dan bahan pelunak dengan
lrcnutup,
pcrbandingan tertentu,yang dicampur secafa dingin dengan tebal padat
rnaksimum 1. cm.
FUNGSI I,ATASBUM :
- sebagai lapis penutup untuk mencegah masuknya
permukaan kedalam struktur perkerasan.

3.1.4.6.

dzri

SIFAT I,ATASBUM :
- kedap ur dan kenyal,
- tidak mempunyai nilai struktural, dan
- cukup awet.

- menyediakan permukaan jalaoy^ngffita dan tidak licin

SIFAT I-ATASIR:
- Kedap air dan kenyal,
- Tidak mempunyai nilai struktural,
- Peka terhadap penyimpangan perencanaan dan pelaksanaan,

3.1.4.8. . Laston : (I-apis Aspai Beton) disebut juga AC (ASPHALTIC


CONCRETE) radalah suatu lapisan permuka afl,y ang terdiri dari campuran
aspal keras dan agregat yang bergradasi menerus,dicampur, dihampar dan
dipadatkan,dalam keadaan panas pada suhu terrentu.

SIFAT LASTON :
- kedap air,
- mempuflyai nilu struktural,
- awet,
- mempuflyirkadat aspal4-7oh terhadap berat campuran
- dapat digunakan untuk lalu lintas ringan,sedang sampai berat

- Tahan keausan akibat geseran ban lalu lintas,dan


- Tahan terhadap pengaruh cua'c .

Dalam perkembangannya,terutama untuk proyek pemeliharaan


jalan,penggu naan Latasir,ditingkatkan kedalam spesifi kasi bahan
HRSS (Hot Rolled Sand Sheet). Ada dua jenis yaitu HRSS-A
dan HRSS-B,dengan persyaratan proporsi campuran nominal
sebagaimana pada Tabel 3.1 1.

Tabel 3.ll.Ptoporsi Campuran Nominal HRSS.

1. AGREGAT KASAR

PROPORSI CAMPURAN NOMINAL


PERSEN BERAT TOTAL CAMPURAN ASPAL

PERSYARATAN AGREGAT berdasarkan SNI 1737-1989-F

Agregat Kasar ( CA ) ( > No.8 )


Agregat Halus ( FA ) ( #S - #200 )

Bahan Pengisi

Total Kadar Aspal dalam Campuran

ar

FUNGSI I-ATASIR:
- sebagai lapis penutup,
- sebagai lapis aus,

(FD ( <No.200)

5l

Agregat kasar harus terdiri dari batu pecah,atau kerikil pecah


yang bersih,kering,kuat,awet dan bebas dari bahan lain yang
tidak diperlukan
Keausan pada 500 x putarafl mesin Los Angeles, maksimum
400h

Kelekatan dengan aspal minimum9lo/o

Jumlah berat butiran tertahan no.4 yang mempunyai paling


sedikit dua bidang pecah min 50o/o (khusus kerikil pecah)
Indeks kepipihan tertaha;o 9,5 mm atzu 3f 8" maks 25oh
Penyerapan ur maksimum 3%o

Elemen Struktur Perkeresan Jalan

52 XOvr6C4Ut<&t74t4%.

Berat ienis curah (bulk) min.2,5 (khusus terak)


Bagian yang lunak maksimum 5%0.

Tabel 3.12. Persy at^tatt Bahan Pengisi


KADARAIR
SIFATUMUM

2. AGREGAT HALUS

-).

Agregat halus,harus dari pasir alam,pasir terak,pasir buatan,atau


gabungan dari bahan tersebut.
Agregat halus harus bersih,kuat,kering dan bebas dari bahan
lain yang mengganggu,serta terdiri dari butir yang bersudut
taiam dan permukaan kasar.
Apyegat halus yang berasal dari batu kapur pecah,hanya boleh
digunakan,apabila dicarhpur dengan pasir alam dengan
petbandingan yang sama, kecuali dari pengalaman terny^t^
akibat lalu lintas,bahan tersebut tidak mudah licin
Agregat yang berasal dari hasil pemecahan batu,harus berasal
dari batuan induk,yang memenuhi pefsyaratan agtega:t kasar.
Agregat halus harus mempunyai angka ekivalen pasir minimum
500 .

Bahan pengisi harus dari abu batu,abu batu kapur,kapur padam,


semen atau bahan non-plastis lainnya,
Bahan pengisi harus kering,dan bebas dari bahan lain yang
menglqanggu,dan bila diperiksa dengan anahst saringan secara

basah memenuhi gadasi sesuai Tabel 3.12.


4.

Gradasi

GUMPALAN PARTIKE.I,
BUKAAN SAFJNGAN (mm )
No. 30 ( 0,59 mm )
No. 50 ( 0,279 mm )

No.100(0,'149mm)
No. 200 ( 0.074 mm )

Agregat campuran yafig diperoleh melalui Pencampurafl


meflurut proporsi yang dipedukan dalam 'iob mix',nilai
ekivalensi pasir tidak kurang dari 50oh.
Aspal yang digunakan untuk aspal beton harus dari salah satu
PEN 60/70 at^v 80/100 yang seragam,tidak mengandung
airdan bila dipanaskan sampai 175" C,tidak berbusa.

% LOLOS SARINGAN
100
90 100
90 * 100
65 - 100

Kadar aspal dalam campuran 4o/o-7o/o


Kadar aspal yang tepat,harus ditentukan berdasarkan pengujian
Marshall,dan memenuhi persyaratan sebagaimana pada
Lampiran B-11 (Sumber: Asphalt Institute)

Tabel3.13. Persy^r^tan Campuran Lapis Aspal Beton


LALIN BERAT

LALIN

(2x75

I.ALIN

SEDANG

RINGAN

SI}.AT CAMPURAN

(2x50

tumbukan )

(2x

tumbukan )

MlN

35

tumbukan )

MAKS

MIN

MAKS

MIN

MAKS

2,0

4,0

450
2.0

4.5

3s0
2,0

5.0

200

350

200

350

200

350

.)

STABILITAS&s)

550

KI],LELE}IAN ( FLOW )mm


STARILITAS/ KELEI-EHAN Gg/mm)
RONGGA DLM CAMPURAN ( % )
R{)5664 DAIAM AGRr,.CAT (o/o)
TNDEKS PERENDAMAN(70)

LIHAT Tabel
75

AGREGAT CAMPURAN
.ilgregat campuran harus mempunyai gradasi menerus,dari butir
yang kasar sampai halus,dan harus memenuhi salah satu pilihan
gradasi pada T abel 3.13.

MAX 1%
T1DAKADA

5. CAMPURAN ASPAL DAN AGREGAT untuk Aspal Beton.

BAHAN PENGISI

53

BWz:u. 2 : PERANCANqAN PERKER,ASAN JAL-AN

3.14

75

75

CATATAN:

1.

Rongga dalam campuran aspal, dihitung berdasarkan Berat Jenis maksimum reorids
campuran (berdasarkan berat jenis effektip agregat),atau berdasarkan berar jenis
maksimum campuran menun.rt AASHTO T 209-82.
2. Rongga dalam agregat ditetapkan berdasarkan berat jenis curah @ulk) dad agregat.
3. Indeks pcrendaman ditetapkan berdasarkan rumus:
STABILITAS I\{ARSHAI-I- se telatr dircndam dalam air,sclama 4fl jam,pada suhu 60,,C ( kg)

----- x 10001,

4.

STABILITAS N{ARSH;\LI- ( kg )
Kcpalatan I.alu l.intas :
Berat : lebih bcsar 500 UE 18 KSAl-/hariljalur.
,.
ir.
Sedang : 50 sampai 500 UE 18I{SAl-/hari/jalur.
iii).
I(ecil : lebih kecil 50 UE 18 KSAL /hariljalur.

B Kw 2 : PER:4NCANqAN

54 r<orr6c4ut1et tr4t4%

PERKERASANJAL*N

Tabel 3.14. Prosentase M inimum }(ongga dalam agre


UKURAN MAKSIMUM

NOMINALAGREGAT
No.16
No.8

PROSTINTAITII MIN1MUM

norric,ca narel,t acngcnr


23,5
21

No. 4

55

diperhitungkan dalam ranc ngar, perkerasan,namun dengan pertimbangan


realitas dan ekonomis, belakangan nilai struktur ini dicantumkan dalam
perhitungan struktur(fabel 3. 1 5.)

18

3/8"

L6

3A"

15
14
13

r/z u

1"
1,

Elemen Struktur Perkerasan Jalan

BATAS-EATAS GRAOASI YAIC OtsTRAM(AT

xR3S KLASA ( 83 50all ra,

rtllt'(

t2

Yz"

2n

11.5

21/2"

11

EATAS-8ATI3 GRAOASI YAI{O DISARANKAN


UTITU( HRS

3.1.4.9. o Lataston (Lapis Tipis Aspal Beton;=gRS (Hot Rolled


Sheet)

F'RI'CLE

lItE

llff'

EATAS - BAT'g oRADASI YAN6 OISANAII|(AI{ I.ilrUX

ltRss KLAS A

I BS

lg.i t+t9!

Lataston atau Hot Rolled Sheet (HRS) adalah campuran aspal yang
perketasan mempunyai fleksibilitas
dirancang dengan kadar aspal ti.gg
^gzr (fatigue). Kadar aspal yang tirgg
tinggi,awet dan tahan terhadap kelelahan
akan menyebabkan film aspal yang meltputi butir-butir aggregat menjadi
tebal, dan sebagian dari aspal akan rnengisi rongga udara yang masih
kosong.

HRS termasuk kelompok ienis campuran yang disebut HRA (Hot


Rolled Asphalt).Yang lainnya adalah ATBL (Asphalt Treated Base
Levelling), sebagai bahan levelling sebelum HRS dihampar,dan ATB
(Asphalt Treated Base),sebagai lapis pondasi atas.

t yang dipakai untuk HRS,mempunyai gradasi


^gglcg
senjang, dimana zggteg t memeflukafl pfoses penyaringan(screening) setelah
material diambil dari lokasi penambangafl nya Oof f ow-pit),s ehingga beberap a
variasi ukuran disisihkan,sehingga nantTny^ kurva gradasi dibagian ini
menjadi lebih datar(lihat Gbr.3.2.). Material hasil penyisihan tadi,dapat
dimanfaatkan unruk tambahan fraksi material ATB atau ATBL.
Gradasi

Pada HRA dengan gradasi seniang,iumlah aggregat kasar dalam


campufan hanya sedikit dibandingk2n iengan aggfegat halusnya. Dengan
demikian butir-butir kasarnya ss-612h-olah melayang floatin$diantata
butiran halus,yang mengakibatkan kurangnya bidang-bidang yang saling
mengunci (intedocking) satu samalin. Karenakurangnya sifat intedocking
ini claya dukung komposisi aggfegat meniadi kurang pula. Oleh karena itu
ti<lal<lah mengherankan,pada awalnya nilai stfuktuf HRS tidak

,u,;;; ffii;i'*,,,r. g,u,,rg,,

Gtu. 3.2. Batas disttibusi


( HRS dan HRSS )
^gtegat

Tumbukan pemadatan saat diuji dilaboratorium, pada saat test


Marshall, untuk aspal konvensional, dilakukan 35 kali uniuk lalu lintas
ringan,50 kali untuk lalu lintas sedang, dan 75 kali untuk lalu lintas berat.
Pada HRA versi Bina Marga lg88,jumlah tumbukan selalu 50 kali,untuk
semua kategori lalu lintas (ihat sub-bab 5.10.1.2.). Pada HRA versi Bina
Marga 1,997 jttmlah tumbukan 2x75 untuk semua kategori lalu lintas (lihat
sub-bab 5.10.1.3.)

Pemilihan-pemilihan diatas adalah konsekwensi,diinginkannya


fleksibilitas tinggi,awet dan tahan fatik,tentunya dengan memperhatikan
syarat-syar^t batas struktur lainnya. Sebagai konsekwensi lain dari
diutamakannya kadar bitumen dan besarnya prosentase butiran halus,aclalah
pedunya meneliti daya absorpsi aggregat,karena kalau aggregat absorpsinya

56 XO*1684UX8,J74L4n

BqKq 2 ; PERANCAN(ANPERKERA.SANJ,4L

N
Elemen Struktur Perkerasan Jalan

57

besar sekali,penggunaan aspal menjadi boros,dan menyebabkan strukrur


menjadi tidak ekonomis lagi.

Material tidak beraspal tanpa diberi


lapis resap pengikat hanya mampu
menahan gaya tekan yang bekerja
pada bagian permukaannya.

PERSYARATAN BAHAN HRS.


Persyaratan bahan HRS secara lengkap dapat dilihat pada SNI. 033425-1994
D alam bentuk grafi k,persya r atan batas distribusi gradasi bahan
algregat untuk HRS,HRSS-A dan HRSS-B ditunjukkan pada Gbr.3.2.

Dengan diberi lapis resap pengikat


maka bagian permukaan mampu
menahan gaya tarik dan tekan yang
bekerja pada bagian permukaannya.

Tabel 3.15. Koefisien Kekuatan (Strength Coefficients)


Lapis Perkerasan Lentur.

Gbr 3.3. Fungsi Lapisan Resap Pengikat

Sumber: World Bank,HDM-tII Model)

iu^*TtrRIAL PERKERASAN

KOEFISIEN

KEKUATAN

Lapis Permukaan HRS


Stabilitas Marshall 450 +850 ks(990-i-1875 lbs)
l,apis Pondasi Atas Beraspal(ATB)
Stabilitas Marshall 450 ke(990 lbs)
t,apis Pondasi Atas Agregat

0,28
0,25
4,14

CBR=110%
Lapis Pondasi Atas Agregat

0,125

CBR=80%
Lapis Pondasi Atas Agregat
CBR=25ok
Lapis Pondasi Atas Soil-Cement
UCS=24 ks/cm2(340 osi)
Lapis Pondasi Atas Soil-Cement
UCS > 7 ks/cr*

sebelum pelapisan dengan m teri^l beraspal diatasnya dan kondisi sudah


stabil (apis resap pengikat sudah kering) sudah dapat dilalui oleh lalu lintas(khususnya lalu - lintas proyek) tanpa akibat perubahan kondisi
permukaan yang berarti.

0,10

4J,64
0,14

3.1.6. r-APrS PEREKAT ( TACK COAT )


Sama halnya dengan lapis resap peflgikat, lapis perekat dilaburkan
diantan lapis beraspil lama dengan lapis beraspal yang baru (yang akan

dihampar diatasnya), yang berfungsi sebagai perekat diantaranya.


Kegagalan konstruksi aklbat lapis perekat dapa;t terlihat langsung
pada lapis permukaan berupa :
Retak Selip (Sliperlt Cmck) yang diakibatkan oleh
Permukaan lapisan lama kotor, atau
Pelaburan tidak merat^,
^t^u
Perekatan kurang sempufna, atau
Kuantitas pelaburan yang kurang, atau
Kombinasi diantaranya.

CATATAN: Untuk soil-cement basc,strength coefficient (a) mengikuti rumus :


ar= 0,075 +0,039 ucs - 0,00088 UCS2,dimana UCS=lrnconfincd (ir>mpressivc strength umur
14 hari ( dalam MPa.)

^. 1)
2)
3)
4)
5)

3.1.5. r-Aprs RESAP PENGTKAT (PRIME COAT)


Lapis resap pengikat merupakan bagian dari struktur perkerasan
lentur yang tidak mempunyai nilai struktur akan tetapi mempunyai fungsi
yang sangat besar terhadap kekuatan dan keawetan struktur terutamz untuk
menahan g yalztterz,l
gaya rem.
Lapis resap ^tav
pengikat dilaburkan diantara lapisan material tidak
beraspal dengan lapisan beraspal y^ng berfungsi unruk menyelimuti
permukaan lapisan tidak beraspal. Untuk jelasnya lihat Gambar 3.3.

b.

3.2.

Kegemukan (Bleedin$ yang diakibatkan oleh kuantitas pelaburan


yang tedalu banyak.

KELOMPOKSTRUKTURJAT-AN KAr(U.

Struktur Jalan Kaku @lgd Pavement) disebut iuga Perkerasan Jalan


Beton Semen.Dapat dilaksanakan pada kondisi daya dukung tanah dasar
yang kurang baik(kecil,misal berkisar llulai 2 o/o),atau beban lalu

lintas yang

58 Novr6c4uxel74J,4%

BqKq 2 : PERANCANq,AN PERKERASAN-JAL-AN

harus dilayani relatif besat,maka dibuat solusi dengan konstruksi perkerasan


kaht(rigid paaemen) atau disebut iuga perkerasafl beton semen,karena bahan
dasar terbuat dari beton semen.

Struktur perkerasan kaku terdiri atas pelat beton yang diletakkan


pada lapis pondasi bawah yang menumpu pada tanah dasar,dengan atau
tanpa lapis permukaan beraspal diatasnya. Jelasnya lihat Gambar 3.4.
Berbeda dengan perkerasan lentur,beban lalu - lintas pada perkerasan kaku
sepenuhnya dipikul oleh pelat beton. Yang diterima tanah dasar relatif kecil.
Perkerasan beton semen dibedakan ke dalam lima jenis yaitu

-1. Perkerasan

beton semen lersambung t^np^

SUCP=Jointed Unreinforced Concrete Pavement)

-2. Perkerasan beton semen bersambung

dengan

SRCP=Jointed Reinforced Concrete Pavement)

-3. Perkerasan

beton semefl menerus

dengan

tulangan=BBTT
tulangan=BBDT
tulangan=BMDT

(CRCP= Continous Reinforced Concrete Pavement)

-4. Perkerasan beton semen pra-tekan (PRCP=Prestress

Reinforced

Concrete Pavement)

-5. Perkerasan beton sdmen fibre (FRCP=Fibre Reinforced Concrete


Pavement)

Dengan berbagai p-erti6bangan ienis perkerasan beton semen (4) larang


dilaksanakan di Inionesia,sehingg a pada Pedoman P erencanaan Perkerasan
lalan Beton Semen Pd T-14-2003 fenis perkerasan beton semen
tersebut,tidak dibahas secara khusus.

3.2.1,. ELEMEN TANAH DASAR

Dalam struktuf perkerasan beton semen,tanah dasar hanya


dipengaruhi tegangan akibat beban lalu - lintas dalam iumlah relatif
kecil,akan tetaptdaya dukung dan keseragaman tanah dasar sangat
mempengaruhi keawetan dan kekuatan perkerasan kaku.
Untuk memperoleh daya dukung dan keseragamanny^ maka dalam
pelaksanaan konstruksi perlu diperhatikan faktor - faktot : kadar air
pemadatan (harus pada kondisi kadat a1r optimum),kepadatan dan
perubahan kadar air selama masa pelayanan.

Daya dukung tanah dasar pada konstruksi perkerasan beton


semen,ditentukan berdasarkan nilai CBR insitu sesuai dengan SNI 03 1731. - 1989,atau CBR laboratorium sesuai dengan SNI 03 - 1,744 - 1989.

l)apat iuga didasarkan modulus subgrade reaction (k). Bila dibandingkan fungsi
trLnah dasar pada perkerasan lcntur,sccara relatif fungsi tanah dasar pada

Elemen Struklur Perkerasan Jalan

59

perkerasan kaku(beton semen),tidak tedalu menentukan dalam ata kata


bahwa perubahan besarnya daya dukung tanah dasar tidak berpengaruh
tcrlalu besar terhadap ketebalan pelat beton. Dapat disimak pada Road Note
29 (TRLL-UI! dinyatakan bahwa untuk tznah dasar dengan nilai CBP. 2o/o
sampai dengan 1,5o/o, tebal pelat beton dinyatakan sama tebal.

3.2.2. ELEMEN I-APIS PONDASI BAWAH.


Hanya ada satu lapis pondasi,yaitu lapis pondasi bawah.Karenalya
dapat juga langsung disebut sebagai lapis pondasi.Pada umumnya fungsi
lapis pondasi bawah(sub-base) untuk struktur perkerasan kaku,tidak
bcrfungsi tcdalu sttuktural,dalam arts kata keberadaannya tidak untuk
menyumbangkan nilai struktur terhadap tebal pelat beton.
Menyediakan sub-base dengan hanpan berinteraksi dengan subgrade dalam
usaha mengurang tebal pelat beton adalah tidak ekonomis (Technical Note
45, CCA =Cement and Concrete Association of Australia).
Lapis pondasi pada perkerasan kaku mempunyai fungsi utama
sebagai lantai kerja y^ng rat^ dan uniform,disamping fungsi lain sebagai
berikut:
a. Mengendalikan kembang dan susut tanah dasar.
b. Mencegah intrusi dan pemompaan pada sambungan retakan
dan tepi-tepi pelat.
c. Memberikan dukungan y^ngm nt^p dan seragam pada pelat.
Permukaan sub-base yang tidak rata,akan menyebabkan ketidak-rataafl pelat
b eton,yang dapat memicu timbuln y a kerctakan pelat.
Lapis pondasi bawah terdiri dari :

1)

Pondasi bawah dengan material berbutir lepas

(anboand

granalar)dapat befupa sirtu.Harus memenuhi persyaratan SNI

03-6388-2000 dengan gradasi aggregat minimum kelas


B.I(etcbalan minimum lapis pondasi bawah untuk tanah dasar
dengan CBR minimum 5'% adalah 15 cm. Derajat kepadatan
lapis pondasi bawah adalah minimum 10O%n,sesuai SNI 03-17431989.

2)

Pondasi bawah dengan bahan pengikat(=BP)- (bound granular


subbase), dikenal clengan nama CTSB (CementT'reated 5'abbase).
Dapat digunakan salah satu dari :
a. Stabilisasi material berbutir dengan kac'lar bahan pengikat
scsuai rancangan,untuk menjamin kekuatan campufan dan

ffi

ron6E4ut16.1

MJA?|

B"tk'7. 2 : PER.4N0,4NqANPERKER,4.SANJAL

ketahanan terhadap erosi.Bahan pengikat dapat berupa


semen,kapur,abu terbang (ffi ash),atau slag yang dihaluskan.

b. Campuran beraspal bergradasi rap^t (dense-graded arpbalt).


c. Campuran beton kurus giling padat (lean rolled concrete) yang
mempunyai kuat tekan karakteristik pada umur 28 hari
minimum 2,5MPa (55 kg/cm).

3).

Pondasi bawah dengan campuran beton kurus=CBl((Lean-mix


Concrete).

CBI( harus mempunyai kuat tekan beton karakteristik pada


umur 28 hari minimum 5 MPa(50 kg/cm'z) tanpa menggunakan
abu terbang,atau 7 MPa(70 kg/cmz) bila menggunakan abu
terbang,dengan tebal minimum 10 cm.

Lntara pelat dengan pondasi bawah tidak ada

ikatan
(boandin!,sehingga perlu dipasangi bound breaker diatas subbase.Bound
breaker ini biasanya berupa plastik tipis atau laburan bahan tertentu untuk
mencegah bounding subbase dengan pelat diatasnya.Hal ini dilakukan untuk
subbase tipe bound granular (CTSB),namun untuk tipe unbound seperti
sirtu,tidak tedalu dipedukan bound breaker,karena tidak teriadt lekatan
subbase dan pelat.Kecuali ada kekhawattrafl dewateing camPuran
^rrtzrzdari pelat masuk kecelah-celah sirtu.Disamping itu permukaan
beton

subbase tidak boleh digaruk (groorc maupun brusb). Berbeda dengan


permukaan pelat yang selalu harus digaruk untuk mendapatkan gesekan
permukaan yang cukup besar@roouing berupa alur memaniang
^t^tr
melintang).
o

ELEMEN CEMENT TREATED SUB-BASE (CTSB).

Elemen Struktur Perkerasan Jalan

Aggregat untuk CTSB,harus bebas dari bongkah tanah lempung,


li()tofan,unsur organik atau unsuf yang merugikan lainnya.
Persyaratan aggregat yang akan digynakan untuk CTSB,agar
rncmenuhi syarat pada T abel 3.16.

Tabel3.16. Spesifikasi bahan CTSB.


URAIAN
. ANALISA SARINGAN:
Urutan Saringan:
1

b.

Air.

Air

yang digunakan untuk mencampur,merawat atau pemakaian


lain,harus bebas dari minyak,garam asam,alkali,gula,tumbuhan atau bahan
lain yang merugikan hasil akhir.
c. Agregat:

PERSYARATAN
%,

y,,,

lolos sadngan dalam berat


95

i/ r,
/4

50

- 100
- 100

20*60

No.8

No.200

0 -15

Indeks Plastisitas
Kadar Semen

max 9

+-

6Yo

Lapis Pondasi Bawah

N\WffilIi*.\.\N#iffi fAS$S#/'rFl',i{*$S\Sgrye4*+"sWW--k"ahoasar

Gbr 3.4" $truktur Perkera*an Kaku fltilu Beton


Semen

a. Semen.

Semen y^ng digunakan untuk CTSB,adalah Pordand Cement


biasa,sesuai dengan pefsyaratan SII. 0013-77 "Cement Pordand"
^tav
AASHTO M 85 @ordand Cement tlpe 1).

6l

d. Bahan Campuran

CISB.

Perencanaan campuran harus memberikan perbandingan komposisi

aggregat,dengan beberapa kadar semen dan kadar att optimum,yang


memberikan hasil sesuai dengan mutu beton yang diingini. I(ekuatan
campuran minimum,pada umur 28 hari,idak kurang dart 7 5 kg / cm2 .

3.2.3. ELEMEN PEI-AT BETON.


Pelat beton terbuat dari beton semcn mempunyai mutu tinggi,yang
dicor setempat diatas pondasi bawah. Elemen pelat beton dibuat dari bahan

Bl^t<q 2 :

62 XOn6E4Ut1&t74J4n

PER

yang biasa dipergunakan untuk konstruksi beton,seperti diuraikan dibawah


ini.
a. .femen.

Semen yang digunakan merupakan jenis semen pordand yang


memenuhi, AASHTO M-85 kecuali jenis IA,IIA,IIIA dan IV. Additive tidak
boleh digunakan kecuali ada ljin direksi.
b.

Elemen Struktur Perkerasan .lalan

ANCAN(AN PERKER-,4SAN JAL,AN

Air.

63

hekuatan struktur beton umumnya dinilai dari kekuatan nilai kuat


tckan(compressiue strength). Namun untuk struktur perkerasan kaku faktor
l<ekuatan ditentukan oleh parameter Nilai Kuat Tarik Lentur,karena pada
pelat beton dengan perbandingan paniang dan lebar yarrg besar tekanan
pada beton rrlaaf kecil,sedangkan lenturan yang menyebabkan gaya tarlk
cukup besar.
Disamping parameter kuat tarik lentur,beber^pa parameter lain sepertt slump
clan fatik beton sangat diperhatikan dalam r^ncanga;n perkerasan kaku.

- seperti CTSB, diatas.


c.

e.

Agregat.

BatangTalangan.

Batang Tulangan baja yang dipakai,mengikuti SII 0136-84 "Baja Ttlangan


Beton,atau AASHTO M-32 "KawatBajaTankan Dingin untuk Penulangan
Beton", AASHTO M-55 "Anyaman Kawat Baja dilas untuk Penulangan

Sifat Agregat seperti pada Tabel. 3.17 dan 3.18.


d. Camparan beton.

Beton".

i). Persyaratan sifat Campuran Beton,mengikuti spesifikasi yang diberikan

Batang tulangan yang dipakai merupakan baja polos ataubaja berulir dengan

pada Tabel 3.19.

mutu BJTU-24. Untuk penulangan berupa


n baja harus mengikuti
^ny^m
AASHTO M-55. Kawat pengikat baja triangan harus dan baja lunak sesuai
AASHTO M32-78.
Diameter batang tulangan yang dipakai bervariasi tergantung beban kerja,
namum umumnya adalah O 16 mm,19 mm atau 25 mm,dengan masing-

ii). Beton yang digunakan harus mempunyai Flexural Strength

(kekuatan

lentur beton) minimum 45 kg/cm2(sesuai AASHTO T-97).


abel 3.17. Sifat Assrepat Beton.

masing selimut beton yang dipakai 3,5 mm, 5 mm dan 6 mm.

BATAS MAKSIMUM YANG

PENGUJIAN

SIFAT
Kehilangan akibat
abrasi mesin Los

DI]IINKAN
AGREGAT
HALUS

AGGREGAT
KASAR

sNI03-2417-1991

AASHTO T 96-87

4U/o

Anqeles

Kehilangan akibat

AASHTO

1 104-87
lat

penesnun kualitas

sK-sNIl M01-1994-03

AASHTO

11.2-87

0s%

0,254h

3o/o

1.%

dapat pecah dlm

Assresat
Bahan I-olns

Bahan untuk pelindungpemeltharaan


setelah pelaksanaan.
- Jenis bahan ' . ioint sealant

200

sK-sNI-M0201994-03

AASHTO T 11.87

dan

. curing compound
. ePoxy

Join sealantrmerupakan bahan pengisi siar ata't alur pada sambungan dapat
berupa bahan silicone,acrylic,polysulfide,polyurethane,elastomer dan lainlain. Tiap bahan mempunyai persyaratan sendiri,seperti pada Tabel
3.20.(ASTM D-3406 -78) untuk jenis bahan elastomer yang dituang kedalam
siar,dalam kondisi panas.

dan perbaikan beton selama

l2o/o

dengao Sodium

Sulfat
7o Gumpalan tanah
dan Panikel yang

f.

Pl7IKrl. 2 : PER;{NCAN4AN PERKERA'9ANJAL N

M NOfigZ4UNg.ttraJJtl

3.18. Persyarutarrr Gradasi Agregat Beton'

Tabet

,7n

LOL()S SARINGAN (THD. BF-RAT)

UKURAN AYAKAN

PILIHAN

AGGREGAT FIALUS

AGGREGAT KASAR

2"(50 mm)
9s

1,5"(37 mm)

100
- 100

1"(25mm)

3/i' (19 mm)


'/2 "(13 mm)
3/8 "(10 mm)

35
100
95 100

No.4(4,75mm)
No,8(2,36mm)
No.16(1,18mm)
No.50(0,3 mm)
No.100(0,15mm)

-70

10-30

0-5

95

100
100

90

25-60

100
100

100
90

0-10
u-5

0-10
0-5

100

40-70
0-15
0-5

20*55

45-80
10-30
2-10

Elemen Struktur Perkerasatr Jalan

clibuat disekeliling perkerasan,yang dimaksudkan untuk mempercepzt atau


rnempedambat pengerasan beton. Dapat berupa reinforced waterproof
paper, polyethelene sheets atau jenis lain. Penggunz nrrya harus mendapat
persetujuan Direksi. Metoda curing dapat saia dilakukan dengan cara poruding
nater,spinkling fog spraying atau dengan satnrated coaer. Pada daerah yang
penguapannya cep^t, dipakai whiA digme nted compoa n/,untuk memperlambat
penguapan. Prinsip curing adalah,meniaga agar kadar air dan remperatur
cukup,pada saat beton mengalami proses hidrasi.
Bahan epoxy,polymer modfied materials,sepertt /atex,acrylic,si/ica Jame;dtpakai
untuk memperbaiki kerusakan-kerusakan kecil pada permukaan perkerasan.

Tabel 3.20. Spesifikasi Joint Sealant


Penetrasi pada suhu 25,'C

harus aipilit ..a.,rikian rupa, schingqa ukuran partikel


rZ
clari iarak minin-rum antara batang tulangan,atau antara batang tersebut
terbcsar <
beton harus
dcngan acuafl atau antara perbatasan lainni,a, dalam jarak dimana pekerjaan

Catatan: Aggrcgat kasar

diten-rpatkan.

Solubiiity ('/, )
Test Flow pada (r0"C (
Test adhesi raik (oh)

knruarax

KARAKTERISTIK BET()N

KEI-AS

BETON

3.2.3.1.

SI-UMP ( mm )

( kg/cm2 )

CONTOH

CONTOH SII-INDER

KUBUS 15 CM

15CMX30cm

hari

28halj

7 hari

28 hari

TIDAK
DiGts,TARKAN

DIGETARKAN

20

K 400

285

400

240

330

K 350

250

3s0

210

290

-50
20-50

300

215

300

180

250

20 -50

K250

180

254

150

210

20-50

K225

150

225

t25

190

20-50

175

115

1.75

95

145

30-60

150

105

1s0

90

125

30-60

50-80

(1/10 mm)

**

Pelapukan

Nilai kuat tarik lentur

perpanjangan >500

I
I
I

17,8"C , 3 siklus

necovery >60%,
tidak teriadi selaput film berr_roa min

Qflexural strength)=f.n

Nilai kuat tarik lentur didapat dari hasil pengujian balok 15x15x75
cm dengan uii pembeb^n^n ttga t:tlk (tltird point hadiny)-AsTM C 78 atau
AASHTO T-97-76 I(uat tarik lentur pada umur 28hari tipikal sebesar 3 - 5
N{Pa (30 - 50 Kg/Cm'),ta.,p^ bahan tambahan. Dengan bahan tambahan
sebagai penguat seperti serat baja(stee/ fbre),aramit atau serat karbon,kuat
tarik lentur harus mencapai 5-5,5 MPa(50-55 kg/cm').Beton yang diperkuat
dengan serat baja disamping meningkatkan kuat tarik lenturny^ |ug^ untuk
mengendalikan retak pada pelat khususnya unruk bentuk yang tidak
laz-im,misalnya jalan sekitar plaza tol,putann dan pemberhentian bus dll.
Panjang serat b^ja afltar^ 15 mm s/d 50 mm yang pada baglan ujungnya
melebar sebagai angker dan atau sekrup penguat unruk meningkatkan
ikatan. Secara tipikal,serat baja dengan panjang 15 - 50 mm dapat
ditambahkan ke dalam adukan beton masing - masing sebanyak 75 - 45
Kg/M3.Semen yang dipilih disesuaikan dengan lingkungan dimana
perkerasan akan dilaksanakan.

compound,adalzh bahan kimia yang ditambahkan Pada beton ataLt


l,.rlr;ur l:rirr 1,anu ditempelkan pada permukaan beton,atau pedengkapan y^ng

( ,rrrirrg

< 130

Test Plastisitas ( 7o )
Test Lekatan pada temperatur
Rcsilience pada25" C

Tcst

Tabel3.19. Persyar^tafi Sifat Campuran Beton'

65

Bl,tP!,. 2 : PERANCANqAN PERKER,AS.AN JAL-AN

66 Xovt664wN6Jtr4t4tt

Hubungan ?fltaf^ kuat tekan karakteristik dengan kuat tarik lentur


beton dapat didekati dengan rumus :

fu = K {(f.)
f., = 3,1.3 K{

dalam MPa,
dalam

(t)

atau

Kycmz

""""""""""(3'1')

""""""

(3'2')

dengan:

f.
f.t

:=kuat tarik lentur beton 28hari Cd!g,/Cm'atau MPa)


:=kuat tekan beton karakteristik 28 hari (Kg/Cm'zatau MPa)
tidak dipecah; dan 0,75 untuk
:=konstanta 0,7 untuk
^gregat
^gregat

pecah.

f., = 1,37 (4")


i**,= 13,44 (f.)

dengan:

f..

dalam MPa, atau


dalam Kg/cm2

67

3.2.3.3. Tulangan pada Perkerasan Beton Semen


l)enulangan pada perkerasan beton semen mempunyai tujuan vtam^:
- mengendalikan lebar retakan,agat kekuatan pelat sesuai tencz.na-

memungkinkan bertambah panjangnya pelat,yang berarti mengurangi


sambungan melintang, j adi meningkatkan kenyamanan perg..rdural
- mengurangi biaya pemeliharaan.
Secara fisik ada dua jenis tulangan yaitu tulangan pada pelat beton tnta.k
memperkuat pelat,dan tulangan sambangan untuk menyambung bagian-bagian

pelat yang sengaja diputus. Kedua jenis tulangan tersebut mempunyai

Kuat tarik lentur beton dapat iuga ditentukan dari hasil uii kuat tarik
belah beton yang dilakukan menurut sNI 03 - 2491 - 7991' dengan
rumus

Elemen Struktur Perkerasan Jalan

bentuk,posisi dan fungsi yang berbeda.


Tulangan pelat pada perkerasan

""""""""'(3'3')
""""""""""(3'4')

=kuat tarik belah beton 28 hari

akibat gulungan banyak bagian tulangan yang tidak ralalagS.

Lokasi penulangan pelat beton tedetak

t/+ tebaf pelat

disebelah atas.

3.2.3.2. Slump Beton.

Parameter slump beton merupakan indikator dari keenceran


beton.Secara ttniauan p.laksanaan angka slump menuniukkan kemudahan
pengerjaan (wirkabitiry).Makin encer beton makin mudah untuk

Fungsi tulangan pelat adarah mengikat beton ag* tidak


retak,bukan untuk menahan momen atav gaya lintang.(F-ungsi
tulangan bukan untuk mencegah retak,tapi
-..rg..rd^liku.,

retak).

i*.I4riurr,,upi kental- encernya campuran memPunyai batasan

teftentu,sesrri d.rrgrn tipe dari konstruksi. Tedalu kental beton akan mudah
mengalami getas liritt*l mudah hancur,terlalu encer-pun beton akan mudah
*.rrlrlir da., mernpunyai keku^tan yang rendah' Umumnya variasi nilai
slump adalah2,5 - 1"0 cm.
Beberapa faktor yaflg memPengaruhi nilai slump adalaln
- kesulitan pencapaian akibat rumitnya tulangan
- iarakwaktu angkut datplant ke lokasi kerfa
- apzkah dipedukan concrete PumP
- apakahdigunakan bahan additive
- jenis Peralatan.
tiitui .io*p beton untuk perkerasan ditetapkan sebesar minimum 2,5
cm dan maksimam 5 cm. Perhatikan tefutama iarak tempuh,katakan iarak
*2,5 cm,atau
tempuh 1. yam bisa mengakibatkan penurunan tit'gg' slump
slump * 0,5 cm'
laraL tcmpuh 10 menit bisa menurunkan tinggi

beton semen disusun dengan:

Bentuk tulangan umumnya berupa lembaran l<tsi(fabricate$


khususnya tip. BBDT. Bila menginginkan kemudahan
pekerjaan jenis lembaran lebih baik daripada gulungan,karena

Fungsi tulangan bukan sebagai tulangan stuktural,sehingga


pemasangannya tidak mengurangi tebal pelat beton.

Tuhngan sambungan pada perkerasan beton semen dikenal dua jenis tulangan

yaitu

tulangan sambungan melintang, dan


tulangan sambungan memanjang.

Tulangan sambungan melintang disebut n11i(dowe0,y^ng berfungsi


sebagai pengendali dari perges emn(sliding deuices) dan pemba gi bebanlio,t
transfer deuice). Biasanya berbentuk polos dan berdiametei relatii besar.posisi
penempatan adalah ditengah-tengah tebal pelat dan sejajar dengan sumbu
jalan. Tulangan pada salah satu sisi melekat pada pelat beton dan pada sisi
yang lain lepas/terbebas dari ikatan dengan pelat.

Tulangan sambungan memanjang disebut tie bar,berfungsi sebagai


unsliding deuicu dan rotatiorual deuices,biasa berupa tulangan

(tteformed

i)r)

"lu
dan berdiameter kecil. Dipasang dengan kedua ujung tulangan
melekat

I
08 xon6z4ut<8Jtr4J.4n

Bwt<V

2 : PERANCAN4AN PER-KER,{SAN

JALAN

dengan pelat (boan$ ditengah-tengah tebal pelat beton,tapi tegaklurus


dengan sumbu jalan.

3.2.4. SAMBUNGAN UOrNl).


Sambungan melifltang berfungsi untuk mengakomodir gerakan
kembang susut,sedangkan sambungan memaniang berfungsi untuk
mengakomodir gerakan melenting dari pelat beton,akibat perubahan
tempefatur terutama pada waktu siang dan malam hari.
Fungsi lain dari sambungan adzlah mengendalikan atau lebih tepat
dikatakan mengarahkan retak pelat leton akibat susut beton (shrinkag)
maupun melenting (wmppin! agar mengikuti bentuk maupun lokasi yang
dikehendaki sesuai dengan f^ncang n. Dengan pengendalian keretakan
tersebut diharapkan retak akan teriadi pada lokasi yang tefatur dan sudah

Elemen Struktur Perkerason Jalon

saat dipotong at,'v bahkan tedalu lama sehingga

dilakukan pada saat beton masih berumur mucla terhitung seiak pengecofan.
dimensi celah
ianis yang Ledua berupa ienis elastomer memedukan ketelitian
dan karena tidak ada daya lekatan mcmeflukan pemeliharaan rutin untuk
menjaga ag2.r berada pada posisinya. Untuk yang cair,pelaksanaan
pemasangannya harus sesegefa mungkin. Menunda tedalu lama akan
menyulitkan pelaksanaan karcna sering kali celah sudah mulai ditutupi oleh
bahan atau debu yang akan menggaflggu pfoses lekatan. Sebelum ioint
scalant dituang kotoran dalam celah harus disingkirkan dahulu bila perlu
<lcngan sempfotan menggunakan blower.
Pelaksanaan penggergafian pelat(saw cuttir@ agaf memperhatikan :
licrcp,rtan lokasi,ketepatan kedalaman (V* tebal pelat) dan tepat
wirl<ttr,lriasanya dalam batas 4 - 24 iam sejak pengecof^fl.8^t^s waktu
tt.rsclrtrt pcrlu cliperhatikan untuk rnenizLga beton iangan terlalu lunak pada

proses

penlusutan(sbinkag) sudah berlangsung,hingga retak (crack) yang leriadl


tidak pada lokasi yang disediakan.
3.2-4.7. sambungan memaniang dengan

bat,,ngpengikat (tie bars).

Fungsi pemasangan memanjang adalah untuk mengendalikan


terjadinya retak memanjang. Jank antara sambungan memanjang iekitar 3-4
metef.
Sambungan memanjang harus disertai tulangan dengan jenis batang
ulir dengan mutu minimum BJTU 24 danberdiameter 16 mm.
Ukuran b^tangpengikat dihitung dengan rumus berikut ini:

A,=204x bx h

disediakan yaitu pada posisi tulangan sambungan.

Pada sambungan melintang terdapat dua ienis sambungan,yaitu


sambungan susut(c0ntr()rtion loin) dan sambungan pelaks^naan(cznstractizn
joint). Pada setiap celah sambungan harus diisi dengan ioint sealant dari
bahan khusus. Ada dua ienis material pengisi sambungan,yaitu bahan
pengisi yang dituangkan dalam bentuk cairan pada sambungan dan
dit iart nn sampai mengefas. Bahan ini yang bersifat thermoplastic,hasll
pemanasan dari polimer dengan material dasar karet campuf aspal.
biu.rtrrr.rya adalah bahan rubber arlthalt,coal tdrs ^t^u rubber tars. Bahan ients
keclua adalah bahan pengisi dari elastomef yamg mempunyai bahan dasar
d.ari neoprene.Matertal yang telah dibentuk sebelumnya sesuai dengan ukuran
standar sambungan yang akan digunakan, diselipkan diantara celah yang
<lipotong dengan .raw cl.ltter (gergaii potong) beton. Pemotongan sendiri

ff

dan

l=(38,3x@) +75
dimana:

A, - =
(*'.,').

luas penampang tulangan per-metef panjang sambungan

jarak terkecil antar sambungan atau


i,r.ak sambungan dengan
tepi perkerasan (m).
h = tebal pelat (m).
I
- panjangbatangpengikat (mm)
O = diameter batangpengikat (--).
)arakbatane pengikat dapat digunakanT5 cm.
3.2.4.2. Sambungan pelaksanaan memaniang.

Sambungan pelaksanaan memanjang umumnya

dengan

menggunakan sgr penguncian. Bentuk dan ukuran gigi pengunci


dapat berbentuk trapesium (ihat detail c bawah GW.1.4)- atau
berbentuk setengah lingkaran.
3.2.4.3. Sambungan susut memanjang.
Sambungan susut mem anjang dapat dilakukan dengan sarah satu
cara dan dua metoda berikut,yaitu dengan melakukan penggergajian
(nw cu) atau membentuk celah pada saat beron masih dalam konclisi
plastis,dengan kedalaman 1 / 3 dari tebal pelat.

BqKq 2 : PERANoAN(AN

70 xon6z4uN&1x4J,4u

PERKER,ASAN JAL-+N

Elemcn Struktur Perkeruson Jalan

7t

bawah jenis stabilisasi semen). Jarak sambungan susut merintang


untuk tip. perkerasan BBTT sekirar 4-5 meter,sedang unruk
perkerasan BBDT sejarak 8-15 meter. Untuk tipe BMDT sesuai
dengan kemampuan pelaksanaan.
Sambungan ini harus dilengkapi dengan batang ruji polos panjang 45
cm,jarak ant,'ra ruii 30 cm,lurus dan bebas dari tonjolan t^iamyang
akan mempengaruhi gerakan bebas pada saat pelat beton men),,usut
DENAH PENULANGAN TIPIKAI PERKERASAN BETON SEMEN TIPE BBDT
DETAIT C.SAMBUiIGAII TIEIIIAI{JAIIG

A, SAIIIBUNGAil

OETAIT

loint

stdant jrntuk

IIIETINTAIIG
iunesi

{ittattiat

luil

muk

tunpi stbagri

Othtuliil
cehh

l)ui)

bcLr

prdr

sebr.qr

diyronq

gu,trjiPolong

2 lajur

petkcusrn sehlgrs

smbu irhn.

kbrrcchh

la"nrirumum

(detail A-Gbr.3.5.). seteng4h paniang ruji polos harus dicat atau


dilumuri dengan bahan anti lengket unruk menjamin tidak ada iktan
dengan beton.

Diameter ruji tergantung pada pelat beton sebagaimana tercanrum


pada Tabel 3.21. dibawah ini.

l,/l'-l/4"
2 cm.

Tabel
NO.

3.27.

(m-)

Plrr,\I2.
pLu

sisipelat 2dibcn pduros

suplr pcgtrr\rn 1x|rs.

tl,ryilii

DEIAIL B . SAI{BUI{GAII TIIELINTANG


(mmh iungsill1almor/ofi
n

ilni

prrrnl
!

rlr"

,0,
plir.tl

't:',

'-

indilr

7t,,,,,,t, ,l

I
l--rujr

lillr

25<h<140
40<h<160

DIAMtrTER
RUJI (mm)
20
24

60<hr190
90<h<220

33

220<h<250

36

28

?"aM'rrli{'l

H,)l,r l\rr I

l_.

roUrui

Diarneter Ruii

TL,BAL PE,LAT BF,TON,H

ruhrgrn yrlos

Llrboipilunns

Gbr.3.5. Illustrasi penulangan perkefasan beton semen.


3.2.4.4. Sambungan susut dan sambungan pelaksaflaafr melintang.

Uiung sambungan ini harus tegak lutus terhadap sumbu memaniang


ialan dan tepi pefkefasan. Untuk maksud mengufangi beban dinamis
akibat lalu lintas,sambungan melintanSl harus dipasang dengan
kemiringan 1 : 10 searah perputaran iarum iam.
3.2.4.5. Sambungan susut melintang.

lrctlrrlrrnan sambungan ini paling tidak mencapai'/+ dari tebal pelat


(lrorrtlrrsi llru,ah icnis ,qrrtnalar) atau 1/3 clari tcbal pelat (pondasi

3.2.4.6. Sambungan pelaksanaan melintang.

Sambungan pelaksanaan melintang yang tidak dirancang


sebelumnya,misalnya akibat darurat kerusakan arat dll. harui
menggunakan batang pengikat berulir. Sedang pada sambungan
yang memang dirancang sebelumnya dapat menggunakan batang
tulangan polos yang diletakkan ditengah-tengah pelat. Sambungan
pelaksanaan rersebut diatas harus dilengkapi dengan batang p..tgikrt
berdiameter 16 mm,pan)ang 69 cm dan iarak 60 cm,untuk ketebalan
pelat sampai 17 cm. Untuk tebal pelat > 17 cm ukuran batang
pengikat berdiameter 20 mm,panjang 84 cm dan jarak 60 cm.
3.2.4.7 .S anbungan isolasi.

Sambungan isolasi adalah sambungan yang memisahkan perkerasan


dengan struktur Iain misalnya manht/e dari drainase,jembatan,tiang
listrik,jalan lama,persimpangan dan lain lain.

E,4Ku' 2 : PER,ANoAN(AN PeRKERASAN JAL-4N

72 rlo%6g&t'lt16t 74J,4rt

dengan bahan Penuttrp (izint


,S/mbungan isolasi harus dilengkapi
dengan bahan pengSsi (ioint
diisi
sisanya
mm
dan
5-7
i seatan) setebal
-frtt').
Sambungan isolasi yang berbatasan dengan struktur seperti iembatan
perlu pemasangan ruii sebagai s^raina transfer beban. Pada uiung ruii
harus dipasang pelindung muai agar ru1i dapat bergerak bebas.
Pelindr4g muai harus cukup paniang sehingga menutup ruii 50 mm
das.Aasih mempunyai ruang bebas yang cukup dengan paniang
minimum lebar sambungan isolasi ditambah 6 mm.
p-3(:1{-a A-exponsion joint
q- sombungon bergigi pengunci

sombungon digergoii

don E conslruclion joint

pekerjaan

pertama diperkerrs.

Sumber: Hondbook of Concrete Engineering-Mork Fintel

Gbr. 3.6. Sambungan isolasi


Sambungan isolasi pada persimpangan dan ramp tidak perlu diberi
ruji tapi diberikan penebalan tepi untuk mereduksi tegzngan. Setiap

sambungan ditebalkan 20oh dzri tebal perkefasan sePanjang 1,5


metef.
Sambungan isolasi y^ng digunakan padz lubang inlet
saluran,manhole,tiang listrik dan struktur lain y^ng tidak
memerlukan penebalan tepi dan ruii,harus ditempatkan disekeliling
struktur tersebut.

3.2.4.8.Penutup sambungan.
Penutup sambungan berfungsi untuk mencegah masuknya air,debu
atau benda lain kedalam sambung^n y^ng dapat menyebabkan
kerusakan berupa gompal dan atzs pelat beton saling menekan
keatas satu sama lain.

Elemen Slruklur Perkerasan Jalan

3.3. ELEMEN STRUKTUR

73

PERKERASAN INTERBLOCK.

Interblock baru mulai digunakan di Indonesia pada awar 1977.


Penggunaannya umumnya masih terbatas didaerah perkotaan,misalnya
untuk jalan lingkungan dikawasan perumahan,areal pafl<t,pertamanan dan
tfotoar.

3.3.7. PENGENALAN UMUM PERKERASAN INTERBLOCK.


Interblock merupakan unit perkerasan segm ental(segmenral pauing
anifi. Komponen terdiri dari unit utuh dengan bahan dasar batuan,campuran
dan sem-en atau bahan lainnya yang cukup keras. Luas permukaan
^gregat
berkisar 0,10 m2 dengan bidang atas dan bawah d.atar atau hampir datar.
unit ini disusun sedemikian rupa sesuai bentuknya meniadi saru kesatuan
bidang permukaan.
Prinsip utama hubungan antara unit adalah terjadinya kondisi
interlocking (saling mengunci) dari unit-unit tersebut. Hubungan intedocking
inilah yang menjadi elemen kekuatan struktur interblock. proses penguncian
sebenarnya akibat keteraturan posisi unit-unit komponen interblock dibantu
adanya lapis perata dan pengisi berupa pasir,pemad^tan d^n batu pengunci
y^ng membentuk intedocking vertikal dan horisontal. Kemampuan
interblock memikul beban dalam arah vertikal dimungkinkan karena adanya
interlocking vertikal,sedang dalam hal beban horisontal k:aren intedocking
horisontal. Tingkat intedocking harus disesuaikan dengan beban lalu lintai
yang akan dipikul.Untuk beban lalu lintas yang bcrat dipedukan interlocking
yang lebih baik dari beban y^ng rtrtg n.Proses intedocking m".r.rp^i
optimal dibantu pula oleh mekanisme repetisi beban lalu lintas yang lewat.
Pada suatu jumlah repetisi beban as standar akan memberikan interlocking
yang paling optimal.
Pada dasarnya perkerasan interblock adalah termasuk perkerasan
lentur sehingga elemen-struktur utama perkerasan sama dengan umumnya
struktur lentur,yaitu:- elemen tanah dasar, - LPA, - LPB dan Lapis
Permukaan. Hanya ada komponen bahan tambahan berupa pasir perata
(bedding sand),pasfu pengisi Qoint
flling sand) dan batu pinggir (kansteen, atau
kerb)-hhat Gbr.3.7.
untuk struktur interblock yang menahan beban ringan seperti untuk
pertamananan,trotoat dll. tidak diperlukan pemasangan LPA dan LpB.
Disamping itu perkerasan interblock disarankan tidak digunakan pada
ialanjalan dengan kecepatan lebih besar dalj, 60 km/iam,karena dikuatirkan pasir
isian akan'terhisap' oleh roda kendaraan.

74

B'I^KI^

2:

PER,4NCANqANPER.KERASANJAL,+N

'<ON6E,8I4GTMI4,1

Elemen Straktur Perkerasan

Jala,

7i

3.3.2. BAHAN PERKERASAN INTERBLOCK


Interblock sebagai elemen lapis permukaan mempunyai fungsi :
- sebagai bagian perkerasan yang menerima langsung beban

Tabel 3.?2. Kornbinasi Mutu,BentukrTebal dan pola pemasangan


Block
Sumber: Pedoman Penentuan Tebal Perkerasan Interblock)

roda

sebagai lapis rapat air untuk melindungi badan ialan dan kerusakan
akibat cuaca
- sebagai lapis aus (weaing coarse)

PENGGUNAAN
ATAU
BEBANESA
a. Trotoar"pertamanan
l). ESA < 1fi3
c. Tempat Parkirgarasi
d. ESA anam 1S-104.

c. ESA > 10+.


f. Lapang padcir konrainer,
Taxiyay &, Pelabuhan

rrltiliocf,
pcrlr p{aeu

CATATAN:

NrtT$ TqFD$I
!

tst Dur
.

r.-

Gbr. 3.7. Perkerasan Interblock

3.3.2.1.

BENTUK

TEBAL

BL}CK

{mm)

1I
1I

r{,B,C atauX

II

.t,B atau C
A,B atauC

A,B atauC
A atau B

I
I

Bentuk dan Tipe Block.

Beberapa parameter berikut menentukan kekuatan perkerasan


interblock, yaitu:
Mutu block yarug menentukan faktor kekuatan.Ada
beberapa kelas block yang dikelompokkan berdasarkan
mutunya seperti tercantum pada T abel 3.22.

Bentuk block.
Tebal block dan
Pola pemasangan block
Kombinasi pemilihan dari keempat parameter diatas harus tepat
sesuai dengan pembebanan lalu lintas QthatTabel3.22.)

6CI

H!

60

H,B atau

60
80
80

H,B atau 5

100

Gbr.3.8. Bentuk Block.

aauS
S

}{
H,B atauS

1. ESA = Equivalent Standard Axle.


2. Kelas I - Mutu Beton K 450,

Kelas II - Mutu Beton K 350., Lasbutag MS > 500 kg.


3. Bentuk Block:
Bentuk sisi bergigi dengan lekukan yang dapat mengunci dikeempat bidang

sisinyadan dimungkinkan untuk dipasang secara pola dang lkan(bininghon)l


= Bentuk sisi bergigi dengan lekukan yang dapat mengunci didua bidang
sisinya, dan tidak dimungkinkan untuk dipasang secara pola herringbone.Dinamakan pola
any^m^n keranjang ( basket weaue)
= Bentuk empat persegi paniangdinamakan pola memanjang (:tretcber)

ffiffi ffiffi
Ft.rtElmi

Hrr tryBtr

ta==

:=:

@@

Ft ltfr

= Bentuk khusus yang ddak termasuk tipe A,B atau C.

Gbr.3.9. Pola Pemasangan Interblock

3.3.2.2. Pasir perata,pasir

pengisi dan batu pinggir.

a. Pasir Perata (Bedding Sand).

(pkfr*) yang dimaksudkan untuk memberi


kesempatan interblock memposisikan diri terutama dalam proses
penguncian (interlockinS. Pasir mempunyai nilai stmktur yang rendah
sehingga penggunaannya cukup dibatasi dalam tebal yang tipis
lmisalnya
Berfungsi sebagai lapis perata

ffi @ffit

POLA
PEMASANGAN

Udara

g,tPr8 }oFDrgr

EltItl?l,

KOMBINASI YANG DISARANKAN


KELAS
BLOCK

ffiffi

tidak lebih dari 5 cm.).


Gradasi pasir perata agar memenuhi syarat padzTabel3.Z3.
b. Pasir Pengisi (Joint Filling Sand)

BAK\ 2 : PER^NCAN4AN PERKERASAN

76 r1o*16c4u$64 1AJ,Att

JAL-AN

Pasir pengisi ini diisikan pada celah-celah diantaru interblock dengan fungsi
utama memberikan kondisi kelulusan air,menghindarkan bersinggungannya

Tabel 3.23. Grudasi Pasir Perata


UKURAN SARINGAN

% LOLOS SARINGAN

9,52 mm

100

4,/5 mm

95-100
80-100

2,36 mm
1,18 mm

m8100A

?an$nc$nhqn
?enksnqsqn ?A$n

50-85

25-60

600 microns
300 microns
150 rnicrons
75 microns

10-30
5-1 s

0-10

-secara fisik bentuk partikel pasir perata tidak bulat ata:u taia;m'
-Kadar Air < 10% dan Kadar Lempung < 30 .

interblock-interblock yang berdampingan dan memberikan kemudahan


proses intedocking. Jangan menggunakan semen untuk mengisi celah
diantara interblock karena iustru akan menimbulkan retak-retak dan tidak
bisa melalukan air. Gradasi dari pasir pengisi sebagaiman a pada T abel 3.24.

Tabel 3.24. Gradasi Pasir Pengisi.


UKTIRAN SARINGAN

%LOLOSSARINGAN

2,36mm
1,18 mm
600 micrcns

90-100
60-90

300 microns
150 micons
75 microns

15-30
5-10

100

30-6A

-Kadar air < 5oh, kadar lempung dan lanau < 10oh.
-Jzngan menggunakan bahan pengikat seperti semen.
c. Batu Pinggir (Kantsteen

atata,

erancangan struktur selalu akan mencakup konsep dasar


tegangan regangan yang dikaitkan pada sifat kekuatan
material. Pengertian kekuatan batas selalu dihubungkan
clengan 'hancur' nya bahan akibat kombinasi tegangan yang diakibatkan
oleh problem yang dihadapkan oleh suatu r^nc ng n. lSta amati desain
'keruntuhan' iembatan, 'keruntuhan' lereng dalam mekanika tanah,
'keruntuhan' kolom bangunan dan lain-lain.
Demikian pula jalan raya, dalam metoda rzncangannya juga akan melibatkan
p^r^meter 'kehancuran' failure) dalam analisis QInatBab 2.2.).
Baik perkerasan lentur maupun perkerasan kaku, dalam metoda pendekatan,
dihadapkan pada masalah'kehancuran' perkerasan sebagai basis tinjau annya,
yang diukur dari perwujudan (performance) perkerasan itu sendiri.
4.1.

PENGERTIAN UMUM PERWUJUDAN PERKERASAN.

Kerb).

Batu pinggir mempunyai fungsi utaLmz untuk mencegah gerakan kesamping


dari interblock,agar proses interlocking tidak terganggu. Hampir sama
seperri struktur Telford batu pinggir ata;u batu pengunci peranannya sangat
penting. Brlzmana batu pinggir goyah atau bahkan hilang sudah pasti tidak
adalag1 kestabilan dari struktur.
Dengan memberikan bentuk kerb seperti alternatif A pada Gbr-3.7. batu
pinggir dapat pula berfungsi sebagai saluran drainase. Bila dipasang
disebelah luar,batu pinggir dapat diiadikan batas perkerasan y^ng
mcmberikan nilai estetik. Apabila dipasang disebelah dalam dapat diiadikan
pembatas untuk perubahan pola pemasangan dari interblock.

Bertitik tolak pada prinsip bahwa perkerasan direncanakan dan


dibangun untuk melayani lalu lintas secara nyamzLfl, aman dan kuat,
perwujudan perkerasan akan mencakup dua hal pokok:
1,. Kerataan Permukaan, |ang mempengaruhi kualitas perjalanan, dan
2. I(erusakan Permukaan, yang mempengaruhi kemampuan
strukturil perkerasan dalam melayani beban lalu lintas.

Dengan pengerrian tersebut maka istilah 'hancur' sebagaimana


digunakan pada bangunan-bangunan teknik sipil pada umumnya, tidak
sepenuhnya dapat digunakan dengan arl y^ng sama pada struktur
77

78

t1o?t6G4tX6J74J,1u

BVIK,IA

2 : PERANCANqAN

PER-KER,4SAN

JALAN

Metoda Persncangon Perkerasan

perkerasan atau konstruksi lalan secar umum. Sesuatu perkerasan yang


sudah hancur dalam pengertian strukturil, masih dapat berfungsi
memberikan pelayanan pada lalu lintas, meskipun dengan tingkat pelzyanan,
yang jauh lebih rendah dari yang diperlukan.
Perwujudan perkerasan dikelompokkan secara kualitatif menjadi
perkerasan baik, perkerasan kritis dan perkerasan rusak. Pada dasarnya
perwujudan mencerminkan perilaku perkerasan dalam menerima beban,
yangakan dipengaruhi oleh :
0 keawetan dan kemantap^tt bahan perkerasan
0 kesempurnaan campuran bahan
0 kesempurnaan dzn ketelitian pelaksanaan
0 kesempurn an tzncangan strukturil
0 kesempurnaan metoda teknik dan
0 besarnya pengaruh luar maupun dalam dari situasi lingkungan.
Perkerasan baik, adalah perkerasan yang dari perwuiudannya tidak
menunjukkan kerusakan - kerusakan dan kelainan - kelainan bentuk
permukaan, terutama dari tinjauan strukturil.
Perkerasan rasak, ialah perkerasan yang dari peruuiudannya
mempedihatkan kerusakan- kerusakan, mulai dari menunjukkan perubahanperubahan bentuk permukaan yang ingan, sampai dengan perkerasan yang
sama sekali rusak, sehingga memberikafl gangguan pada lalu lintas. Khusus
menghadapi kenyataan panjangnya iumlah ruas ialan yang rusak dalam skala
penanganan , maka klasifikasi 'rusak ringan', 'rusak sedang' dan 'rusak berat'
dapat dimunculkan.
Perkerasan kritis, zdalah perkerasan y^ng dari perwujudannya
menunjukkan kerusakan- kerusakan danf atau kelainan - kelainan bentuk
permukaan yang ringan dan belum memberikan gangguan yang berarti pada
keadaan terjelek dari perkerasan baik, dan keadaan
lalu lintas;berkisar
^ntar^
terbaik dari perkerasan rusak. Perkerasan pada kondisi ini mempunyai ciri,
bilamana tidak segera ditangani sec rz memadai, sewaktu-waktu akan
mengalami kerusakan yang mengganggu lalu lintas.

konteks pembahasan hubungan

Kerusakan perkerasan dapat didefinisikan sebagai manifestasi akibat


batas-batas kemampuan masing-masing elemen
l)('r'kcrlrsan ialan. Dilihat dari sumber penyebab kerusakan, kerusakan
1rt'rlicrusan rlapat dikelompokkan dalam dua kategori,yaitu'kerusakan teknis'
..l,rrr 'lit'r'trsrrkan wajar'. Perbedaan teknis dan wajar harus ditinjau dalam

79

masa pelayanan dan perwuiudan

^nt,.ra
perkerasan sebagai manifestasi kemampuannya
melayani beban lalu lintas.
Kerusakan w@ar, adalah kerusakan*kerusakan yang terladt akibat
dilampauinya tegangan kritis tertentu pada lapisanJapisan perkerasan oleh
tegangan-teg ng n yang timbul akibat pembebanan yang berulang-ulang.
Beban lalu iintas akan mengakibatkan lenduran dan regangan, baik dilapisan
perkerasan maupun pada tanah dasarnya, yang bersifat sesaat, yaitu pada
saat beban lalu lintas berada diatasnya. Besarnya lendutan dan rcgangan yang
terjadi, tergantung pada besarnya perbandingafl
besarnya beban, dan

^ntaa
sifat-sifat lentur dari lapisan perkerasan dan tanah
dasar. pada keadaan
perbandingan tertentu, regangafl sesaat tersebut dapat melampaui regangan
batas, sehingga terjadi regangan-reg ngzn yang tetap. Akumulaii Jari
fegangan-regang n tetap ini, selama masa pelayanan akan menimbulkan
deformasi dan retakan-retakan pada perkerasan, ataa dengan kata lain
timbul kerusakan-kerusakan pada perkerasan.
Kerusakan teknis, ialah kerusakan-kerusakan y^ng terjadi akibat
tegangan-reg nga;n) yang bukan secara langsung bersumber dari repetisi
beban lalu lintas, misalnya oleh perbedaan temperatur, pemampatan,
konsolidasi tanah dasar, susut-muai, pengembangan, kehil^ngan dayi ikat,
reaksi-reaksi kimia, longsoran dan bencan a-bencana lainnya.
Identifikasi kerusakan masuk kedalam kedua kelompok tersebut,
sangat dipedukan, karena penganalisaan dan carr- penanggulangan
kerusakan, pada umumnya berbeda satu sama lain. Pada dasarnyu
perw'njudan lalu lintas, dalam hubungannya dengan masa pelayanan^nilr^
hanya
berlaku untuk kelompok kerusakan wajar

4.3.

4.2. MEKANISME KERUSAKAN.


tlrrri tcdampauinya

Jalan

ti

jt

tl

PENrr-ATANPERWUJUDAN

Permukaan perkerasan idak rata, ataupun kerusakan perkerasan,


merupakan sesuatu yang tidak dikehendaki.Namun biasanya pan pemakai
jalan, menilai dengan cara subjektif dan kualitatif. Pemakai jalan merasakan
ketidak-nyam^nan, dan tidak perduli sengaja atau tidak. yang diperlukan
adalah penilaian kuantitatif, sehingga jelas tindakan apayang harus diambil.
AASHTO mengembangkan cara penilaian yang didasarkan pada
penilaian sekelompok anggota panel, dari berbagai macam bidang profesi.
setiap anggota, masing-masing melakukan penilaian, dan rilai rata-rata dari
penilaian anggota panel, selaniutnya disebut tPresent seruiceabiliqt
Rating' GSR), atau Nilai Perwujudan yang ada. Metoda AASHTO ini
diikuti oleh banyak neg ra. Selanjutnya AASHTO mencari hubungan
^ntarzPSR dengan keadaan fisik )alannya sendiri.Dari hasil percobaan didapat

80

B\Kq 2 : PER-ANoANqAN

t<ou6c4uN6J 74J,4?t

PSR, dengan jumlah ' alur-aluf', dan retakanyang baik


^rrtar^
rctakan yang terjadi pzda perkerasan. Nilai yang didapat dari hubungan
matematis, yang dikembangkan untuk maksud tersebut, selanjutnya disebut
Ptesent Seruiceability fndex (PSI), yang lebih kita kenal dengan lndeks
Perkerasan (Ip).
lndeks Perkerasan arlalah suatu bilang^n yang menyatakan titgg,
rendahnya mutu/ tingk at / nllai perkerasan dalam memberika n pelzy anan,
kenyamanan pada gerakan lalu lintas. Besaran ini tidak mengaitkannya
dengan geometrik ialan, matpun hambatan- hambatan lainnya.
Faktor-faktor yang mempengaruhi Ip, adalah:
* Roughness (I(ekasaran Permukaan),
* Slope variation (Varia si ketid ak- rataan permuka an ialan),
* Crack (Retakan)
* Patch (fambalan)
* Ruth depth (dalamnya alur).
hurl>r-rngan

Rumus yang bisa digunakan untuk mencari .\'eruiceabiliry, adalah:


x dengan menggunakan fumus sederhana:

PSI =5100-01015 R - 0114log


x Rumus

Metoda Perancangan Perkerasan Jalan

PERKERAS,AN JAL-AN

4.4.

4.4.1.7.

RD

=
=
=

Metodologi Umum

Seperti sudah dijelaskan pada Bab 2.2. pendekatan metoda unruk


perkerasan lentur acuan Bina Marga (Indonesia) adalah metoda pert^m^,
clalam hal ini, perznc ngan struktuf perkerasan pada dasarnya menentukan
tebal lapisan perkeras an y^ng mempunyai sifat-sifat mekanis yang telah
clitetapkan sedemikian sehingga menjamin bahwa tegangan-tegangan dan
fegangan * regangan pada semua tingkatan yang teriadi karena beban lalu
lintas, pada batas-batas yang dapat ditahan dengan aman oleh bahan
tersebut. Metoda perancang n didasarkan pada prosedur desain empiris,
seperti misalnya Metoda CBR.

a).

Persyaratan Rancangan Dasar untukJalan Baru.

Ada 3 (tiga) langka,h ltama yang harus diikuti dalam perancangan


perkerasan ialan baru, yaitu:

Hitunglah jumlah beban lalu lintas berdasarkan konfigurasi


beban sumbu standar yang akan melalui jalan tersebut.
Hitung kekuatan daya dukung tanah dasar.
Pertimbangkan i) dan ii) pilihlah kombinasi yang paling
ekonomis untuk bahan-bahan perkerasan serta ketebalan
lapisan yang akan mencukupi pelayanan selama umur
renc fla dengan hanya melakukan pemeliharaan rutin saia.

(R= roughness =inch/mile)

PSI = 5,03 - 1,91 tog ( 1 + Sv) -0,01 (C + P ;o''- 1,38 RD'

SV =

METODAPERANCANGAN

4.4.I. PERANCANGAN PERKERASAN LENTUR

AASHTO:

dimana : PSI

8l

Present Serviceability Index (nilai Ip)


slope variation, yang menyatakan ke-tidak -ra;taan

b).

permukaan
cracking (retak) - (ftl1000 ft)
patching (tambalan) - (ft/1000
nrth depth (alur) - inch

Untuk perkuatan atau rekonstruksi perkerasan-perkerasan yang adz,


diambil pendekatan yang sama. Akan tetzpi adalah dimungkinkan,untuk

ft\

AASHTO menentukan nilai 'terminal seruiceabiliry' (p) terendah yang


masih bisa ditoleransi, pada akhir pedode sebelum direkonstruksi atau
penghamparan ulang, adalah :

* Untuk jalanttama i pt= 2,5


* Untuk falan dengan lalu lintas lebih rendah : p, =

2,0

Persyaratan Rancangan Dasar untuk Peningkatanlalan.

melakukan review desain dengan data ditempat padz saat perkerasan jalan
akan dilaksanakan, dengan menyederhanakan kembali rancaflgan semula,
yang mungkin rancangannya sudah berselang lama dari masa pelaksanaan.
i).Perhitungan lalu lintas dapat diambil dari lalu lintas yang ada, berdasarkan
prosedur seperti pada Bab 1.2.1. dan praktaan pertumbuhan lalu lintas
tahunan, selama 10 tahun.

82

r<Ott6EWr16.'

Butr<u. 2 : PERANCAN(AN PER.KER,4SAN J,ALJQN

74J4!t

ii).CBR tanah dasar reviewdapat ditentukan dilapangan dengan c r^


menggali lubang uji pada sekitar perkerasan yang ada, dan melakukan uji

Meloda Perancangon Perkerasan Jalan

83

Group Index = 0,2 a+ 0,005 (r) (c) + 0,01 (b) (d) =


= 0,2Q0) + 0,005 (20) (0) + 0,01 (40) ( 5) = 6

Penetrometer Kerucut Dinamik (DCP).

Dari grafik didapat

4.4.1.2. Metoda Group Index.

Metoda ini dikembangkan oleh Public Roads Administration @RA)


didasarkan pada klassifikasi kelompok tanah, diturunkan dari
USA,
pengalaman desain terdahulu. Model desain struktur perkerasan terutama
dikhususkan untuk perkerasan dengan LPA (Lapis Pondasi Atas) dan LPB
papis Pondasi Bawah) yang menggunakan
zt^1r t^n h.
^greg^t

Liolas

GI

d
6

d
q
E

Group Index = 0,2 a + 0,005 a.c

a
o

.(4.1)

0,01 b.d

q
o

!.
?

I
{

lebih besar 35o/o

^nt^r^ sebagian dari prosentase material yang lolos saringan no. 200, yafig
lebih besar dari 1,5o/o dan tidak lebih dari 55% dinyatakan sebagai
0 40.
bilangan positip,bulat
^nta;rz sebagian dari batas caLr yanglebih besar dari 40o/o dan tidak lebih dari
60oh dinyatakan sebagai bilangan positip,bulat anrara 0-20.
sebagian dari indeks plastis yang lebih besar dari L0ohdan tidak lebih
besar dari 3}ohdinyatakan sebagai bilangan positip, bulat antara 0 sebagai bilangan positip,bulat

bc

---#$tri tr

lolos saringan no. 200,yang


dan tidak lebih besar dari 75o/o, yang dinyatakan

sebagian dari prosentase material yzng


0

CONTOH SOAL

4.1:

Analisa tanah dasar untuk digunakan bagi perkerasan,mendapatkan


Tanah Lolos saringan # 20O,mempunyai :LL = 40o/o danPL = 1'5oh.
LHR mempunyai intensitas 750 SMP.
o/obtiran Lolos saringan # 200 = 55o/oJadi:

a=55-35=20
b=55-15=40
c=0(

LL tidak melebihi

d=15-10=5

40 )

fi

7/

t
l+r[
ileu

l0a

20.

20.
Rentang nilai group index yang berlaku adalah 0 sampai 20.

s
?

Io

a
,a

dimana:

^=

60lqn

SMP )

Nilai Group Index, dihirung berdasarkan rumus dibawah ini:

Hdon MeEtq

Un ( dolom

E*

2.1

t-a
k* t0.t

W
W,

,ffi ////Wl
WT-

t0m

('::

Gbt.4.1. Metoda Group Index


Tebal Lapis Pondasi Bawah yang diperlukan = 20 cm.
untuk intensitas lalu lintas dengan LHR = 750, diatas garis A- A didapat
30 cm, ini beratti tebal perkerasan lapis pondasi atas dan permukaan adalah
30 cm, dapat diambil LPA = 20 cm dan Lapis permukaan = 10 cm.

ini sangat sederhana, cukup dengan mencari


pengelompokan tanah berdasarkan group index, menggunakan pera),atan
biasa mekanika tanah yangbanyak tersedia di laboratorium, dan beban lalu
lintaspun cukup diwakili perkiraan volume, tanpa memperhatikan berat dan
komposisi kendaraan.
Asumsi masa layan adalah 20 tahun dan beban lalu lintas merupakan beban
rata-rat^ selama 20 tahun.
Metoda Group Index

84 Non6t4ut16Jr4tJu

E,,t}<',. 2 : PERANCANqAN PERKER,ASANJAL-AN

I(ekurangan metoda ini adalah :


- G"-iotan angka group index, tidak mencerminkan perilaku tanah
dasar, dalam menerima beban lalu lintas'
komposisi kendaraan dan konfigurasinya tidak

- Berat maupun

disinggungsamasekali,padaha|faktor.faktorinisangatmenentukan
kerusakan Perkerasan.

kualitasnl'a'
Tidak memperhitungkan komposisi lapisan perkerasan dan
hujan,
Tidak memperhito"gtr" fakior lingkungan (temperatur, curah

dan geometrik ialan).


Parameter kerusakan stfuktuf perkerasan tidak terukur'

Metoda Perantangan Perkerosan Jalun

85

Beban Staodar unruk perbandingan

Penetrasi
0,10 inchi ( 2,54 mm )

0,20 inchi ( 5,08 mm )

1000 lbs/ina (7A3


,UOO

rbr/,n,

ks/

cmz )

( 105,4 kg/cm2)

Model desain struktur perkerasan berdasarkan metoda CBR


diturunkan dari persamaan berikut ini r

safa'
Sebaiknya, metoda ini hanya digunakan pada analisa pendekatan

4.4.l.3.Metoda CBR.
Metoda

ini paling banyak dipakai untuk perencanaan perkerasan

lentur.

Pada atvalnya dikembangkan oleh california Division for Highway,


dan
kemudian baru didndaklaliuti oleh US Army Corps of E'ngineers'
umumnya diadopsi oleh banyak neg^r^ didunia'
Metorfa ini didasarkan hasil empiris oleh california State Highway

t
N
A
p.

- tebal struktur perkerasan ( inci )


= beban sumbu standar kumulatif ( SS )
= luas bidang kontak lingkaran dari suatu roda
=

Department,USA;denganmeflgacupadanilaiCBR(CaliforniaBearing
Ratio).
PemeriksaiLn CBR, dalam lral

ini, ditakukan terhadap tanah dasar,

dapatdilakukandilaboratoriumataldilapangan.NilaiCBRae|alah

standar,
p.ibu.rdirrg,,i afltzf,. beban penetrasi suatu bahan rerhadap bahan
d".rg", kedalaman dan kecepatan Penetrasi yang sama'

logam (mold),
Dilaboratorium contoh tanah dimasukkan kedalam silinder
dengan
diameter 1.5,24 cm dan tinggi 1,7,78 cm, dan dilakukan penumbukan
penumbukan
Sesudah
alat tumbuk sebagaimrna].meriksaan pemadatan.
mesin penetrasi
(standard atau modified) ietakan ini ditempatkan pada
krprsit^, 4,45 ton dengan kecepatan penetrasi_ sebesar 1,27 mmf menit.
P"-b".rr., pembebanul dit,tt 'ttut p'J^ serangkaian penetrasi mulai dari
0,0125" sampai 0,50' '
Bilamana disYaratkan contoh dalam kondisi rendaman (soaked),
dilakukan test'
contoh didalam silinder logam direndam selama 96 iam, baru
NilaiCBRdinyatakandalamprosentasebebanyangmenyebabkan
pcrlctrasi 2,5 mm atau 5 mm terhadap beban standar'

CBR

kendaraan pada sumbu standat ( inci2 ).

tekanan roda akibat beban (psi) ESS7L @,quivalent


Single lMheel Load ) pada bidang kontak A yang
memberikan
reaksi struktural seperti
sama pada

ffilff;;fl:i1ii1:,

i:i?:ffi;vang

indikator kekuatan tanah dasar (oh).

Untuk suatu nilai CBR tanah dasar,persamaan diatas a;kan


mendapatkan hasil berupa ketebalan struktur perkerasan total,yaitu tebal
lapis permukaan,LPA dan LPB ( to",- + trpa * t,_ru ). Sedangkan nilai CBR
lapis pondasi bawah akan memberikan tebal lapisan permukaan dan lapis
pondasi atas (t0",-ftr_rJ. Demikian pula nilai CBR lapis pondasi atas akan
mendapatkan hasil tebal lapis permukaan (h.J.
Dari hasil pengeliminasian dari ketiga hasil tersebut akan didapatkan
tebal masing-masing dari elemen struktur perkerasan,yaitu to",-,t spa dan t ru.

Hasil turunan dari persamaan diatas, dijabarkan dalam bentuk grafik


(Gbr.4.2.), sehingga proses perhitungan menfadi lebih mudah dan singkat.

I
s6

Bltl<u. 2 : PERANCAN(AN

xottstnllt<Sit 74J.4n

PERKERA.SANJALAN

CBR

Cro
E

lrnl. yanE sama


atau lebih besar

It

;20
o
t30
o
8*o

10

I1

;50
3

10

11

12

CONTOH SOAL

60

80
90
104

103

,05

106

107

,08

r0g

Beban Sumbu Standar Kumulatif

Gbl4.2. Gra{ik untuk penentuan tebal Perkerasan


(Metoda CBR- US Army Corps Engineers)

Keuntungan metoda CBR ini zdalah:


* digunakan dimana-mana oleh banyak negaru
* prosedur cukuP mudah
* dapat dilaksanakan dilaboratorium maupun dilapangan
* kekuatan lapis perkerasan lama dapat dievaluasi
* sudah memperhitungkan berat kendaf^ 1\, konfigurasi kendaraan dan

Metoda Peroncangan Perkerasan Jalan

konfigurasi sumbu
dapat menghasilkan komposisi lapisan perkerasan dan

kualitas

bahannya.

Kerugian metoda CBR ini adalah


* pemeriksaan sangat spesifik untuk bahan yang bersangkutan,iuga tuiuan
untuk aPa test ini dilakukan
* bila hasil terdahulu harus diikuti,prosedur test harus benar- benar tidak
menyimpang dari test lama
* ridak memberikan hasil yang akurat,btTa adz material kasar
* hasil yang didapat sangat sensitifterhadap perubahan kepadatan
* mctoda tidak memperhitungkan faktor lingkungan
,r paramucr kcrusakan struktur perkerasan tidak dapat langsung diketahui'

87

Persen yang sama atau lebih besar

ItltIxlUUYo= lUU"lo
10/11x100%= 9A$l o/o
8111x100%= 72,73%
7l11 x 100 Yo = 63,640/b
5/17 x 100 Yo = 45,45 0lr
3/11x 100 Yo = 2727 %
L/11x 100% =
9.09 %

4.2:

Dari beberapa sampling tanah dasar, didapatkan CBR = 9, 6,12,7,8,


7,'1,0,9, 10, 11,,71,. Lapis Pondasi Bawah dan Atas berturut-turut
mempunyai CBR = 20 dan CBR= 50.
Tentukan tebal perkerasan yang paling optimal,bilamana beban sumbu
ekivalen standar adalah 2,5 x 106 SS.
Dalam penentuan CBR rencan^ dilakukan prosedur penentuan
CB\**o sebagai berikut:
- Tentukan harga CBR terendah.
- Tetapkan berapa banyak harga CBR yang sama dan lebih besar dari
masing-masing nilai CBR.
- Angka jumlah terbanyak dinyatakan sebagai l00oh, jumlah lunnya
merupakan prosentase darr 1,00oh.
- Buat grafik korelasi antar nilai CBR dan prosentase jumlah tadi.
- Nilai CBR*o_*o adalah yang didapat dari angka prosentase 907o.

CATATAN: Dalam praktek, untuk mendapatkan nilai CBR.","_,,* yang


aplikatif, lakukan pengelompokan dalam segmen-segmen dimana
variasi nilai CBR tidak terlalu berbeda jauh.

T
88

BAIIA 2 :

11ou6C4uX6t74J,Av'

Metoda Perancangan Perkerasan

PER-ANC,AN4AN PEIeKERASAN J,AL,AN

Jalan

8g

Baru pada periode 1,974 - 1983, Bina Marga mengeluarkan aturzln


Perancangan Perkerasan No. 04/PD/BM/1974, yang mengadopsi AASHO
1,972 dan Asphalt Institute 1970. Kemudian pada periode 1983
- 1987

dipetbaharui menjadi perancarlgan berdasarkan buku


01, /PD /B/1983,y2ng merupakan pengembangan dari

$to

i,,

il,0

$m

;50

60
TA

80
$o

\103

io4

ros

toe

ia7

1oB

tos

BGban Sumbu Standar Kumulatif

Gbr. Contoh Soal r:o.4.2-

Tarik garis verrikal dari absis 2,5

105 memotong garis CBR=7

didapatkan tebal perkerasan 28 cm.


Ini berarti h"-.* trpe f tLpA = 28 cm (min ).

Dengan carayangsamq untuk CBR rou = 20,


didapat tn"*.f tLpa = 1,2 cm.;
dan CBR oo= 50, didapat tp",-.= 5 cm.(min).
Jadi secara lengkap:
trpB = 28 -'12= 16 cm, trp,r = 1,2 - 5 = 7 cm (min)'
Secara praktis, dapat diambil :
- Tebal total diambil 30 cm, trpts = 17 cm, tlpa = 8 cffI, tp"-. = 5 cm.

04/PD /MB /1e74.


Kemudian pada periode 1983 - sekarang,menggunakan standar SNI
1732-1989-F, yang merupakan standar perancangan perkerasan dalam skala
Nasional yang bedaku diseluruh Indonesia. Disini akan dibahas r nczngan
yang terakhir,yang pada dzsarnya adalah hasil pengembangan
pengembangan dari standar-standar sebelumnya.
Untuk perbandingan akan dibahas pula standar darl, Road Note,
NAASRA dan AASHTO 1986.
Metoda Bina Marga 1987,lebih dikenal sebagai Metoda Analisa
Komponen, seperti disebutkan diatas adalah mengadopsi AASHO 1972,
dengan pertimbangan :
- kebutuhan mendesak akan pedunya metoda resmi,
- banyak kendala untuk melakukan penelitian sendiri,antan lain :
biaya yang mahal, kelangkaan para peneliti dan memerlukan
waktu yanglama.
- cara AASHTO paling lengkap penjelasannya, dan
- cara AASHTO paling mudah untuk dimodifikasi.
Untuk sedikit membandingkan metoda AASHO 1972 bersumber
pada AASHO Interim Guide for Design of Pavement Structures 1972,yang berdasarkan hasil peneliaannya menurunkan rumus dasar
berikut :

0).

G,=F(logW,-loge)=log

IP" - IP,

.....(4.2..)
IP.

Catatan: Harap diperhatikan bahwa untuk variasi beban lalu lintas, ada

tebal LPB-," dan tebal LPA-i.., yang perlu disesuaikan kembali didalam
perhitungan.
4.4.1.4.

MetodaAndisa Komponen -Bina Marga ( sNl-tz:z-tlsln;

Historis desain perkerasan falan di Indonesia, adalah sebelum tahun


1974, belum ada metoda standar pefaflcangan perkerasan yang baku. Waktu
itu masih menggunakan metoda LN, antafa lain dari US Army Corp of
linginccrs (tfSACE- lihat atas), Asphalt Institute,AASHO dan lain-lain.

standar
standar

1,5

dimana:
G, = fungsi logaritma dari perbandingan ant^ra kehilangan tingkat
pelayanan ( serviceability ) dari IP=IP" sampai
IP= IP.,dengan kehilangan tingkat pelayanan dari IP" sampai

IP=

1,5.

p - fungsi dan desain dan vadasi beban sumbu

yang

berpengaruh terhadap bentuk grafik IP terhadap !7.

= beban sumbu pada akhir umuf fencana t.


A = fungsi dari desain dan variasi beban sumbu

W,

yang

menyatakan jumlah perkiraan banyaknya lintasan sumbu

T
90

b tl,,- 2 : PER,ANoAN4AN

r.ort6a4U1<sJtr4L'u

9l

Jalan
Metoda Perancangan Perketasan

PETeKeR,+SANJAL-4N

G,

perkerasan mencapai

yang diPedukan sehingga Permukaan


L"jr.r, pelaYanan IP =,1'5'
pada aw at umur,'1""11'^11T-:::TX
[P. = ffi5ff;
bahan lapis permukaan

i.;ffi;

+
logti(,r* =9,361o9(ITP + 1)-0,20

::[::.ffi1;#';JJ a'" '''"*


4'4a'')

IP,

$ihat Tabel
umur rencana'
indeks Permukaan pada akhir
0,081 (

(2).

F= 0,40 + ----------( ITP +

L1+
7

1)

4'19

e?lii;or"

sumbu ( tunggal ".3, gri11,,,,,,,,,,,,,,,r


ganda = 2 ).
sumbu tungg' =iitffilltSr*;u
Lz = kode sumbu ( untuk
inchi)'
(
1
rErip"znl'S4 cm
ITP= indeks
(SN= Structural Number )

4'3) dengao Lr =

18 kips dan

(18+1)''"

_-_.-:;_----0,40 + -____._*
llTP + 1;s'le'

^t^u

""

(4.e.)

dimana:

0,081

F=

- 1,5

= N," ( 1/ FR), atau

logW," = 1ogN," + log ( 1/ FR)

L' = l'mernberikan hasil:

(4.8)

dasar untuk menurunkan


Persamaan (4.8) diatas adalah Pefsamaan
w""ITP dan IP.
-r","r.
ai.,gu" faktor-faktor
;;;;;
kondisi
i^"ah dan ikti- yarg r.r.:1 .dengan
Rumus ini berlaku
diperlukan'
lain
t""Lk Lndisi
AASHO -.rro,,ttk* rumus' Sehingga dari persamaan berikut ini:
p'r meterfaktor ud;*;l'ng dii";;rkan
'W',ls

'J"'i[ffi;J'i'*

Persamaan (

4,2

(4.3)

log(Lr + Lz) + 4'33logLz


. ( 4.4.)

(ITP + 1)5'"''

IP. - IP,
G. = log ( -------------- )

dimana:

)1" .Lr'zu.

+
Iogq = 593 + 9,36 log (ITP

(31

L2)1'23

1094

0.40 +

1094

(4.5)

( a'a)
Demikian iuga dengan Persamaan

beban sumbu tunggal 18 kips yang


\(/,1s = faktor lalu lintas atas dasar
regional'
t.fuft aipttttitungkan terhadap faktor
kip'
N,r8 =iumlah^lintasan sumbu 18
FR =faktor regional'
umum
agar metoda dapat dipakai secar^
Faktor lain yang harus dimasukkan'
kondisi
sehubungan d.ngan perbedaan
adalah faktor daya dukung tanah,

+ 7)*4'79log(18 + 1) + 4'33log7
loge = 5,93 + 9,36log(ITP
Lta\J

+
log Q =9,36 log (ITP 1 )

Persamaan

(4'2') ditulis
Iog

dalam bentuk lain

V/,=logA+G,/

(4.6)

0'20
:

(4.7 )
P

5) dan (4. 6) kepersamaa


srrlrst i tu si persamaan(4.

n$.7') menghasilkan:

,"*{

J -} + 0,37 2(DDr- 3) .........'." """"'(4'


)

l.rR

0)

T
92 No%6E4uX6J94t*rt

BAKA 2 :

PER.4NCANq-+N PERKER,4SANJ,4L-+N

Faktor-faktof penyesuaian yang diberikan oleh Bina Marga adalah

0).

Metoda Perancangan Perkerasan


:

Jalan

Kondisional yang lain tetap dipertahankan,seperti :


- disyaratkannya pemeliharaan yang kontinyu,
- berlaku untuk bahan berbutir kasar(elastis dan isotropis)
- dapat digunakan untuk 'full-depth pavemenr,,oveday,,final stage,
dan 'stage of construction'.

AASHO mengambil korelasi

DDT = 3,71log (CBR) + 1,35, sedangkan Bina Marga mengambil


DDT = 4,30log (CBR) + 1,7

PROSEDUR PERENCANAAN
hanya menggunakan satu angka IP", disesuaikan
menjadi 5 vztan IP, (karena variabilitas kerataanfkehalusan dan
kekokohan lapis permukaan),yaitu IP"> 4, IP"= 3,9 - 3,5,IP" =
3,4 - 3,0,IP,,= 2,9 - 2,5 da3lP"< 2,4

(2). AASHO

(3). AASHO

menggunakan

(1).
i.)

Prosentase I(endaraan padaJalv Rencana:

Tetapkan lebar lajur lalu lintas berdasarkan Tabel 5.3. standar


Perencanaan Geometrik untuk Jalan Perkotaan 1992 atau Tabel

II.8 Tata cara Perencan^an Geometrik Jalan Antar Kota (iihat

nilai IP. yaitu:


IP,= 1,0 menyatakan permukaan ialan dalam keadaan rusak berat.
IP,= 1,5 menyatakan tingkat pelayanan terendah yang masih
mungkin (iilan tidak terPutus ).
TP,= 2,0 menyatakan tingkat pelzyanan terendah, bagi jalan yang
masih m nt^P'
IP,= 2,5 menyatakan permukaan ialan masih cukup stabil dan
baik.

Buku 1)
- Jumlah lajur, sesuaikan dengan batas marka; bilamana tidak ada
batas laiur yang ielas, tetapkan sesuai dengan Tabel 4.1 bedkut ini.

Tabel4.1. Pe netapan lumlah ialur


(L)
IUMLAH IALUR(n)

LBBAR PERKERASAN

L<5,50m
5,50m<L<8,25m
8,25mlL<11,25m
11t5m<L<15,00m

(4). FR = faktor regional di Indonesia diambil berkisar znt2;fa 0,5


- 4,0 dengan pertimbangan iklim tropis terutama curah huian,
0,2 * 5,0.

ii).

Nomogram yang disiapkaan AASHO adalah untuk umur


reflcan 20 tahun r=0o/o, sedangkan Bina Marga i= }oh dan UR =
10 tahun, sehingga ada faktor penyesuaian FP = UR/10'

FP =

untuki -

3 ialur

4iilut

5 jalur
6 ialur

Hitung koefisien distribusi kendaraan


Tabel4.2. berikut.

JUMt-{H
IALUR
1 falut
2 ialut
3 ialur

untuki < 10% dan


)uR -1

jalur

2iahx

(c) mengikuti aturan

pada

Tabel4.2. Koefisien distribusi


fl
kendaraan
KENDARAA N RINGAN*')
l ARAH
2ARAH
1,00
0,60
0,40

d,al am ta lur C
KENDARAAN BERAT*X)
1 ARAH
2ARAH

1,00
0"50

0,40

4 falur
0,30
) larur
0,25
6 ialur
0_2a
x)berat total < 5 ton : mobil penumpang,pickup,mobil
hantatan
**) betat total > 5 ton : bus, truck,ttaktot,semitailer, railer

10.i

( 1+i

15,00m<L<I8,75m
18.75m <I:<22.AOm

(5).

( 1+i )uR-1
AASHO memberikan rumus FP =

ANALISA LALU LINTAS

nllat IP, dimodifikasi meniadi 4

kelandaian dan prosentase kendaraan berat. AASHO meninjau


faktori 4 musim, drainase,muka air tzoah dan kelandaian dan FR =

gB

1'0o/o

10-'log(1+i)
iii).

1,00
0,70
0,50

1,00
0,50
0,475
0,45

a,425
0.40

Hitung LHR pada tahun awal rencana (I-HR ),untuk masing-masing


ienis kenda raan yang ada.

I
94

BVJ<^ 2 : PERANoANqANPERKERASANJAL

Metoda Perancangan Perkerasan Jalan

LH\=(1 *i )" . Ndr".


dimana

vi).

.( 4.11.)

= faktor pertumbuhan kendaraan,selama


pelaksanaan.

"ir).

'9.

= iumlah tahun,seiak data pengukuran


diambil,sampai dengan awal umur reflcanz.
N = masing-masing tipe kendaraan
Hitung LHR pada tahun akhir rencana (LHR),untuk setiap ienis

viii).
i").

(1+i)'o.LH\.

(4J,2,)

dimana: UR = umuf teflczn


i = faktor pertumbuhankendaraan,selama umuf
Ienc n

Hitung Angka Ekivalen (AE),untuk setiap kendaraan.(ihat Bab


konfigurasi masing-masing sumbu kendaraan.

BEBAN
SATU
SUMBU
kg

I unssal
1000

2000
3000

4000
5000

6000
7000

0,0002
0,0036
0,0183
0,0577
0,1410

a,2923
0,5415
0,9238

Sumbu
Ganda
0,0003
0,0016

0,0050
0,0121

0,0251
0,0466

8160
9000

1,0000

0,0794
0,0860

1,4795

0,1.273

10.000
11.000
12.000
13.000
14.000
15.000

2,2555
3,3022
4,6770
6,4419

0,1940
0,2840

11.,41.84

1(r.000

14,7815

8000

8,6647

0,4022
0,5540
0,7452
0,9820
1,2712

kg
17.000
18.000
19.000

20.000
21.000

22,00a
23.000
24.000
2s.000

(4.1,4)

(4.15)

.............(4.1,6)

A).
1).

PERHITUNGAN TEBAL PERKERASAN.

ii).

Dari data jenis bahan lapis permukaan dan roughness

..............(4.17)

Hitung Daya Dukung Tanah (DDT).


Gunakan Nomogram ( CBR-DDT ) - Lihat Lampiran B-1.
(<alau

tersedia), tetapkan indeks IP" dari Tabel4.4a.

Tabel4.3. Anska Ekivalen ( AE


BEBAN
ANGKA
ANGKA EKIVALEN
SATU
EKTVALH,N (AE)
(AE )
SUMBU
Sumbu

LEA = ILH&xCxEA

Hitung Lintas Ekivalen Tengah :


LET = 0,5 ( LEP + LEA ) .............
Hitung Faktor Penyesuaian ( FP )

").

1,.2.1,.)

memperhatikan

.(4.1,3)

Hitung Lintas Ekivalen Rencana


LER = FP x LET

Atau gunakan Tabel 4.3. dibawah ini,dengan

Hitung Lintas Ekivalen Pertama:


LEP = ILHR"xCxEA
Hitung Lintas Ekivalen Akhir:

FP=UR/1O

kendaraan.

LH&=

").

05

'<on6t8Ur<CJMJ.4n

Sumbu
I unggal
18,8380

Sumbu
Ganda

23,677L

2,0362
2,5279

29,3937
36,0877

43,8648
52,8360
63,1176
74,8315
88,1048

1",62A1,

3,1035

3,7724
4,5439

iii).

Dengan merencanakan bagaimana kondisi permukaan jalan, pada


akhirumur renc n tetapkanIP,(Iabel 4.4b).

,").

selanjutnya dari pemilihan yang dilakukan pada ii) dan iii). diatas,
pilih nomogram m^n^ y^ng sesuai (lihat Lampkan B_2 s/d B10),untuk dipakai mencari ITP.

v).

Dari pasangan harga DDT dan LER tarik garis lurus sesuai arah
petunjuk inset pada Nomogram. Garis ini akan memorong suatu
zngka pada garis vertikal ITP.

vi).

Dari pasangan ITP dan FR (Lampiran B-2 s/d B-10) lakukanhal


yang sama,sehingga memotong garis vertikal ITp . Angt yang
^
didapat adalah nilai fTP yangdicari.

5,42:81

6,4355

(Catatan: Bila FR =

7,5770

"ir).
i

'i
1

{
!

1,

ITP

Selanjutnya gunakan rumus ITP =ar.Dr*ar.Dr*a..D3 .........(4.18)


untuk mencari tebal perkerasan,dengan menyesuaikan data jenis
bahan untuk mendapatkan masing-masing koefisien relattf (rabel
4.7) dan mengambil tebal minimum lapis permukaan dan LpA
(rabel 4.6) untuk mencari tebal LPB dalam alternatif jaranbaru,atau
kombinasi tebal minimum LPA dan LpB untuk mencari tebal

overlay dari lapis permukaan.

ITP1.

ByrKt 2:

96 Notl6zquNal74l49l

PER.+NoANq-+NPERKER.+SANJAL^N

x1-

I-A.SBUTAGI

HRA

BURDA
BURTU

-3,5

[3,4

l,

zooo

!t,+ -t,o
lz,9 -z,s

I"\TASBUM

2,9 -2,5

2,9

>2000
<3000
> 3000

2,5

Jalan Tanah

<') /.

Jalan Kerikil

<)t

*) Roughness diukur dengan alat Roughnessmeter NAASRA

Tabel4.4b. Indeks Permukaan Akhir ( IP


LER ( SS/had )

LOKAL

<10

1,0

KLASSIFIKASI IAI-AN
ARTERI
KOLtrKIOR
1,5

1,5

1,5

TOL

* 2,4

2,0
1,5 *2,0
1,5
100
2,0 *2,5
2,0
7,5 - 2,0
1000
2.5
2.5
> 1000
2,A *2,5
*) LER dalam satuan angka ekivalen 8,16 ton beban sumbu tunggal
CATATAN : Pada proyek ialan darurat atauialan murah maka IP dapat diambil 1,0
10

100

'

Tabel 4.5 Faktor


KEI-ANDAIAN I KEIANDAIAN II KEI,/,NDAIANIII
{ > fJa/o\
r<6%)
r6*10%)
()6

Kendaraan Berat
>itoah

130o/o

Iklim I
< 900mm /th
Iklim II

0r5

1,0-1,5

7o Kendaraan Berat
<300
>30o/o
1,0

7,5-2,0

Yo

Kendaraan Berat
>3U/o

<3A/a
1,s

2,0-2,5

3,0-3,5
2,5
2,4
2,5-3$
l15
2,0-2,5
>900mm /th
( I ATATAN:P ada bagan j alan persimpangan, 3pemberhentian atau t.ikungan taiam (iatt-

iari

30 m), FR ditambah dengan 0,5. Pada daerah rawa FR ditambah dengan 1,0.

BAHAN

/,5

6,71.

7,5

I-APIS PELINDUNG,BURAS/BURTU/BURDA
I-APEN /MACADAM,HRA,IASBUTAG,I-ASTON
I,APEN IMACADAM,HRA,I*A.SBUTAG,I-{.STON
IASBUTAG, LASTON

10

LASTON

2,9 - 2,5

LATASIR

TEBAL
MINIMUM

3,00
6,70

7,49
7,50
9,99
>- 10,00

< 2000

*3,5
* 3,0

IAPEN
BURAS

< 3,00

f<zooo

3,0

TTP

{cm)

L> 1000

3,s

13,9

3,9
3,4

pryr/km

[< rooo
I

lr+
]3,e

Tabel 4.6a,Batas Minimum


urrr teDal
tebal raDls
lapis Defmu
Dermukaan.

ROUGHNE.SS

IP.,

97

(lI'

Tabel4.4a. Indeks PermukaanDada awal UR


JENIS t \Pm
PERKERASAN
LASTON

Metoda Perancangan Perkerasan Jalan

Tabel4.6b. Batas
Mini
tas Minimum
tebal laoisan oondasi
TEBAL
ITP
BAHAN
MINIMUM(cm)
< 3,00
15
BATU PECAH, STAB.SEMEN,
STAB.KAPUR
3,00 * 7,49
20 *)
BATU PECAH, STAB.SEMEN,
STAB.KAPUR
7,50 *9,99
10
LASTON ATAS
20
BATU PECAH, STAB.SEMEN,
*
1,0,00
1,2,24
STAB.KAPUR, MACADAM
15
TASTON ATAS
>1))\
20
BATU PECAH, STAB.SEMEN,
STAB.KAPUR, MACADAM,
LAPEN,LASTON ATAS
18,
BATU PECAH, STAB.SEMEN,
STAB.KAPUR, MACADAM,
LAPEN,LASTON ATAS
, a)uJ

* UNTUK LAPIS PONDASI BAIOTAH :


Untak setiap nilai ITP, bila digunakaru lapis pondasi bawab, tebal minimum
adalah 10 cm.

98

t<OuStAWcsl

7414u

Bt

Kt 2:

PER^NoANqANPERKERASANJ^I-AN

Metoda Perancangan Perkerasan Jalan

Prosedur diatas dilaksanakan untuk pera;nczflgan perkerasan jalan


baru, ata;u relokasi, untuk perancangan pelapisan ulang dan
pelaksanaan bertahap dilakukan sebagai berikut:

Tabel 4.7 Koefisien Kekuatan Relatif.


KOEFISIEN KEKUATAN

REU.TIF
al

*2

A3

KEKUATAN BAHAN
MS
f ko)

0,40

744

035

s90
454
340

0,32
0,30
0,3.5

744

031

590
454

0,28

/ lralrm4

JENISBAHAN

CBR
(ola\

Pelaoisan

IASTON

Ulans:

Nilai ITP sisa struktur perkerasan lama,adalah:

ITP.i""=E(r, .Dt.NK)
ASBUTON

o2t

3N

0,30

340

HRA

0,26

340

MACADAM

0,20

0,28

590

IASTON

o;,26

454
340

ATAS

dimana:

0,15
0,13

'))

0,15
0,13

22

STABILISASI

i8

KAPUR

, '
D =
al =

dim^n
A

STABILISI SEMEN

18

0,14

100

MACADAMgasaH

0,12

60

MACADAMTsmNc

0,L4

100

BATU PECAH KLS.,\

0,13

80

BATU PB.CAH K1-5. B

0,1.2

60

BATU PECAH KlS.C

0,13

7A

0,'1,2

50
30
20

SIRTU KLS.A
KLS.B
KLS.C
TANAH/LEMPUNG

0,1i
0,10

KEPASIRAN

Cata;tanl- Kuat tekan stabilisasi tanah dengan semen diperiksa pada hari ke 7. Kuat
tekan stabilisasi tanah dengan kapur diperiksa pada hari ke

21.

AD=

LAPEN(uaxua$

0,19

4.8 ).

o Tebal lapis permukaan untuk pelapisan ulang (overlay) didapat dari


ITPo"a* - ITP,i,u

LAPEN(MEKANIS)

023

(4.1,e )

a,. D, seperti diatas


NK = nilai kondisi sisa lapisan ( Tabel

I.AFEN(MEKANIS)
LAPEN(MANUAL)

a25

0,24

0!f

Konstruksi Bertahao

tebal lapis permukaan ulang


koefisien kekuatan relatif lapis petmukaan
(bahan lapis permukaan,harus sama dengan
bahan struktur lama).

Pada akhir tahap pert^m , struktur perkerasan dianggap masih


mempunyai nilai sisa 40010. Dengan kondisi seperti ini ITP,on^o 0",,"-,,
dihitung berdasarkan beban lalu lintas LER = 1,67 LERr.
x.LER, = LER, + 4)oh.x.L,F,R, * x = L,67

I(onstruksi tahap pettar":

, t^npa penambahan

konstruksi tahap

kedua, akan mampu melayani 60oh da:il, total masa layan.


y. Ltr& = LERr + LER, = 60oh.y.LE& + LH& ---+ y = 2,50

ITP tahap pertama ditambah tahap kedua : ITP,*, diperoleh


nomogram dengan menggunakan LER = 2,5 LE&.
Nilai ITP tahap kedua adalah: ITP, = ITP,*2

ITPr

dari

B\KA

l00 t1ou6E4ut1&J 74J.4u

Metoda Peroncangan Perkerasan Jalon

2 : PERANCAN(AN PERKER-ASAN IAL^N

t0l

Tabel4.8. Nilai Kondisi Perkerasan Ialan


NrLAr KONDTST (%)

GAMBARAN KONDISI PERKERASAN

b. Pertumbuhan Lalu Lintas

l.IAPIS PERMUKAAN

90

- Umumnya tidak teriadi crack,


hanya sedikit deformasi pada lajur roda.
- Tetlihat crack halus, sedikit deformasi pada
lajur roda,namun masih tetap stabil.
- Crack sedang,beberapa deformasi pada laiur
roda,pada dasamya masih menuniukkan

i."d^. = Bo/o
it*.k-rAS = 3 o/o

100

70-90

io*.

-- 6 %
itruck5AS =2 o/o.

It.ckzAS = 40

I.2. DataJalanLama

50-70
a.Jumlah jalur = 2jalur

kestabilan.

b.Perkerasanlama

30*50

- Crack banyakdemikian iuga deformasi,pada


laiur roda.

Lap. Permukaan: 6 cm. ( LASTON ; a, = 0,40; NK= 60% )


Lap. Pondasi Atas : 10 cm. ( I-ASTON ATAS ;ar= 0,28;NK= 100oA
Lap. Pondasi Bawah: 16 cm. ( SIRTU ;4= 0,12 i NK= 10%)

2.II,PM PONDASI ATAS


a). Pondasi aspal beton atau
penetrasi macadam.
- Umumnya tidak teriadi crack.
- Tedihat crack halus,namun masih tetap
stabil.
- Crack sedangpada dasarnya masih
menuniukkan kestabilan.
- Crack banyak,menuniukkao geiala

90

c. C8R,","2

100

70-90

e.

30*50

100

a. Jumlah

80

100

b.Bahan Perkerasan

90

100

70-90

DATA
:

SEDAN

BUS

TRUCK2

TRUCK3

AS

AS
35

AS

40
49

LHR

2OO2

1204

LHR

2OO9

1995

350
498

102

LHR 2014

3160

652

L21

80

1.00o/o.

Lap. Permukaan : LASTON, dengan q = 0,40


Lap. Pondasi Atas : LASTON ATAS, dengan a2= 0,28
Lap. Pondasi Bawah : SIRTU , dengan U = 0,1.2

4.3

I.1,.Data Lalu Lintas


a. LHR.

80%,Nf; =90o ,NK =

jalur = 3 jalur-

c.

LHR

menielang a'raT ovetlay:NK,=

70

IAPIS PONDASI BAUflAH.

- Plastisitas Indeks ( PI ) S 6
- Plastisitas Indeks ( PI ) > 6

I.

NK

= 1200 mm/km.

I.3.DataJalan Baru

b). Stabilisasi tanah dengan semen atau kapur


- Plastisitas Indeks (PI ) n 10.
c). Pondasi Macadam atau batu pecah
- Plastisitas indeks ( PI ) < 6.

CONTOH SOAL

= 4; 5 ;5 ;4 (tanah dasar lama )


= 6;5; 6.; 5 ( tanah dasar baru )

d. Roughness

50-70

ketidakstabilan.

3.

TRUCK
4
6

CBR , ,u_o,^= 4; 3

; 4 ;3 . (pada pelebaran /

relokasi ).

I.4. Umur Rencana ( UR ) ; UR BERTAHAP: tahap 1 = 5 tahun


tahap2 = l0tahun
URovedaY = 5tahun
URpelebaran = 10 tahun.
I. 5.WaktuPelaksanaan(MP)
WP b"tun"Pr rorr=1 thn.
a. WP tahap 1: 2004 s/d 2005. tahap 2 : 2009 - 2010
b. \XrP overlay 2014 - 2015
c. \I(/P pelebaran2078 -201,9.

!
Bt t<A 2 : PERANCANqAN PERKERASANJALAN

l02 r1urcc&t4rlsJ tr.AJ,4n

Metoda Perancangan Perkerason Jalan

I.6.Faktor Regional= 1.

II.

PERANCANGAT{ PERKERASAN :

l.

EERTAHAP
2. OVERTAY
3. PELEBARAT{

YANG DICARI

1.
2.
3.
ru.

dcnario Slrf,ULASl

t03

Susunan Lapis Perkerasan Bertahap : tahap 1 danZ'


Susunan Lapis Perkerasan Overlay'
Susunan Peikerasan barru/ perkerasan pada pelebaran'

PENYELESAIAN
Lalu T,intas lihat Tabel Perhitunsan
TRUCK3

TRUCK5

AS

AS

AS

350

80

35

1511,65

4l{rfi6

9L61

39J7

43?

2221.12

557,85

118.20

48

1995

498

102

40

LHR2OIO

2154,{r0

527,88

10?,10

41,60

6,18

LHR

465t$2

945,35

11415

61,58

8,3I

TRUCK
SEDAN

BUS 5 ton

1200

LHR2OO5

LHR2OIO

LHR

URpamt",aq = 15 th ( 5 + 10

BERTAHAP(T)

LHR

2OO2

TAHAP 2 = 2010 -2020

UR*r"v
= 5th(2015-2020)
URea"t'. = 10 th ( 2019 - 2029 )
r1vs11u pelaksanaan konstruksi bertahap, TAHAP 1 ( 2004 - 2005 )
WP2 = e7611u pelaksanaan konstruksi bertahap, TAHAP 2 ( 2009 - 2010 )
WP3 = rys11, pelaksanaan o\eday (2OM - m15 )

WP, =

BERTAHAP(2)

LHR

2OO9

2O2O

TAHAPl=200s-2010

WP. = rssL1, pelaksanaan pelebaran ( 2018


SIRUKTUR PERKERASAN LAMA

( 2 Jalur

LASTON

Lapis Permukaan =
= LASTON ATAS

LPA
LPB

2019 )

STRUKruR PERKERASAN BARU ( 3 ialur ):


idem SIRUKTUR PERKERASAN IAMA

=SIRTU/PITRUN(A)

OYERLAY
LHR2OI4

3160

652

121

49

LHR 2015

fil2$0

691,12

,2795

5qe6

7,21

LHR

5014,52

924,87

t62,15

62pa

8,36

2O2O

PELEBAB.AN

LHR2OIS
LHR 2019
LHR 2029

&ffi
4536,00
979?,88

789

145

56

s36J4

tsa,25

58,24

8,24

1497,76

248,W

863r

11$7

2.a. ITP

Perkerasan Lama ( akhir

ITPp..k".."nl"-"'t"=

NKr,

2003)

arDl + NKr%. a,z-D2+ NK3%.ar.D:.

= 60ohx0,40x6 + 700ohx0,28x10
-- 7,44 + 2,8 + 7,92 -- 6,76

b.

100ohx0,72x1,6

ITP Perkerasan Lama ( akhir 2014).


ITP Perkeras nLam^ ( menjelang pertengahan tahap II BERTAHAP,
untuk mengembalikan kondisi ke posisi 100o/o pada saat akhir tahap II,
dan awal dari pelaksanaan pelebaran):

rrpp",k.,^,,.,-,'o'o=xr.;,r?r!1r{03,X";rJliK;tfr]12x16

Bt Kq 2 ; PERANCANqAN PER-KER,ASANJALAN

l04 t1ot16z4ut16J trAa4v'

c.

NK, =NK,

e.

( akhir 2018 ).

ITP Perker^sanL^m^

- NKj = 1,OOo/o unruk existing, yang tidak ikut dilebarkan.

Yang dilebarkan, statusnya seperti ialan batu.

d.

Menghitung ITP

1).

CBR4

CBRmrrz

45

4d,

TAHAP Il( IP=2)

LERs

1,67LERs

LERrs

2J LERrs

44,60

74"50

1d;A.3

300J5

IPo=3,93.5

IPo=3,9-

ITP.q=6,30

ITP15*16*$,!g

Umur Rencana

5 tahun (201'5

CBRr

DDT

CBR,

CBfu

CBRr

CBRmrz

4,5

Roughness

ar.Du

^r^n,*

---+

0,40 Dr ='1,,73

---+

0,40 Dr

Dr=4,32cm-5cm.

TPpZ,

ITP= a,xD, + arxDr* arxD.

8,50 = 0,40 x D1 + 0,28 x 10 + 0,12 x


D, = 9,45 cm 10 cm.

-2020).

16

3,78

D,

f TP=2-5 )

FR

IPr: >= 4

ITPs=6,30

= 900 mrn/km

^tau
LER* = 63,37 --+
ITP' = 6,30
ITPno**.*^ro* r^ro'o'o = 4,60
A ITP = ITPs - ITPd" = 6,30 - 4,60 = 1.,70
1,70 = 0,40 x D,,
Dr = 4,25- 5 cm.

L,ERs= 63.37
416

ar.D,

ITP= a,xD, + arxDr* arxDu


6,45 = 0,40 x Dl + 0,28 x 10 + 0,12 x'!,6

OVERI-AY
CBRlar-a^*rava

2). OVERLAY
9","k perkuatan Perkerasan I,ama ( Overlay ).
ITP = ar .
ITP
ar.D, + ar.D,

2). OVERLAY

c.

al.D1

14p t'

FR

= 1200 mm/kn

Roughness

KONSTRUKSI BERTAHAP
Untuk Struktur Perkerasan Bertahap :

Tahap 1 : LER or^", = 1,,67 LER,. ---+ : LE\o,r^o, = 74,5


Tahap 2 : LER
2= 2,50 LER15. ---+ :LE\or^n, = 300,75

TAHAPI (IP=1,5)
DDT

CBfu

105

Menghitung Tebal Perkerasan.

IW=

KONSTRUKSI BE,RTAHAP
Umur Rencana = 5 tahun ( 2005 - 2010 ).
^.
b. Umur Rencana = 10 tahun (2010-2020).

CBfu

1).

CBRtauNrtua

CBRl

Metoda Perancangan Perkerasan Jalan

3). PELEBARAN
Untuk Perkerasan Baru ( pelebaran & relokasi ).

3).

77F=

PELEBARAN / JAIAN BARU


d. Umur Rencana = 10 tahun (2019 '2029 ).
CBRFuarrmu
CBRr

CBRz

DDT

CBRr

CBRI

FR

9,0 = 0,40 x

4,1

IPoS

2,4

lTPro=9,0

a,Dzf

f.

a..D3.

5* 0,28 x 10 + O,12xD:

Du=35cm

PELEBARAN
f IP=1-O\
LERro= 153,95

CBRrrra2

^,,.Dr

0,12D3= 4,20

Tabel Kesimpulan

Dengan menggunakan fumus-fl.rmus sefta besaran-besaran yang telah


didapat diatas, maka tebal perkerasan bertahap, oveday, serta perkerasan
baru akan didapat seperti pada Tabel dibawah ini

Ell.tl{ 2 : PERANoANqAN

lffi xovtoc4wrlet 1,AJ./tfi

Metoda Perancangan Perkerasan Jalan

PERK9RASAN JAL-AN

107

ftl[rl,[&iluuuilTrs
0rsmtBlAt

lrfi!r&
&ilotuatt

tr;Nrs

BERTAHAf

UMUR

I{]SISI

PER(ERASAN

RENCANA

TAHAP

TAHAP

(fr)

r)
Z

- ija
il((s)

&C

!d

Tt

t6

uwli

,,tsttrr

$m,

z
Z
n

i*
ir

t4p.Pt

(cm)

(n)

LPA

LPT

L!p.Pe

I,PA

Ltl

(d)

(d)

(cs)

km)

(.t0

,
,

BUSTION

ils.|3

ml

tt

itL

TIUCT( r.l$-20

roil

JS

4fi

t*

rRucr(

lx

Cr[=lJ

tr.
IIIR

ll

l6

}ISTIIBTJSI

2OO'

,1)t{tsKINDlS

(201t

SIDAN

me

ll

It

[tL!

BIJS

EMN

10N

2AS.I; Il}N

IIITJCK

ta

ils

TRtlC( 3tS.20 TOfl

tofl

Tnucl( 5As-t0

LEp

im= {5
Nx(*)

tl
lrlSION

16

t
5

m,a a,$0r{ {50 0;5 tit


itTrs 0,el7zt asa 3.s
4t2
a
18t95 rg0 0,ar rra
ln t
ltil{e 05a 17.91 51,t,
4t
lrls? 050 r4,at 2c,8.
t
1,4s52? $O
&lt
3it
TOI I
TCI| 9937

5
5
5

,020

t%

215,r,60 Ir

t651,62 0,0{0{0 050

49S

5h

527.tE t0

,15J5

0,02t?C 0,50

qoo

0,e0

r,1fl30

c50

I02

5*

10?,10 l0

t?ars

1,0:3s0 0rt0

,10

Lfr.

{t,6c

l0

6,JS

lJ2f?0

2556

3713

6.18

t0

tjl

t.4e5?0 050

1,52

611

stmll

trB

0.65

0,t0

u0

r,02

1036

19

0.m

t00

{,0t

!m,B

c1g2

?d,tt

5.?3

'1,5'

92.n

5.12

l{?,61 120J0 t,m

r,.lliiSeJa

=5lll

IJIllr

,015

,[NIS XTiNDIRIAII

2010

AT,{S

It

8%

3,il2,r0 5

501452 0,01xr60 050

1.02

1rs0

612

trl

6ct.t2

0rt.s7

0.02[0

7,s{

t0.0,

0,00

0,00

0,l5l3l) 0,51t

0,04

0,00

MN

121

t/"

127.05 5

t02.15 t.05380 0i0

66,01 8;,il

;r.tS

mN

49

t%

50,96

62,00 tJ28?0 0J0

3l,Jl

,r,09

it4,?0

721

8,36

5J9

695

5,82

tr2,l6

ut32

stDut

,0

ls

BIIS

BUS 8 TON

3l

LAS

LAS

sll

TRUCIT

ION

fl

TRU0I{ 3rS.20

TO\

31fl)

5 TOIT

,t

2029)

3J

lllfto

D$rflaust

E9J

lllRr

1945

mr

U[=lolg

,clo

mil

LIt[ 20r4

Ul

ana

OVtXlrtI
Lrstol\

ilx{*)

Um

TOTAT_

,@0 )

(s[c

UR=stll

Lgno

ilt

it(%)
lt

TillIrI
L[S0
,aas
lslt,as
4lar6
an
c2.ar
:eJ?
4,r?
TilIrr2

lx

r!It e0rt-

1,2

LPB

(em)

mt

4,5

* r{l}

lda

5.

rPA

lf

)a
a)
<c

(@)

Lls

$n e

la

LPF

(@)

Ilttlcl( sas$'I$x

nloI

M(B

Z
T

(dn)

l!r0
&,
ist.P.3

Arrs

rf, {ilat

(.m)

t
S

LP,\

LPD
(rm)

mN

f,us5

& CBB
lrp.Pm

sIDl]r

P}:"RKEMSAN OAf,U

UVERLAY

LAMA

'AS.B

lTls
Tnt|(l(

sis-{ m]\

050

l,r9s?0 050

TOTiJ,
PEt-[8,${n3r4l.tR2{MH
l.Il[ 20]8

Lflfio

DISINNUSI

42m

s[larri
BUS

?89

5ToN

[tis8

8q.

61,,

t26,74 050

2029

9792,88 0,000im 0,{txt

0"54

i.t8

fl-86

{16.:t

lr?.76 0,021q} 0.fft0

?,33

ll.i!

1022

0.00

0,00

0.00

0.00

l0

0,t5r:t0 s,lfi

TOII

Its

iL

l,',2,?5 t0

2t8,00 1,0M80 0,1?5 ??,0t

t25.l3 l0ll2

'IRIICX 3[S-20 ToN

56

lCt

.'ri"24

t0

8f,21

t.0t?i0 0.{?;

:lt.?0

42.19

33.i9

$,2r

l0

il.01

t,31950 0.{75

5,16

6.91

6-05

t8.?t

ilt9.t5 t;J.gs l.[0

]',fiUfi 2tS-t'

TRICK 5A!-30

IOli

3r,\

63fi

10.00

636,00 I0
0

ToN

0,00

ttlfir

?019

JINIS Xf,NOANAAN

lR{lh}=

126
s,7;

TOTA|,

]$-ei

T
lw

BytrJ[ 2 : PERANCAN4AN

roil6c4ux6J7An4u

Metoda Perancangan Perkerasan Jalan

PET.KER,4'SAN JAL-AN

dimana

4.4.l.5.Metoda AASHTO -1993

t09

SN

Seperti diuraikan pada sub-bab 4.4.1.4 diatas,model dasar struktur


perkerasan menurut Metoda AASHO l9'/2,secara lengkap adalah sebagai

=
=

A PSI

= Selisih antara nilai PSI diawal dan akhir


= Deviasi Standar dari nilai WJ8.

berikut:

NIr

'W,r8

4,2

4.2-

= 9,36 log ( ITP + 1 ) -

LR

0,20 + -------------------------- + log

( -------

) + 0,372

(S

FR

7094

(ITP +

=
ITP =
P, =
FR =
S =

Wt18

2,54 SN4 = 2r . Dr
2,54 SNj = 2r .Dr
2,54 SN2 = ar .D,

(4.21,.)

;s'r'

beban sumbu standar total ( ESA )


indeks tebal perkerasan atau Structural Number ( in )
terminal PSI( Present Sericeability Index - IP (indeks permukaan)
faktor regronal ( Regional Factor = R )
soil suPPort value

dimana i =L,2,3,4
tanah dasar.

AASHTO 1993 terdapat perubahafl mendasaf, walauPun tetaP


masih mengikuti model perkfu^an kondisi perkerasan AASHO 1972.
Perbedaannya adalah sebagai berikut :
AASHTO T993

AASHO 1972

1. Parameter daya dukung ta[ah dasar,

t. Parameter daya dukung tanah dasar


DDT ( S ) hasil konversi dari CBR,
2. Faktor Regional ( FR= R ), untuk
mengakomodir perbedaan kondisi lokasi
jalan.
3. ( Ua"- dimunculkan parameter: reliabilitas, - koefisien drainase dan simpangari )

ar . Dr

+ az.Dz* a:.D:.

(ITP=SN)

dinyatakan dalam Mr (&Iodulus


Resilien) yang diperoleh dari test
AAHSTO-T27 4, atalu korelasi
terhadap CBR.
2. Parameter faktor regional tidak
digunakafl lagi, diganti parameter lain.
3. Parameter baru:
- reliabilitas
- koefisien drainase
- simpangan baku total
4. IT? = ar.Dr + az.D2.mz * a3,D3.m:
m = knefi.sien drainase.

A PSI

los
=

ZR*S,,

9,36 log

( ---4,2 -

(probabilitas), R

(SN + 1) -0,20 + ------------------------ + 12,32log (Mn) -3,0557


0,40 + ---------------

(SN+1;s'to

terhadap nilai

M*

(4.23.)
menyatakan lapisan permukaan,LpA,LpB, dan

da.*i tanah dasar, lapis pondasi bawah dan lapis pondasl

Persamaan bertingkat tersebut diatas, dapat dilakukan hanya jika lapisan


pendukung memiliki nilai MR tidak lebih besar dari 300 Mpa, yang biasanya
hanya dipunyai oleh lapisan pendukung t^np^ bahan pengikat. untuk lapis
pendukung yang mempunyai nilai MR > 300 Mpa,gunakan tebal lapisan

minimum
Metoda AASHTO 1.993 menetap_kan persyara,tan tebal minimum lapis
perkerasan sebagai fungsi dari w,l8,sebagaimana dapat dilih^t p^d^ TaLel
4.9. berikut ini.

Tabel4.9
.7. r-efsyaf1alarl
Pet
TL eDaI
bal lvtlnlmum.
Mi
W,tt,

TEBAT LAPISAN MINIMUM ( CM ), UNTUK

(BSA)
< 50.000

- 150.000
150.001 - 500.000
* 2.000.000

7.000.000

7.000.001 =-

( 4.22)

ar.Dr.mr* a..D,,.m..
ar.Dr.mr.

atas.

2.000.001

1094

I(euga nilai SN pada rumus bertingkat diatas,masing-masing dihitung

500.001

1,5

*
*

= indeks

50.001

Model perkiraan kondisi Perkerasafl seczra lengkap adalah:

loglW,1a

masa layan struktur perkerasan

= Konstanta Normal pzda tingkat peluang


- Modulus of Resllicnt ( Mpa.1.

3,0 )

Pada Metoda

4.ITp =

total ( ESA ) selama umur rencana.

Tebal Lapisan Perkerasan dihitung dari nilai SN rumus berjenjang berikut

1,5

0,40 + ---------------

dimana:

Beban sumbu standar

-P,

k'g ( ---:--log W,18

S.,

Structural Number ( ITP )

ASPAL BETON

2,5

( bisa pelaburan saia)

PONDASIAGREGAT
10

5,0

10

6,5

10

7,5

15

15

10

1.5

Metoda Perancangan Perkerasan

ll0xoTl,6cdlux6J7,Al4uBl^}<l^2:PER,4NoANqANPERKER/qSANJAL-qN

t.

Faktor baru yang dimunculkan adalah :

1.

M* =

=
K =
od =

4.
5.

it

fr

ll

.t,r

tfri

tEl

rfii

|lll

.t3i

{Jp

tJlt

{.rs

.ilft

.uE6

.llri

.r,fi|

ltt{

.tsl

ft

i.l

-lr

.rit

Tabel4.11. Iubunsan keandalan dan Fungsi lalan

Tol
Jalan Arted
Jalan Kolektor
Ialan Lokal
Jalan

TINGKATKEANDAIAN (R)

DAERAH URBAN
85

99,9

B0*99
80-95
s0-80

modulus resilient tanah kohesif ( Mpa).

konstanta tergantung pada sifat

fisik

tanah,

tegangan deviator ( KPa ).

Note

31.

Metoda ini dikembangkan di Inggris oleh rRRL (fransport Road


Itesearch Laboratory ). Road Note 31 dipublikasikan 7962, kemudian
tlireview pada L966 dan 1977. Terakhir terbit overseas Road Note 31
t lipublikasik an 1.993.

till

FUNGSIJAI-AN

...... (4.24)

Koefisien Kekuatan Relatif, dihubungkan dengan modulus resilient.


Drainase, diikutsertakan dalam bentuk koefisien drainase m,.

4.4.1.6. Metoda Road

$Eaf

Ld

modulus

kepadatan dan kadar air.

Tabet 4.10. Hubungan Keandalan dan standar Deviasi Normal


n

K,.(oo)"

dimana Mn

Untuk ialan zrteri primer, misalnya, adalzh ialan yang memikul beban lalu
li.rtrs y".rg tinggi, dan harus selalu memiliki kondisi perkerasan yang baik'
Maka tin{kat risiko kesdahan desain harus dapat dibuat minimum, dan ini
berarti tilgkat peluang (probabilitas) harus ti.rgg. Variasi data dianggap
mengikuti-dltt.ibo.i normal,sehingga faktor keandalan desain,ditentukan
oleh-nilai keandalan dan tingkat probabilitas (standar deviasi normal,Zf lihat Tabel4.10
Pada Tabel 4.11. tingkat keandalan,iuga dikaitkan dengan fungsional ialan,
dan kategori wilayah dimana ialan itu berada.

irhi

Karakteristik ranah dasar, y^ng diterjemahkan menjadi

Reliabilitas(Keandalan)

desain.

r$.I

lll

resilient.

Reliabilitas adalah nilai peluang dari kemungkinan tingkat pelayanan


dapat dipertahankan selama masa pelayanan. Variasl dari data dianggap
mengik"i distribusi normal,sehingga faktor keandalan desain, hanya
diten-tukan oleh simpangan (deviasi) standar dari nilai S" dan tingkat peluang
Z*,yang diinginkan.
Ti"gkrt pelra.rg pada dasarnya merupakan tingkat risiko dari kesalahan

Ir*ll

Jalan

DAERAH RURAL

* 99,9
-95
75 *95

g0

7s

50-80

Pada dasarnya metoda desain didasarkan pada metoda cBR, dengan


rnenggunakan batas beban E,Ar,2,5 x 106 pada Road Note 31 hingga agak
rnenyulitkan untuk lalulintas dengan beban gandar yang lebih ti.gg dari itu.
l)ada overseas Road Note 31 hal ini sudah diperbaiki, sehingga beban EAL
yang digunakan sudah mencapai 30x106.
I)ada Road Note 31, disamping membahas Burtu (Single Surface Dressing)
rlan Burda (Double Surface Dressing ), irg, lapis pondasi, secara sp..ifi[

tlibahas juga Macadam dan HRS (Hot Rolled Sheet), yang pada overseas
sudah dilengkapi lagi dengan Stabilisasi semen dan Kapur, Slurry Seal, AC,
wearing course dan Binder yang lebih lengkap, disamping peninjauan
beban dan jenis tanah dengan pengklasifikasian yang lebih lengkap. Banyak
kriteria-kriteria yang diadopsi oleh Bina Marga dari Road Note 31 dan
( )verseas Road Note 31 in1,
ter;tamz- menyangkut rolled asphalt, binder dan
wearing course, refusal density disesuaikan dengan kondisi di Indonesi a, dan
sudah banyak dilaksanakan dilapangan.
4.4-L-7.

Kondisi Lingkungan, bukan lagi sebagai faktor regional (AASHO


2.
,72
), yang merupakan faktor kumulatif dari kembang-susut tanah,
perbedaan temperatur,dan penuaan bahan aspal.

Metoda Perancangan Pelapisan ulang perkerasan Lentur.


Pada dasarnya pelapisan ulang bertuiuan untuk meniaga
r
jalan masih dalam kriteria fungsi jalan semula, misalnya ^g
ialan

.reraiceabilifl

ll2

xon6c8ut16,t

BIAl<y. 2 : PERANCANqAN PERKER,4S,4NJ,4L-AN

tr4t4rt

berfungsi sebagai ialan arten dengan desain rencana. sepuluh tahun, atau
dalam kondisi lain meningkatkan serviceability ialan tersebut akibat
perubahan fungsi ataupun perubahan beban lalulintas. Pada pengertian yang
peftam^ dikatakan dilakukan pemeliharaan ialan, sedangkan pada kriteria

kedua dilakukan peningkatan kekuatan lapisan ialan.

Struktur ialan Lama, apakah masih berupa jalan tanah, ialan berbatu
atau sudah beraspal, bisa teriadi akibat menggenangnya air pada beberapa
lokasi, dilakukan peninggian badan jalan (raised grade) dengan menambahkan
matedal lapis pondasi sampai ketinggian yang direncanakan. Dalam kondisi
lain untuk peningkatan kekuatan tanah dasx atau meraPikan kembali level
permukaan dilakukan perbaikan tanah dasar (subgrade preparation). Harap
dibedakan bahwa peninggian badan jalan seperti ini, sudah merupakan
pekerjaan merubah dan memperbaiki kekuatan tanah dasar atau lapis
pondasi, sedangkan pelapisan ulang, tidak meningkatkan kekuatan hanya
menambal atau melapisi dengan lapis baru, tapi mempunyai mateiral yang
sama dengan lapis permukaan yang semula.

t0,08

0,408 ( 1 - log ESA )

0,0131og ESA

dimana:

D -

design deflection (mm),dari Benkelman Beam

(4.2s.)

number

oveday thickness.

axles (x106)

PAYEMENT SHAPING;

P.AC
(4.26.)

---------4

dimana:

= lapis per^t^

(leuelling thickness)

RCI = Road Condition Index

= perbedaancrossfall/camber

Tm. =minimum thickness,tergantung ukuran butir


maksimum.
= lebar perkerasan (m).

CATATAN : RCI = Road Condition Index,merupakan indeks dari perwuiudan


kondisi permukaan ialan ,yang diiabarkan dalam rumus berikut ini:
( -0,0501 x

IRI

1'220326)

RCI=10xe

IRI

adalah International Roughness Index,indeks kekasaran


permukaan, yzng diukur dengan alat NAASRA.
Dalam bentuk grafik relasi tersebut dapat dilihat pada Gbr.4.4.
dimana

CONTOH SOAL

4.4.

Diketahui:
Jalan2lajur 2x3,50m.

- ESA=8x106.
- D = lendutan dart alat Benkelman Beam = 3 mm.
- AC=loh
- IRI=5
- material lapis per^ta mempunyai butiran maks o 2 cm.

PAVEMENT STRENGTHENING:
(HRoDr)
2,3031og D

of cummulatives millions of equivalent 8,2 ton

ESA

T = 0,001 ( g- RCI )',t + T-,"

.
Nilai Sisa Perkerasan Jalan
Pengertian nilai sisa perkerasan jalan, adalah perwujudan nilat struktur yang
masih ada, datt sisa rencana umur perkerasan perancangan semula. Nilai sisa
perkerasan ini akan tetap diperhitungkan, bilamana akan dilakukan pelapisan
ulang diatasnya.
Metoda yangbanyak dipakai di Bina Marga, dalam pelaksanaan peranca{rg n
pelapisan ulang, adilah metoda yang dikenal dengan metoda HRODI(HoI
Rolled Overlay Design in Indonesia). Metoda ini menambahkan tebal lapis
ulang, dengan didasarkan pada tujuan pavement strengthening dan
pavement shaping. Yang pertama untuk memberikan perkuatan baru, dan
yang kedua untuk membentuk permukaan yang memadai sesuai tuntutan
bentuk permukaan dan kelandaian melintang jalan.

ll3

Metoda Perancangan Perkerasan Jalan

Hitung: Tebal lapis perata Qeveling) dan tebal perkuatan perkerasan.


a).
(-0,0501 x

=10xe

RCI
RCI = 7,0

T-i, = 2 +

3omaks

IIU

=Q*

1,220326)
( -0,0501
=10xe

3) 2 cm= 4 cm

51.220326)

{
ll4

BI;IK;A 2 : PERANCAN(AN PER,KERASAN JATAN

tadltcGailtl&J 1,AJ.lrt

T = 0,001 ( 9- RCI
T

0.,

* T-,. * P'lC

-0,001(9-1+,s14-.

4
0,023+4*1,,75=5,7'7 cm (tebal perata).

Metoda Peroncangan Perkerasan Jalan

700.0,01*
4

i\

:!

b).

2,303

log D

t0,08

.=

0,01 3 log

Tebal lapis tambahan

4.4.1.8.

fr
L,
ur
2
*
u
:E

0,408 ( 1 - log ESA )

0,0131og ESA

2,3031og3-0,408(1*log8)
0,08

= 5,77 +

(tebal perkuatan)
20,91, - 2'1, cm.

s\ \
\
,1

l.

tocltT5

L,
i9

_4,

Untuk rrret^ncang tebal perkerasan interblock,karena masih masuk

kelompok perkerasan lentur pe:lilncaflg^nnya sebagaimana perkerasan lentur


umumnya. Jadi mengikuti proseduf pefancangan sebagaimana yang sudah
diuraikan diatas. Bila menggunakan metoda analisa komponen pedu
ditambahkan beberapa modifikasi seperti dibawah ini.
Rumus ITP yang digunakan adalah :

ao.Do.

......

F$ffiffiI*
tl.tr

Jrln

T..F t?tr' I

r ttYtrEat wbln

Ir mt

tmrtl r

7.Om

\ \

lrl

c,ec r cE {fBrL JAlrd


w'&cr tlgYAxtrn?t

ll

!r\

-t*i

&
=
gt

ngl.o oaSgEvaTroia!

fi \\\\

Perancangan Interblock.

ITP= a,.D, + zr.Dr+ ar.D, +

'tdE
e

l,l0-0'04
=t5,l4cm
0,08 - 0,0 I
15,1'4

1t5

&{t

Crm at
a,3n ,c,Etroi
lsffib.r

-t1

i-i-.;;''

lOm

ll.!.6 cr2)

ATAL rqit

G aatlrlt

r"$fir.e

lc'af

rl
ntilh.mn
,rcalirohb
rl*c*rc C

L*

ROAO CgNDtTtoil

i.{uldlnt

3T8L

cta
tt{oEx t ncI

(4.28.)

dimana:

21, 22, 23, a4 bertufut-turut koefisien kekuatan relatif bahan


interblock, pasir perata, LPA dan LPB.
D,, Dr, Dr, Do masing-masing tebal lapis perketasan (cm).

Nomogram yang digunakan untuk mencari Indeks Tebal Perkerasan


IfP digunakan Nomogram 1 dan 2. Nomogrzm 1, digunakan untuk
stfuktuf pada lalu lintas berat seperti lapangan parkir-contasaer, taxiwal di
terminal p.ru*rt udara, ialan dengan repetisi ESA >105, ialan umum dengan
kecepatan 1:enc nz > 40 km/jam dll. Adapun Nomogram 2 digunakan
untuk lalu lintas ringan seperti tempat parkir umum, gatasi, tfotoar, tam fl
dan jalan lokal dengan ESA < 10s.Untuk koefisien kekuatan relatif spesifik
bahan interblock digunakan nilai pada Tabel. 4.12.Untuk nilai koefisien
kekuatan relatif bagi bahan-bahan LPA dan LPB sama dengan y^ng
diberikan pada Tabel 4.7 .

Iorol $oFanl

Arh'F*.

ftEoffrrlttd

hrr lf rm.
sld tct ) 6.
trnrIhtO
ltc

,lmrulc ilrr,.,r

KE

BUTUI.'AN

TE

BAL PEMBE NruKAN

PE

RMUI(AAI\I

SUMBER: IRM$ BIMMARGA

Gbr.4.3. Desain Pelapisan Ulang

I
Bi/ty'w 2 : PERANCANqAN

116 xo%6cauN6J74t4rt

PER-KER.AS.4N

JAL*N

Metoda Perancongan Perkera.san Jalan

CONTOH SOAL

ll7

4.5.

I)crancansan Interblock
a. Perkerasan Baru

Misal diambil kondisi seperti contoh soal 4.3. dengan kecepatan


rencana= 55 km/jam.dan lalu lintas ringan( Struktur perkerasan
lama 2 jalur)

DDT = 4,60 FR= 1 UR=5 tahun.


LER5 = 43,10 -+Total EAL selama 5 tahun =
<10s -+ Nomogram 2 -+dtdapat ITP5 = 6,30.
o

15 18 2c
" ,", ,,],?*r .1n2.r.t1a

Gb.4.4. Korelasi RCI dan IRI

Ambil susurian perkerasan:


Tebal interblock 10 cm kelas I = A,44 x 70
Pasir perata 5 cm
= 0,04 x 5
LPB sirtu
15 cm
= 0,1,2x75

22

(SUMBER: RDS-Bina Marga)

berapapun nilai ITP.

n Keku atafi Relatif bahan


Tabel 4.12. Koefisien
KOEFISIEN KEKUATAN REI,ATIF
a}

Al

(ks)

K,
(ks/cnfr cBR
4s0

0,44

350

0,40
0,35

JENIS

KEKUATAN BAHAN
MS

a3

ifik Interblock

(0/0

Block beton
Block beton
Beddins sand

Tabel 4.l3.Tebal minimum lapis petmukaan interblock.


ITP

<

5,00
5,00-10,00
10,10-12,00
>1,2,00

TEBAL MINIMUM(cm)

BAHAN

6
10

Beton,Asbuton
Beton
Beton

12

Beton

78.658

= 4,40
= 0,20

= 1.80

ok!
b. Pedapisan tambah.

Misal Interblock lama :


- Interblock kelas I tebal 10 cm kondisi baik.
- Pasir peraLta 5 cm kondisi baik.
- LPB sirtu 15 kondisi baik.

BAHAN

500
0,04

ITP =6,40>6,30

Batas minimum tebal lapisan untuk lapis permukaan interblock


sebagaiman^ y^ng dicantumkan pada Tabel 4.13. Untuk lapis pasir perata
(bedding sana) tebal minimum adalah 3 cm dan tebal maksimum 5 cm.Bila
diperlukan lapis pondasi bawah(I-PB) tebal minimum adalah 10 cm untuk

43,1x5x365

Direncanakan untuk menampung:


- LER = 300 Beban As Standar.
- UR = 10 tahun.
- ITPp",k","."n,u-,^ont"t'u' = 6,76 ( Contoh Soal 4.3).
-Jadi total EAL = 300 x 10 x 365 = 106 > 10s -+ Nomogram
Dari Nomo gram 1 didapat:

ITP

1.

,orn^= 8,3

[TPp",k,^,.n=

ffi

,g,r,-iTF ,u u= 8,3-6,1 6 = 2,14.


Untuk perlapisan tambah, gunakan LPA dari batu pecah kelas A.
Tebal lapis perkuatan = tebal LPA= ITPp..r..^r^n 122 = 2,1.4:
0,1,4=75,3

16 cm. Jadi susunan perkuatan menjadi:

-+10 cm interblock- 5 cm pasir perata-LPA=16 cm@atu pecah A)LPB=15 cm (sirtu).

T
llS

Bt k;t/. 2 : PER;4NCANqAN

rldvts4autlet MJ.l'vt

PERKER^.SANJAL,4N

4.4.2. PERANCANGAN PERKERASAN KAKU.


4.4.2.l.Pendekatan Metoda Desain Petketasan Kaku.
Pendekatan metoda desain perkerasan kaku, intiny^ szm dengan
perkerasan lentur, yaitu
a). Pendekatan metoda desain yang didasarkan pada beban kendaraan
rettczfl ,yang akan menyebabkan tingkat kerusakan yang diiiinkan.
b). Pendekatan metoda desain yang didasarkanpada iumlah repetisi
kendaraan standar, yang iuga dibatasi sampai tingkat kerusakan yang
diijinkan.
perbedaannya adalah pada konsep penyebafan tegangan pada badan
fleksibel perkerasan lentur dan pada badan kaku pada perkerasan semen.
Perkerasan kaku mempunyai tebal yang relatif tipis, dibandingkan
dengan tebal lapis tanah dasar. Karena modulus elastisitas semen sebagai
mateial perkerasan kaku, mempunyai nilai yang telatf lebih besar dari
material pondasi dan tanah, maka bagian terbesar yang menyeraP
tegangan akibat beban adalah pelat beton itu sendiri.
Tegangan pada perkerasan kaku, disebabkan oleh, beban roda'
perbedaan temperatur pada pelat beton, perubahan kadat air, dzn
perubahan volume dari pelat beton dan lapis pondasi bawah dan tanah
dasar.

Gambaran perbedaan penyebaran distribusi gzy^,

sekaligus

tegangannya dapat dilihat pada Gbr.4.5.

119

pondasi bawah-pun tidak pedu terlalu kuat, kekuatan secukupnya, asal bisa
menjamin duduknya pelat beton pada bidang r^t^, dan mampu mengatasi
PumPinS in{iltrasi ur dzn bawah pondasi, dan ekses dari tanah-tanah
potensial. Didaerah empat musim masih ditambah lagi ketahanan terhadap
proses pendinginan dan pencairan butiran es (freeTe dz tbaw).

4.4.2.3. Sifat Umum Perkerasan Kaku.

1.
2.
3.
4.
5.
6.
7.

Keandalan (serviceability) ti.ggr, mampu memikul beban besar.


Keawetan (durabiliry) lama;bisa mencapai umur 30 - 40 tahun,
tahan lapuk, oksidasi dan abrasi, pemeliharaannngan.
Lapis tunggal (single layer), dingan LPB tidak terlalu struktural.
Sangat kaku, modulus elastisitas bisa 25 kfu modulus elastisitas
lentur, dengan demikian distribusi beban ketanah dasar relatif kecil
I(ompetitif, katena walaupun biaya awal besar, umur rencanalama,
dan pemeiih araan lngan.
Keamanan, besar karena permukaan kasar.
Dapat digunakan pada tanah dasar, dengan daya dukung rendah.

Road Note 29,


dengan CBR =

menyebutkan bisa dipakai untuk tanah dasar


- 5o/o, yang penting uniform.

20

4.4.2.4 Beban Lalu Lintas Rencana.


Secara umum tinjauan beban lalu iintas reflcana- akan mengkaji

- Jumlah beban sumbu dan kumulatif beban ekivalen yang lewat,

4.4.2.2.Ikiteria Desain Petkeras an Kaku.


Tiga faktor desain untuk peranc flgan perkerasan kaku yang sangat
penting, adalah
1). I(ekuatan tanah dasar (subgrade), dan lapisan pondasi bawah
(subbase), yang diindikasikan lewat parameter k(swbgrade
reaction), atau CBR.

2).

Modulus I(eruntuhan lentur beton (flexural streflgth

3).

dan
Beban lalu lintas

- f.),

untuk mendapatkanpelayanan maksimal dari perkerasan kaku, pelat


beton harus te{amin mempunyai landasan yang kuat dan uniform. Struktur
perkerasan kaku hanya mempunyai lapis pondasi bawah, sedang lapis
p<,nclasi atas tidak clipedukan (bandingkan dengan perkerasan

Metoda Perancangan Perkerasan Jalan

lcntur). Lapis

dan konfigurasi sumbu (ihat Bab 1.2.1)


- I(husus untuk perkerasan kaku, beban lalu lintas reflcan
didapatkan dengan mengakumulasikan iumlah beban sumbu untuk masingmasing jenis kelompok, dalam rencafl lajur selama umur rencana.
Prosedur yang dilakukan adalah
1). Eliminasi Lalu Lintas

a).Hanya mengambil kendaraan niaga dengan berat > 5 ton.


b). Dipilih konfigurasi sumbu :
- STRT (sumbu tungp5al roda tunggal),
- STRG (sumbu tung4al roda ganda)
- STdRG (sumbu tandem/sumbu ganda roda ganda).

ln

B^Kw 2 : PER,ANCAN(AN

xon6c8l4r1si) 74J,4n

PERKER,ASAN JA[-4N

tn

Meloda Perancangan Perkerasan Jalan

2).Langkah estimasi Lalu Lintas Rencana:


a). Hitung LHR pada akhir usia rencana, sesuai kapasitas ialan.

b). Estimasi LHR awal dari kelompok sumbu, pada masingmasing jenis kelompok sumbu kendaraan niaga (bisa dibuat
kelipatan 0,5 ton, misal: (5 - 5,5), (5,5 - 6), ( 6 - 6,5 )
demikian seterusnya.

Kekuoton

Subgrode

c). Biia ada konversikan beban sumbu tridem ke beban sumbu


ganda, yaitu bahwa beban sumbu tridem setara dengan dua
sumbu ganda.
d). Hitung JSKN (fumlah sumbu kendaraan ntaga), selama
umuf fencafla.

TEGANGAN PCC: KEKUATAN PCC


TEGANGAN SG << KEKUATAN SG

JSKNL)R=365XJSKN,XR.

b). perkeroson lentur

.....(4.29.)

dimana:

a--l?-?frff^
-*|

Kekuoton
Perkeroson
TANAH DASAR I SG

TEGANGAN SG
TEGANGAN AC

KEKUATAN SG
KEKUATAN AC

- jumlah total sumbu kendaraan niaga selama


umur rencana
JSKNH = jumlah total sumbu kendaraan maksimum
htrian, pada saat jalan dibuka.
R
= faktor pertumbuhan lalu lintas selama umur
fencan .
i). Untuk i * 0 ---+ selama umuf fencana terjadi pertumbuhan
lalu lintas
JSKN,R

SUMBER: PAVEMEM DESIS\


PROF, M,W WTCZAK

IL

(l+i)uR -1

<<

Faktor pernrmbuhan lalu lintas kondisi

PRINSIP DTSMIBUSI TEGANGAN KEKUATAN


PADA PERKERASAN KAKU DAN LENTUR

Gbr.4.5. Distribusi dan tegang an pada perkerasan

(4.30.)

i
i)

dapat juga

ditentukan dari Tabel 4.14.

ii).Untuk

i + 0, jika setelah waktu tertentu (J\

tahun),

pertumbuhan lalu lintas tidak berubah lagi:

x=

(l+-')'^
I

iii).Untuk

+(uR-un-;ftr

i)'*^-1

i + 0, jika setelah U\

)...........

........(4.31)

tahun, pertumbuhan lalu

lintas, berubah dari sebelumflya. ( i') tahun:

T
122 11ou6t8w116J

R_

trAta*t

Brltru'u.

-l

(1+i')uR-

2 : PERANoAN4AN

(t *;')uR

1l+ i)uR*

uRm

-l

PERKER,ASANJAT-AN

Tabel4.15. Faktor keamanan beban ( Fo)

dari ketiga persamaan i), ii) dan iii) keterangan notasi adalzh:

lalu lintas
laiu pertumbuhan lalu lintas per-tahun(%)
laiu pertumbuhan lalu lintas baru dari sebelumnya
umur renc^fl (tahun)
waktu tertefltu (tahun) sebelum UR selesai.

= faktor pertumbuhan

=
=
UR =
UR- =

123

g). Faktor keamanan beban(F"u),dimasukkan sebagai indikator, ufituk


menampung tingkat pelayatr:B.n rerhadap keselamatan pengendaradapat
diambil danTabel4.15.

i'

Metoda Perancangan Perkerasan Jaktn

(%o)

Tabel4.14. Faktor petumbuhan lalu lintas (R)


LAJU PERTUMBUHAN (i) PER-TAHUN (% )

PENGGUNAAN JALAN

FAKTOR KEAMANAN

Jalan Bebas Hambatan utama(major


freeway) dan ialanberlaiur banyak,
volume kendaraan niaga tinggi.

1,2

Jalan Bebas Hambatan (free='Jay),dan


ialan artei dengan volume kendaraan
niaga menengah
Jalan dengan volume kendaruan ruaga
rendah.

1,1

UMUR
RENCANA
(thn)

10

5,2

5,4

5,8

5,9

6,1

4.4.3. METODA PERANCANGAN.

10

10

10,9

t2

73,2

14,5

15,9

4.4.3.1. Metoda

31,8

15

15

17,3

20

23,3

1'7

20

20

24,3

29,8

36,8

45,8

57,3

25

25

32

41,6

54,9

73,1

98,3

30

30

40,6

56.1

79,7

113,3

164,5

J)

50

35

40

40

60,4

J,t
95

111,4

1s4,8

172,3

271

259,1

w,6

AASHTO

1,0

1993.

Tidak jauh berbeda dengan perkerasan lentur,untuk perkerasan kaku


mengedepankan rumus untuk perkerasan kaku. Identik dengan rumus
4.22. AASHTO menurunkan rumus berikut:

rn

loElV,

AP.S/
Z

*
S
o + 7,35 log@ + l)

'ott-r- ,-r)
- 0.06+ - ,.#ffi + t4,22- 0,32* rq) * to
l+

Sr"*cu(dJt-'U3q
Z t

5O:trt

Du'"

1D+t;x'46

l&41

(8,, /

==
kl\z,

(4.34.)
(e) HitungJumlah Sumbu Kendaraan Niaga renc

naperlaiarialan:

Dimana

= Tebal pelat beton(inch)

= Beban sumbu standar total ( ESA ) selama umur rencana.


= Selisih antara nllai PSI diawal dan akhir masa layan srrukrur

W,ta
A PSI

perkerasan.

JSKNr*r"i"' = JSKNr*

= Deviasi Standar dari nilai W,ta.

so

Zt
dimana:

C=

koefisien distribusi kendaraan (ihat Tabel 4.2 untuk

kendaraan berat).

(0

pada tingkat peluang (probabilitas), R

= Koefisien Drainase
= Koefisien transfet beban(=1,2 bila sudut dilindungi)
E. = Modulus Elastisitas beton (psi)

Ca
J

Hitung iumlah repetisi kumulatif untuk i^p


konfigurasi /beban sumbu pzdalajur reflcarr

= Konstanta Normal

IP' = Indeks Permukaan=P,=terminal PSI@resent Serviceability Index)


S.'
= Modulus Keruntuhan beton(psi)

kombinasi

k = Modulus Reaksi Tanah (psi/in)

Dari rumus diatas diturunkan Nomogram peranc ng n(Gb.4.6.)

T
124 XortGG,&u16.,

roe,

jrui,

BAKA 2 :

trAtAu

. raq t

r.!srros!o(Dr, - 0.06

[ ^rr'l
'*,.[*-r.r]|
+
--------

PER

Metoda Peroncangan Perkerasan Jalan

ANCAN4AN PER-KER/4.SAN JAL-AN

125

+ (a.22-0.!2P:l rlotro

"mrr

Gbr. 4.7. Beban Roda Kendaraan

metoda PCA

.3

l(xr

l(x, !o

llodulor

R.oclls, I

ol

I(asus

SubOtoda

(pcil

SUNIBLIR : AASHTO Guide For Daign


Parrement Structures

CONll)}I:
of

k=12lxt.
ti"=5x10"psi

Fi
=1,0

s., = 650

S,,

O.Zq

R=95%(Z-=-1,645)
APSI=4,2-2,5=

1,7

W,, = 5,1\10'( 18 kiP LSA)


C,
didapat D=10,0jnch.

Hal ini diperkuat dengan oleh Dr.Girald Pickett dan Gordon K.RayInfluence Cbarts for Concrete Paaements Transactions-AscE Vo1.16.1951;

Gbt.4.6. Nomogram AASHTO untuk Petkerasan kaku

bahwa:

4.4.3.2. Metoda PCA.

1.

PCA

(Portland Cement Association) Thickness Design USA,


dijadikan oleh NAASRA (I.{ational Association of Australia State Road
Authorities) sebagai referensi untuk menFrsun Standar Perkerasan Kaku
NAASRA.

2.

Berikut ini adalah tinjauan metoda PCA tersebut.

Kasus

: Beban roda tunggal dan tandem

3. AASHTO

tepat bekeria pada

pinggir sambungan melintang (transversal).

Kasus

: Beban roda tunggal dan tandem bekeria pada tepi

luar konstruksi perkerasan.

Kasus

Untuk beban as tunggal pada lokasi 75 mm dari tepi pelat beron,


dan as tandem pada lokasi 25 mm dari tepi pelat beton, akan
memberikan tegangan maksimum pada pelat beton >99oh dari
keseluruhan beban lalu lintas yang lewat (kasus 1)
Peningkatan tegangan akibat beban lainnya dai 1o/o beban total,
tidak akan mempengaruhi tebal ranc ngan pelat beton yang
bersangkutan.

a. Beban lalu lintas diamati pada 3 kasus penempatan beban roda


kendaraan,roda tunggal,roda tandem (ganda),lihat Gbr. 4.7 dimana:

memberikan tegangan yang lebih tinggi dari I(asus 1,


sedang kasus 3 memberikan tegangan paling rendah dari ketiganya.
Frekuensi terjadinya beban roda, pada posisi repetisi paling sering,
lihat gambar diagram sebelah kanan. Ternyata kasus 1 dan kasus 3
memberikan kondisi yang representatif untuk rancangan.

lo

b.

3 : Beban roda tunggal dan tandem bekeria seperti

kasus 2 tapi digeser 15 cm dari tepi luar konstruksi perkerasan.


i

,t

Design Commitee menyebutkan dalam asumsi


konservatif, tidak akan terjadi penyaluran beban roda kendaraan
akibat lalu lintas (tranverse) yang akan melewati/menyeberang
pada sambungan memanjang.
Butir agu ini penting dalam hal kenapa ukuran tulangan
sambungan melintang -tiebar- relatif kecil dan diameternya lebih
kecil dari ruji -dowel.
Nomogram per^ncangan tebal perkerasan dari PCA, dapat
dilihat pada Gbr. 4.8a,4.8b dan 4.8c.

T
By!}<l( 2 : PERANCAN4,4N PERKER^S.+N J/4L^N

126 Xon6t4w1e11AJ,4tt

Metoda Perancongan Perkerasan Jalan

127

Gambar 4.8a. mempresentasikan kondisi sumbu tunggal, roda


tunggal. dalam selang 3 - '10 ton, Gbr. 4.8b. sumbu tunggal, roda
ganda, dalam selang 4 - 1,6 ton dan Gbr.4.8c. adalah kondisi untuk
sumbu ganda roda ganda dalam selang I - 24 ton.
3-orp-oa

E
a

:
4

c
I

gi
ta

io
e

Ii

I
q

ll***lf
-

O".rgn Cnrd lu Singta-ffiected Sngte

ffi.r"*rl,.

:o

CTLlFQfrilIA gF^fiNG fiTDd

Gbr. 4.8 a. Nomogram untuk sumbu tunggal, roda tunggal


b. Nomogram untuk sumbu tunggal, roda ganda
(Sulfnen:

Oa.tg\ Ch*t tu Atsbwnaillad E,ngk Ar!.$

n
aItE iSSlliBLY LOA0

lre*ll

Cement & Concrete Association of Austalia.)

t{H!$d*.rr

El+t
c.

Kekuatan Tanah Dasar dan Lapis Pondasi Bawah.

I(ekuatan Tanth dasar dapat didekati dengan modulus reaksi tanah


dasar (modulus of subgrade reaction), atau California Bearing Ratio
(cBR).

Konversi nilai dari angka CBR ke angka Subgrade Reaction k, dapat


dilihat pada Gbr. 4.8d.
Pemakaian lapis pondasi bawah, dapat digunakan bahan campuran

beton dengan kekuatan rendah (biasa disebut sebagai CTSB

$I

Fetat,oash,p 8ei$6n hlodulus ol


Suograde Reacton afld Cahlornia
8sa.,og Aeao

Cement Treated Sub-Base), namun dapat juga digunakan


t
^ggreg
saja, tanpa pengikat semen. Bila digunakan aggregat tanpa
bahan
pengikat, fungsinya hanya sebagai dasar perata permukaan untuk
duduk pelat beton perkerasan kaku.

Oa$rern

Gbr.

eu'*BR

Crra/f to. Bilal.Wtreeled TaAGafi Axles

4.8

c. Nomogram

untuk sumbu tandem, roda ganda.

d. Nomogram unruk konversi nilai CBR

ke

Subgrade Reaction (k)

Apabila digunakan aggregar rersemen (bound sub-base),lapisan subbase ini dapat meningkatkan kekuatan tanah dasar. bila digunakan
dalam hal demikian, peningkatan kekuatan ini, dapat diliha t pada
Gbr.4.9.

CATATAN:
Metoda PCA ini banyak dipedomani oleh negar^ lain diluar USA,
karena dibandingkan dengan metoda AASHTO, metoda Road Note

1
128 t1ovt6c4ur6J7424u

El.;t'/c'..l.

2 : PER,ANCAN(AN PERKER.4S,4NJAL"4N

31 (tJK), US Corps of Engineers dll;metoda PCA lebih


lain tidak memerlukan pendekatan
ringkas dan sederh afla,

29

atau

^f:rtar^
t".iiudup ikiim(seperti kondisiy'ee<! 0 tbap -bekn&leleh) yang tidak
ditemui dinegara tropis termasuk Indonesia' Demikian pula

Metoda Peroncangan Perkerasan

ln

Namun metoda ini iuga sebenarnya mengadopsi metoda dari PCA diatas,
walaupun dilakukan modifi kasi.
l' arameter yang digunakan antaru

a.
b.

Jdlan

Maximum value Permitted bY NAASRA

l{rn:

Beban lalu Lintas Rencana, sebagaimana padz 8ab.L.2.1. Hanya


kendaraan niaga dengan berat total > 5 ton yang diakomodir.
Modulus subgrade reaction k, dilapangan dapat dilakukan dengan
pengujian 'Platc Bearing Test (AASHTO T 222-81) atau ASTNI D
1196.

:U

c.

t\z

i"o
,uff
0C u.l

rg*

<;

G3
{5^
U-

Wtur lJ

ail
(Jn

ur;

f,o
u.ro
ASSESSECI SUSGftAOE STfiENSTH

-C8N

{SbI

Elfective lncrease in Subgrade Strength


Oue to Cement'keated Sub-Edse

CBR lapangan dilakukan dengan pengujian CBR lapangan sesuai


dengan SNI 03-1731-1989 atau CBR laboratorium sesuai dengan
sNr 03-1744-1989.
Apabila CBR mempunyai nilai < 2o/o maka harus dipasang pondasi
bawah terbuat dari beton kurus (Lean Mix Concrete) setebal 15 cm
yang dianggap mempunyai ntlat CBR tanah dasar effektip 5o/o.
d. Tebal pondasi bawah minimum didapatkan dari Gbr.4.10. dengan
tebal paling sedikit 10 cm yang mempunyai mutu sesuai dengan SNI
No.03-6388-2000 dan AASHTO M-155 serta SNI 03-1743-1989.
Bila direncanakan perkerasan beton semen bersambung tanpa ruji,
pondasi bawah harus menggunakan campuran beton kurus (CBI!.
e.
CBR tanah dasar effektip dapat dilihat pada Gbr.4.11. CBR effektip
adalah peningkatan CBR tanah dasar sesudah diperkuat dengan
campuran beton kurus (CBK).
Beberapa ienis pondasi bawah yang direkomendasikan adalah : sirtu
@ranalar sabbase), beton kurus gilas padat (lean rolled conrete),
campuran beton kurus (CBI(=lean mix concrete), atau stabilisasi.
CATATAN:

Gbt.4.9. Peningkatan kekuatan subgrade


dengan adanYa CTSB.
penilaian perwuiudan perkerasan dalam bentukan seniceabiliry Qthat
i.e.; ,iarU^Atin)au. Sehingga relatif lebih mudah untuk dilaksanakan.

4.4.3.3.Metoda Bina Marga 2003.

PadadasarnyaPerzncaflg^ndenganmetodaBinaMargasesuai
Perkerasan Jalan Beton Semen ("dT-14dengan pedoman Pl.reic n
^n
Australia.
2OOZ), *"rrg"dopri perancangan perkerasan kaku dart Aastroad

Scbagai alternatif (walau bukan cara Bina Matga) untuk mencari kekuatan sub-base
rrnhound dan boand subbase dapat menggunakan Tabel 4.16 dan Tabel 4.17, yang
nrerupakan effek ketebalan sub-base pada k desain(Handbook of Concrete Engineering llobert G. Packard ).

f.

Analisa perkerasan beton semen didasarkan atas dua model


kerusakan yaitu:
- fatik : kelelahan struktur pelat beton akibat repetisi beban.
- erosi pada pondasi bawah atau tanah dasar yang diakibatkan
oleh lendutan berulang pada sambungan dan tempat retak yang
direncanakan.

I
ll0 roil644ux&JMt4u

Eutlz-u"

2 : PERANCAN(,AN PERKERASAN JAL.AN

Metoda Perancangan Perkerosan Jalan

13t

Tabel4.16. Pengatuh Unbound Sub-Base pada nilai k

NIIAI

NILAI k SUB-BASE ( pci )


9in
6in

TANAH DASAR

4in

50

100

65
130

14A

20a

220

230

300

32A

330

t:t

12 trt
110
190
32A
430

85
160
27A
370

Tabel4.L7. Nilai k untuk Cement Treated Sub-Base


NII-A,I kSUB-BASE (Pci )
NII-AI K
8in
6in
4iu
TANAH DASAR
50
100
200

170

230

280
41A

400
640

10

in
' Jit6 CBR < 2q5 glnhn hb.l
pond..t b.r'ah CBK lgt M drn

390
640

310
520
830

.ig.ir |wFfFt
l'nhdg{r*M5*

& 5 6 ?a

SUMBER: Cement & Concrete Association of Austtalia.

CBR Tmah

20 zS ror5

Dr.er R.nc.ne (r6t

( Sumber Pedoman Pd T-14-2003)

l0

.t2 1'

CBR

Gbr.4.11. CBR Tanah Dasar effektip dan tebal


pondasi bawah untuk perkerasan beton semen

il

Eeo

.?0

rfl.a

lifla CBR bnalr daar hrratg dad 2t,


gunakar C8l(, tr[dnlnlmum llcm

Io

4.4.3.3.1. Prosedut Perancangan Perkerasarr Beton Semen.

Ii
ItI

I,ANGKAH

!e

I,ANGKAH

1.

.cl

tt

Tentukan nilai CBR tanah dasar.

2.

G.

a,
.)

hld
f
sprutilp.ief,n
:Ir:-rlr.sra

1:

2:

Merubah data lals lintas dalam satuan kendaraan meniadi dalam satuan
sumbu kendaraan.

t0?

3r{'

lr

i). Menghitung jumlah konfigurasi beban sumbu untuk masi,g-masing

ilo

jenis kendaraan riaga.

ii). Menghitung jumlah sumbu kendaraan niaga 0SI(NJ) rencana dicari

&tMh trpelbitunbu

dengan rumus 4.29.

iii).Menghitung jumlah repetisi kumulatif tirp


Gbr.4.10. Tebal Pondasi Bawah minimum untuk
Perkerasan Beton Semen ( Sumber: Pedoman Pd T-14-2003)

konfigurasi /beban sumbu padalajw renc^n

I-ANGKAH

3.

kombinasi

3:

Piiih tipe struktur perkerasan.


a). Jenis perkerasan :BBDT, BBTT, atau BMDT dengan atau tanpa ruji.
b) Bahu ada/ldak,kalas ada apa fenis bahu.

1
l!2 xofi6t8w1al14J4u

Butrlt 2 : PERANCAN4AN PER-KERASANJALAN

c). Jenis dan tebal lapis pondasi bawah.


d). Sifat kekuatan struktur: CBR tanah dasar, CBR effektip, kuat tarik
lentur.
e). Faktor keamanan beban.

LANGI(AH 4:
4. Menghitung I(ekuatan

a.

b.

Pelat Beton.
Pilih satu tebal pelat beton lebih besar dari tebal minimum 15 cm.
Pemilihan tebal pelat berdasarkan pengalaman atau contoh yang ada
gun kan gambar vang bersesuaian dengan kondisi
sebelumnya,
^tzu
langkah 3 menggunakan grafik pada LampiranCl.2 s/d C-15.

Hitung beban reflcana per-roda untuk setiap ienis sumbu

= F.s

xBeban Sumbu/iumlah roda (F*o diambil dari Tabel 4.15.)


Jumlah roda pada jenis sumbu STRT adalah2buah, STRG adalah 4
buah, STdRG adalah 8 buah, dan STrRG 12 bvh. Jika beban

c.

> 65 kN(6,5 ton) znggap

dan gunakan nilai


di Lampiran C-7
nomogram
tersebut sebagai batas tertinggi pada
s/d C-9..
Tentukan tegangan ekivalen (IE) dan faktor erosi (FE) untuk setiaP
ienis sumbu dengan menggunakan Tabel pada Lampitan C-1. s/d C-

reflc^fla per-roda

6.

d.

(fE) dengan kuat tarik lentur {"


Dengan faktor rasio tegangan (FRT) dan beban renc fl\ tentukan
jumlah repetisi ijin untuk fatik(fatigue) dari nomogramLampiran C7, yang dimulai dari beban roda tertinggi dari ienis masing-masing

t33

c rayaflg sama hitung jumlah total erosi dari setiap beban roda, dari
semua jenis sumbu yangada.

k. Hitung jumlah total


l.

kerusakan av,tbat fatik dan jumlah total

kerusakan akibat erosi untuk seluruh jenis kelompok sumbu.


Ulangi langkah a) sampai k) hingga diperoleh ketebalan tertipis yang

menghasilkan total kerusakan aklbat fatik dan atau erosi < 10oo/o.
Tebal tersebut adalah tebal pelat yang paling ekonomis untuk tebal
perkerasan beton semen yang direncanakan.
4.4-3-3.2. Perancangan Penulangan pada perkerasan Beton semen.

^.

Penulangan pada perkerasan beton semen bersambung


tanpa tulangan (BBTT).

Pada tipe ini penulangan tetap dipedukan untuk meminimalkan


retak rambahan penul^ng n secara khusus mutlak diperiukan bila
ada:

- Pelat dengan bentuk idaklazim.


- Pelat dengan sambungan tidak seialur.
- Pelat berlubang.

b.

Tentukan faktor rasio tegangan (FRT) dengan membagi tegangan


ekivalen

e.

Metodq Peroncangan Perkerasan Jalqn

Penulangan pada perkerasan beton semen bersambung


dengan tulangan (BBDT).

Luas penampang tulangan dapat dicad dengan rumus berikut ini:

A.-s-',u.L.M.s.h
"
2f,

(4.35.)

sumbu.

f.

Hitung jumlah prosentase dad repetisi fatik yang direncanakan

dimana:

g.

terhadap fumlah repetisi iiin.


Dengan menggunakan faktor erosi(FE) tentukan jumlah repetisi ijin
untuk erosi, dengan menggunakan nomogram Lampiran C-B atau C-

A, =
(
=

9.

g
h
L

h. Hitung prosentase dari repetisi erosi yang direncanakan terhadap

i.

j.

iumlah repetisi ijin.


Ulangi langkah e) sampai h) untuk setiap beban roda pada jenis
sumbu tersebut, sehingga iumlah repetisi beban ijin yang terbaca
pada Nomogram Lampkan C-7 dan C-8 atau C-9 yang masingmasing mencapai 10 juta dan 100 iuta repetisi.
Hitung jumlah total fatik dengan meniumlahkan prosentase fatik
dari setiap beban roda dari semua ienis sumbu tersebut. Dengan

luas penampang tulanganbaia (mm2 /m lebar pelat)


kuat tarik ijin tulangan (I\[Pa). Biasanya 0,6 x tegangan

leleh.
gravitasi (m/det2)
tebal pelat beton (m)

=
=
= jank antara sambungan yang tidak diikat danf ztau

tePl

bebas pelat (m).


M = berat per-satuan volume pelat (kg/-,)
p = koefisien gesek
pelat beton dengan pondasi bawah
^ntarz(tabel4.18.)
Luas penampang tulangan berbentuk
empat persegi
^nyaman
panjang dan bujur sangkar ditunjukkan padaTabel4.19.

1
lu

,lou6c8urcr'J4J,4u

ButP<|,.

2 : PER,ANC^NqAN PERKER.ASAN JAL-AN

Tabel4.18. Koefisien gesek

P. =

P.

I-APIS PEMECAH IKATAN (bound breakel

No.

KOE.FISIEN GESEKAN

(r)

Tapii-esap ikat aspal diatas permukaan pondasl


bawah.

L;b;;"

-)

1,U

1,5

parafin tipis pemecah ikaun

Krret koinpon

()

f., =
fy =
n =

2,0

rhloinottd rubber t*ritg n*poan$

=
=
=

t1

E.

E.

Tabet 4.19. Ukuran dan berat tulangan anyaman polos dilas'


TULANGAN
MELINTANG

TUIj.NGAN
MEMANIANG
Diameter

Diameter

Jaral<.

(mm)

(mm)

/mm)

Jamk
(mm)

100
100
100
100
100
100
200

17,2
10

8
7.1

9
8

Buiut $anskat

TUI-ANGAN
Memaniang

Melintang

satuafl
luas

(mm2/m)

(mm'/m)

(ks/m2)

I
I

200
200

r227

?51

11,6A6

9tJ6

9J07

200

200

8
8

200
200

785
636
503

251
251
251
251
251

250
250

318
251

201

4,076

201"

3.552

503

503

7,892

393

393

5,165

200

Berat per-

396

235
290

6967
5,919
5,091

menerus adalah 0,6oh

2N

318

318

4.994

2N

251,

251

3.946

7,1

204

7,1

198

198

6,3

2W

6,3

200
200
200

t56

r56

3,108
2,447

200

200

dimana:

200

98
83

1,542

200

98
83

0987

L."
p

cl. Penulangan memzniang.


Tulangan memaniang yang dibutuhkan pada perkerasan beton
,.*.r, bertulang menerus, dengan tulangan dihitung dengan rumus
berikut ini.
100

.f ,,(r,3

- 0,2p)

fr-''.f,',

L., =

menerus

dengan tulangan.

p-

- l<eatas

.............(4.36.)

luas penampang beton. Jumlah optimum

tulangan memanjang perlu dipas


ag r jarak dan lebar retakan dapat
^ng
dikendalikan.
Secara teoritis jarak antara reta.k^n pada perkerasan beton menerus
dengan tulangan dihitung dengan rumus berikut:

c. Penulangan pada perkerasan beton semen

28s

Prosentase minimum dari tulangan memanjang pada perkerasan beton

10

i0

-225

8,138

100
200

9
8

4.20.)
koefisien gesekan
pelat dan lapis dibawahnya.
modulus elastisitas^fitara
baia =2,1x100 1kg/cm2;
modulus elastisitas beton = 1485 { { Gg/cmr).

$abel

Tabel4.20. Proporsi angka ekivalen baja


dan beton (n).
f. ftg/.m')
n

100
200
200

10

185

prosentase luas tulangan memanjang yarig dibutuhkan


terhadap luas penampang beton (%o).
kuat tarik langsung beton= 0,4+0,5 f., ( kg/cm).
tegangan leleh rencanabaia GS/cm,;
angka ekivalensi antart-bajz dan beton(E"/E)

1,75

ErnpatPetsegiPaniqL
12,5

LUAS PENAMPANG

Jalan

Metoda Perancangan Perkerasan

u
fb
es
f,,
n
E.
E"

-f",'
n.p' .u.-ft(e

".E "

...... (4.37.)

-f",)

= jank teoritis

retakan (cm)
^ntara
perbandingan
luas
tulangan
memanjang dengan luas
=
penampang beton
= perbandingan keliling terhadap luas tulangan = 4/d
= tegangan lekat antan tulangan dengan beton =

1,97! f, GS/cm';.
= koefisien susut beton = 400.106.
= kuat tarik langsung beton = 0,4 + 0,5 f., ( kg/cm).
dan beton (n=E./E)
= angka ekivalensi
^nt^r^baja
modulus
elastisitas
beton
l4B5
{ q 6g/cm).
=
=
= modulus elastisitas baia =2,1x10u 0.g/.-1

T
lffi ,ldnGtqUN&J,J424U

Byty-|/.

2:

Untuk meniamin agar dtd^pat retakan yang halus dan iatak ^fltar^
rctakan yang optimum, maka:

o/o tulangan dan perbandingan


tulangan(u) harus besar.

- perlu

Metoda Perancangan Perkerasan

PERANoANqANPERKER.+SANJAT-AN

menggunakan tulangan

^nt^r^

ulir

keliling dan

(deformed
mempetoleh tegangan lekat yang lebih tinggi.

baA

luas

ufltuk

Jarzk retakan teoritis yang dihitung dengan Persamaan 4.37. dtatas


harus membedkan hasil antara 150 dan 250 cm.
+
Jaruk antara talangan 100 mm 225 mm. Diameter batang tulangan
memaniang berkisar atttat X2 mm dan 20 mm.

c2. Penulangan melintang.


Luas tulangan melintang (A) yang diperlukan

pada perkerasan beton


menerus dengan tr.rlangan dihitung menggunakan rumus 4.35.

Tulangan melintang direkomendasikan sebagai berikut:


- Diameter batang ulir tidak lebih kecil dari 1'2 mm.
- Jankmaksimum tulangan dari sumbu kesumbu 75 cm.

\'1rng sama seperti perhitungan tebal pelat

lll

beton semen pada peren clanEan

pcrkerasan beton semen baru yang sudah dijelaskan diatas.

Modulus reaksi perkerasan lama ft) diperoleh dengan melakukan


lrcngujian pembebanan pelat (pkte bearing tes) berdasxkan AASHTO r 222ttl pada perkerasan lzma yang selanjutnya dikorelasikan terhadap nilai CBR
(lihat Lampiran c-10). Bila nilai k >140 KPa/mm 0a kg/cm), maka nilai k
tcrsebut dianggap sama dengan 140 KPa/mm 0a kg/cm) dengan nilai
cBR 50%.

b.

Lapis tambah perkerasan beton semen diatas perkerasan beton


semen lama.

bl-

Pelapisan tambahan dengan lapis pemisah (unbounded atau


sepatated ovetlay)
Tebal lapis tambahan dihitung dengan mmus berikut ini:

T, = {(

r, -

c,.r"1

. (4.38.)

dimana:

T,
c3. Penempatan tulangan.
Penulangan melintang pada perkerasan beton semen harus
ditempatkan pada kedalaman > 65 mm dari permukaan (untuk tebal pelat <
20 cm dan maksimum sampai 1/3 tebal pelat (untuk tebal pelat > 20 cm).
Tuiangan arah memaniang dipasang diatas tulangan arah melintang.

Jalan

T
T"
C,

= tebal lapis tambahan


= tebal yang diperlukan berdasarkan beban rencana dan
daya dukung tanah dasar dan atau lapis pondasi bawah
dariialm lama sesuai prosedur diatas.
= tebal pelat lama (yang ada).
= koefisien yang menyatakan kondisi pelat lama yang

bernilai:
4.4.3.3.3. Perancangan Lapis Tambah pada Perkerasan Beton Semen.

C"
C"

Ada beberapa kondisi dimana diperlukan pelapisan tambah (ouerlEl


pada perkerasan beton semen yaitu:
a. Pelapisan tambahan perkerasan beton semen diatas perkerasan lentur.
b. Pelapisan tambahan perkerasan beton semen diatas perkerasan beton

C, =

semen lama.
c. Pelapisan tambahan perkerasan lentur diatas perkerasan beton semen.

^.

Lapis tambah perkerasan beton semen diatas perkerasan


beton aspal.

Penambahan lapis tambahan perkerasan beton semen diatas


perkerasan lentur dalam hal ini perkerasan beton aspal, dihitung dengan cara

kondisi struktur perkerasan lama masih baik.


perkerasan lama baru mengalami
retak awal pada sudut-sudut sambungan.
kondisi struktur perkerasan lama sudah rusak.

= 0,75 kondisi struktur

0,35

Tebal minimum lapis tambahan dengan lapis pemisah sebesar 150


mm.
Fungsi lapis pemisah untuk mencegah refleksi penyebaran retak
perkerasan lama ke lapis tambahan, yang biasanya terbuat dari beton
aspal dengan ketebalan minimum 3 cm. Letak dan jenis sambungan
serta penulangan pada lapisan tambah tidak perlu sama dengan yang
ada pada perkerasan lama. Penulangan pada lapis tambahan tidak
tergantung pada tulangan dan kondisi perkerasan lama.

{
l?i8 rlovlgG4Ut1&JwJ.rrl

BJ/(PC{

2:

PSR/tNoANq/AiNPERI4ERr't-SANJAL-AN

b2. Petapisan tambahan langsun g (dircct overlal)


Tebal lapis tambahan dihitung dengan rumus berikut ini:
T, = ',0{( T'3

- c,.T"'') .............

tebal laPis tambahan

tebal yang diperlukan berdasarkan beban fencana dan daya


dukung tanah dasar dan atza lapis pondasi bawah dafr. ialzn
Iama sesuai Prosedur diatas.

= tebal pelat lama.(yang ada).


C. = koefisien yang menyatakan keadaan struktur perkerasan lama
0,75 + 1.
yang bernilai
^ntaf^
Tebal minimum lapis tambahan ini sebesar 130 mm'
Letak sambungan pada lapis tambahan harus pada posisi yang sama
dengan letak sambrrrg* pada perkensan lzmz. Jenis sambungan dan
p..rilr.rgrn pada lapis tambahan tidak harus sama dengan ienis sambungan
irt, p.*rlrtgrtt prd, perkerasan lama' Perkerasan lamz yang mengalami
r.trk ,-^l (C.=0,2S) dapat diberi lapisan tambahan langsung bila
To

berdasarkan perhitungan lapis tambah an pada perkerasan lentur.

Dalam menentukan tebal ekivalen perkerasan beton semen, perlu


memperhatikan kondisi dan daya dukung lapis beton semen yzng ada.
Apabila lapisa;r-lapisan perkerasan telah diketahui dan kondisinya
diietapkan, kemrdi^n faktor konversi dipilih sesuai Larnpiran C-11, tebal
effektip dari setiap lapisan dapat ditentukan. Tebal effektip setiap lapisan
m.*prkm hasil perkali^t ^ntar tebal lapisan dan faktor konversi' Tebal
effekip untuk seluruh perkerasan merupakan iumlah kumulatif tebal
effektip dari masing-masing lapisan.
'I

...(4.40.)

dimana:

T,
T

=
=

tebal lapis tambahan


tebal yang dipedukan berdasarkan beban rencana

dan daya dukung tanah dasar dan atau lapis


pondasi bawah dan jzlan lama sesuai prosedur
diatas.

T"

tebal effektip perkerasan lama.

Tebal lapis tambahan perkerasan lenrur yang diletakkan langsung diatas


perkerasan beton semen, dianjurkan minimum 100 mm. Bila tebal lapisan
tambahan lebih dari 180 mm, strukrur lapis tambahan dapat menggunakan
lapis peredam retak (Gbr.4.1,2)

I
j
{
s

Lapis tambah petkerasan beton aspal diatas petketasan beton


semen larna.

Pedu ada evaluasi kembali mengenai kondisi struktuf perkerasan


beton lama supaya tebal effektifnya dapat dinilai sebagai aspal beton. Untuk
menenrukan iebal effektif (f) setiap lapis perkerasan yang ada harus
dikonversikan kedalam tebal ekivalen aspal beton sesuai dengan Tabel 4'19'
Dengan demikian tebal lapis tambahan y^tg diperlukan, dihitung

lgg

T-T...........

kerusakann ya dapat diPerbaiki.

c.

Jalon

Tebal lapisan tambahan dihitung dengan rumus berikut ini:

T, =
...(4.39.)

dimana:

T. =
T =

Meloda Perancangan Perkerasan

beton aspal sebagai lapis aus (l)


bcton aspal sebagai hpis perau (2)
beton aspal sebagai lapis peredam retak (3)
perkerasan beton semen lama(png ada)-(4)
tanah dasar (5)

Gbr.4.lZ. Lapis peredam retak pada pelapisan tambahan


perkerasan beton semen. (Sumber: pd.T -14-2003)

CONTOH SOAL

4.6.

RANCANGAN PERKERASAN BETON SEMEN


Rencanakan pelat beton perkerasan kaku, dengan kondisi

- ialan baru berupaialan tol(major freeway) dalam kota.


- lalu lintas 2ialur. terbagi atas 4lajur ( 4/2TB).
- UR = 25 tahun
- data lalu lintas haian ratl-rarta:
* mobil penumpang = 1995 kend./hari
* bus 8 ton
= 293kend./hri

,/

l10

t1onGarut<G;t

Et{tly. 2 : PERANCANqAN PERKER.A.SANJAI-4N

l,rJJrt
* truck
* truck
* truck
* truck

2 as- 6 ton(I(cl)=
2 as- '1,3 ton(Bs)=
3 as- 20 ton(fd)=

gandeng 5as-30t=
Pernrmbuhan lalin
=

Umur
-

CB\**0"",=

rencana

Metoda Perancangan Perkerasan Jalan

754kend./hri

Tabel Contoh Sod 4.6(1)

685 kend./hari
410 kend./hari

25kend./han
per-tahun
25 tahun
6%o

4,5oh.

Perkerasan beton semen mempunyai:


a). tipe BBTT b). tipe BBDT c). tipe

BMDT

dengan ketentuan :
- kuat tarik
=4,25IVIP, ( = 310 kg/cm2,silinder)
semen 72,5 cm
bawah=stabilisasi
- bahan pondasi
- mutu baia nrlangan
BJTU 32 (fr=tegangan leleh 3200kg/cm) untuk BMDT'
BJTU 24(fr=teganganleleh 2400 kglcml untuk BBDT'
- tanpa bahu jalan beton

lentur

pelat beton dan lapis pondasi bawah diberi lapis bound breaker
^ntara koefisien gesek p= 1,5
dengan

Perbiturgan:

Langkah

1.:

1. Nilai CBR =

4,5%o

Langkalr2z
2a).Menghitung jumlah konfigurasi beban sumbu untuk masing-masing
jenis kenda raan niaga dan

CATATAN: RD=roda depan, RB=roda belakang, RGD=roda gand."g dip""3cn=od"


gandeng belakang, BS=beban sumbu, JS=f umlah sumbu,STRT=sumbu tunggal roda
tunggal, STRG= sumbu tunggal roda ganda,STdRG=sumbu tandem roda ganda

JSKN,

2b).Menghitung jumlah sumbu kendaraan niaga (JSKN ) rencana.


JSKNuR = 365 XJSKNH X R dari (rumus 4-29.) darr
JSKNu*hi"= JSKN,*x C dari rumus (4.33.)
Untuk Umur Rencana 25 tahun, dengan i=6oh didapat R=54,9 (fabel
4.14) dan dalam hal ini , menurut Tabel 4.2. untuk 4laiut 2 anh, n:.Ial
C = 0,45
JSKNUR =365 x 3284x54,9 = 6,58 x 107
JSI${ uRr"i" = 6,58 x107 x 0,45 = 2,96 x 107.
2c).Menghitung iumlah repetisi kumulatif tiap kombinasi konfigurasi/beban
sumbu pada laiur rencana.

Langkah 3: Memilih tipe struktur perkerasan


a). Sifat dan ienis srruktur :
Menggunakan Ruji (Dowel)
Tanpa bahu beton
f.r= 4,25MPa
Lapis Pondasi bawah: stabilisasi semen l2,S cm.
CB&"run a"r", = 4r5o/o
CBR"u.uoo - 20oh ( dari Gbr.4.11)

F* = 1,2.

b).Jenis perkerasan:tipe BBTT,BBDT atau tipe BMDT.

tlt

T
142

?W1u. 2 : PERANoAN(ANPERKER,ASANJAL

Metoda Perancangan Perkerasan

Jolan

143

'@u6cttttlstMt4u
Tabel Contoh Soal

Sumbu rencana.

Pe
o/o

BEBAN
JENIS

SUMBU

SUMBU

BHBAN

PROFORSI

TERHADAP

SUMBU

JUMIdH
SUMBU

{torD

LAtU
LINTAS
RENCANA

YANG

(6)

(3)

(4)

(s)

STRT

435

0,13

0,66

2,96x107

2,54x1ff

135

443

0,66

296x1A7

4,49xi06

754

0,21

0,66

2,96x10r

4,49x106

586

0,1s

0,66

2,96x10?

3,51x106

0,23

0,66

2,96x10?

4,49x1ff

754

TOTAL
STRG

1,00

685

A,54

026

2,96x107

4,15x106

586

0A6

4,2{t

296xl(f

3,54x1ff

1.271

1.00

43s

1,00

0,08

2,96x.1U

2,31xl06

435

1,00

TOTAL
STdRG

14

TOTAL

ruii).
d). FRTsrRu= TErrr, = l'09 =o-zo

=gx(s)x(6)

3.264

KUMUIATIF

"ft

FRTrr*o=

'

- STRG

l'75

=0.+t

4*:'i.:.'
4'25
f.r

==

r.r,

ANALISTI FATIX

2,96x101
NIS

BEBAN
SUMBU

ToN&N)

BEBAN

BENCANA
PER.RODA
(kN)

REPETISI

YANG

lErJADl

*EPETI$1

IrN
(r)

IRT

didapat

a)

(3)

(4)

6(60)
s(50)
4(40)
3(30)

36,00
10,00

2,54x1 06

4.4}{106

IE=1,09

24,N

4l}{10F

FnI:036

18,0o

3,51xlS

FE-221

12,00

4.49*10

5{50)

15,00

3,54t106

14(r40)

27,lN

2J7x I tP

2@
I'RG

ANAIISA EROSI

ITAKTOR

TEGANGAN
DAN
ERt)sI

(s)

(6)

fi
TIT

T1

T'f

E(U0.)

FRT-0,4I
FE=488

TT

PE&strN

IUSAK
frt)
(7)3(a)x

100/(o

R"E,FETISI

IJIN

(E

PE[SEN
TI'EAK
(e6)

(q=(4)*
100/(8)

II

1T
.IT
.IT

TT

0
0
0

461

3J1106

,18

TT

4.6rlO{

51

0
0

FtT=0,34
FE=e9S

xl.2 = 36

= 9xr.2
4

e),0,9 dan h).


Gunakan Lampiran E-1 dengan masing-masing beban roda dan
masing-masing FRT untuk mendapatkan repetisi beban ijin(fatik).
Gunakan pula Lampiran E-2 (untuk kondisi tanpa bahu beton pada
analisa erosi untuk mendapatkan repetisi beban iiin (erosi).
t),),k). Lihat petunjuk pada kolom pada Tabel.

b) Beban Rencana per-roda:

- STRT

4'25

Tabel Contoh Soal4.6(3). Analisa Fatik dan Erosi.

Langkah 4: Menghitung Kekuatan Pelat Beton


a). Dengan data dari langkah 3 gunakan gambar grafik pada
Lampirao 2 s/dB dengan :
- Lalu Lintas dalam kotii. dengan ruii;f.t=4,25; F*r=1 ,2;

60

TErr^,

FRrsranc:

MtltI

CBR.rr.uor=2070 dan :'-petisi sumbu=2,96x107


pendekatan tebal perkerasan= 19,0 cm'

Gunakan Tabel pada Lampiran D.


- untuk kondisi tanpa bahu,tebal pelat 19 cm dan CBR
effektip = 20o/o masing-masing akan didapat untuk:

TErr*, = 1,09 TErr*" = 1,75 TErro*" = 7,45


FErro, = 1,82 FErr*" = 2,42 FErro*" = 2,48 (dengan

o)

(2)

c).

SUMBU

(1)

*1.2= 21......... dst.

REPETISI

TERJADI

TOTAL

140

- STdRG=

46I>I{XFl{

= 24 .........dst.

169>t$yt

CATATAN: TE=Tegangan Ekivalen,FRT=Faktor Rasio Tegangan,FE=Faktor Erosi, TT=tidak


terbatas.

T
14

rldltGqtltlE t ril./a$

BIAKIA 2 : PER.4NCAN6AN PERKER,QSAN JAL-qN

Metoda Perancangan Perkeroson

Jalan

lli

Sambungan susut melinang pada BBfi dipasang setiap jaruk 4


m, ambil5 m.
Gunakan untuk tebal pelat 200 mm ruii o 33 mm panjang 45 cm
dengan iarak 30 cm.

-:. 5

Persen rusak kedua analisa melebihi 7}}oh,iadt tebal 19 cm tidak memenuhi.


l-,akukan pengulangan perbitangaa nulai dari 4a lagi

Ambil tebal pelat 20 cm.


Tabel Contoh Soal4.6(4). Analisa Fatik dan Erosi(ulangan)
BEBAN
]ENIS
SUI!ffiU

BEBiTN
SI]MBU

REN'3NA
PER-

YANG

ToN(lN)

RODA

TEBJADI

A,EFEI'ISI

{kN)

FAI{fi)R
DAN
EROSI

(4)

(s)

(6)

'tl
TT
TT

0)

srltt

o(b$)

56,U0
30.00

2,54xlS

5(S)

4,49x1&

Tk1,0t

4fiq

24,00
18.00

4,49x1tr
3,51xlS

FET*0,24

3(30)

ST.IIRG

REPETISI

IJIN

{3)

51-l(G

ANALISAFATIK

/Ovl

,t21))

12.f'0

8@l

24,ffi

dl5*tF

5{50)

15,00

3J4st#

r4(14q

21.00

7.,I7xlDF

ANALISA BROSI

TEGANCAN
PEASEN

RUSAK
C/,)

c0

PEESEN

REPETISI

NUSAK
e/.)

I]IN
(8)

TT

TI
TT

TT

T831.62

lOxl$

4t'5

SJrlS

4t

Fl{T=0J8
fiF=? *1
TE=l,36

TT

t'T

TT

I0r10t

21

TT

1T

grXl'=e32

IiErL92
73<l0tr/o

41Jcl00P/o

TOTAL

sambungan pelaksanaan memanjang dipasang batang


pengikat memakai n_rlangan baja ulir diambil o20 mm, panjang
70 cm dengan iank7l cm.

0
0
0

FE=2iI

CATATAN: TE=Tegangan Ekivalen,FRT=Faktor Rasio Tegangan,FE=Faktor Erosi,. fi=tidak


terbatas.

Jadi tebal pelat beton 20 cm aldalah yang paling tipis dan Paling ekonomis
untuk kondisi sebagaiman yang ditentukan.
^

CONTOH SOAL 4.7.


PENUI-ANGAI{ PELAT PADA PERKERASAN BETON SEMEN
Rencanakan penulangan pelat beton untuk perkerasan beton semen
untuk tipe :
b). BBDT dan c). BMDT.
a). BBTI
dengan kondisi seperti contoh soal4.6.
Rangkuman data dengan ketentuan struktur pelat adalah sebagai berikut:

Soal b).

- Untuk BBDT pelat memerlukan penulangan memanjang dan


melintang.
Tulangan Memaniang.
- Tebal pelat beton 200 mm
- Lebar pelat = 4x3,5 m.(untuk 4lajw tanpa median).
- Panjang pelat untuk kategori bersambung(BBDT atau BMDT)
variasi 8 -15 m, disini ambil 15 m.
- Koefisien gesekan dengan lapis pemecah lekatan (bound
breake) dengan p= 1,5
- Untuk baja BJTU 24,kaat tarik leleh fr=240 MPa, kuat tarik ijin
f,= 0,6 x f, =0,6 x 240 = 144,0 MPa.
- Berat Isi Beton - 2400kg/*'.
- Gnirtasi g - 9,87 m/det2.
- Gunakan rumus 4.35.
A,*"' = p.Ltlv!.s.h- 1,5'15'0'2i00i,81.0,20 :

2f"

A."

Soal a).

Untuk BBTI pelat tidak dinrlangi secara struktur,

hanya

dipasangi ruji dan batang pengikat.

- Tebal pelat beton 200 mm


- kbar pelat
= 4x3,5

m.(untuk 4laiur tanpa median)

dia.3i nm.

- Untuk

={4)x100/(8)
0

0
0
0
0

116

batangpolos

lt]

2.144

367,9 mm,f m, lebar.

= 0,74o/o x luas pelat ( SNI'91)


= 0,0014.200.1000 - 280 mm'/m' lebar < A,o""o.
Gunakan nrlangan o 12 - 300 mm , A" = 377 mmrfm,
lebx>367,9

I
Itfr xou6t44rl6J tr'424it

Bwll[ 2 : PERANoANqAN

PERKERASANJAL,4N

Metoda Perancangan Perkerasan Jalan

Tulansan Mclintanrr.

Tulangan Melintang.
v-r, p.L.M g.h 1,5'l 4,0'2400'9,81'0,20
.

4,0.2400.9,8 I .0,20

2f.

2.144

= 3 43,3 5 mm, f m, lebar.

A.''' = 280 mm2/m'lebar.


Gunakan tulangan o 12 mm- 300 mm (A. =377 mmz).
Pengecekan iarak teoritis antar retakan.
Dengan mengpnakan rumus 4.37:

lebar>343,35

Hasil tulangan memaniang dan melintang hampir sama, sehingga


dapat digunakan tulangan polos anyaman las (wire mesh) buiut
sangkar.Hal ini dapat dimengerti karena elemen pelat beton hampir
buiur sangkar yaiat T4 m x 15 m.
Gunakan wire mesh s 1.0 - 200 mm ' A, = 393 mm'f m'
lebat(melintang maupun memani a n$> 343,35 ata:u 367,9.

L., =

.f

",'

n.p'.u.-fu(e .,.8"

a=4/d=4/1,6=2,5

dengan

- -f,,)

p - 20,1.1/ (100x20) = 0,0101


Ambil fo= (1,97{ f,)/d = (1,97 I 31,0)/1.,6 = 21.,68kg/cm2.
Ambil e" = 400 x 10-6.
E. = 14g50{ f.', = 14950 ./ ato = 267.461kg/cm2.

Soal c).

Untuk BMDT pelat memerlukan penulangan memaniang dan

melintang dengan ketentuan:


Tulangan Memaniang.
- Tebal pelat beton 200 mm
- Lebar pelat = 4 x 3,5 m.(untuk 4laiur tanpa median).
- Panjang pelat untuk kategori bersambung(BBDT atau BMDT)
variasi 8 -15 m, disini ambil 15 m.
- Koefisien gesekan dengan lapis pemecah lekatan (boand
breaker) dengan P= 1,5.
- Kuat tekan beton (f.) = 310 kg/cm2(silinder).
- E,/8. = 6 (Iabel 4.20.).
- fr = 4,25 MPa. Ambil {,=0,50.f,, = 0,5'4,25 MPa=2,1'25
MPz.=21.,25kg/cmz.
- Untuk baja BJTU 32,ktattarik leleh fr=320 MPa=3200 kg/cm''
- Sambungan susut dipasang setiap iarakT5 cm.
- Ruji digunakan o 33 mm, panjang 45 cm daniarak 30 cm.
Gunakan rumus 4.36 :
p, = 100.L(1.3-0,2p) = 100'21,25(1.3--q'?'1,5) = (J.10n,,
3200-6'21'25
f , -n'f",
x
20
A,n'."" - o,7oo x 1oo
= L4 crnzA.*t" = 0,600 x 100 x 20 = 1,2 cmz< A,P"'t".
Diameter tulangan arntaira12 mm -i 20 mm, ambil 16 mm.
+
Jarakantar tulangan afltaLra 100 mm 225 mm.
Gunakan tulangan o 16 mm- 100 mm ( A, =20,11 cm2).

1,5 . I

[,v-t = tt. L :4. g.h -

I = 3 43,3 5 mmz f m' leb,o.


"s
2-144
,f,
A.'t' = 280 mmz /m' lebar a A,0""'
Gunakan tulangan o 1,2 320 mm ---) A, = 354 mm2fm'

147

21,252

L,,=
6.O,OLO

.2,5.2 1,68(400. I 0 -u .261 .461

- 2t,25

= 16334cm<
)

L..-"u'=250 cm. ok!

CONTOH SOAL

4.8.

PELAPISAN TAMBAH(OYERI-AY) PADA

PERKERASAN

BETON SEMEN.

l.

Lapis tambah perketasan beton semen diatas perkerasan beton


semen lama.

Contoh soal4.8.a:
Jalanlama perkerasan beton semen mempuflyai tebal 18 cm (I)
Hasil plate bearing test mendapatkan k = 15 kg/cm3.
Kuat tarik lentur {, = 3,50 MPa (35 kg/cm')
Datalalu lintas seperti soal4.6.

Tentukan:
a). Lapis tambah dengan lapis pemisah,bila keadaan perkerasan lama secara
struktural dalam keadaan rusak ( C=0,35).
b). Lapis tambah langsung pelat beton baru mengalami retak awal (C=0,75).
Jawab:

a).Tebal lapis beton semen yang diperiukan


seperti pada rancangan perkerasan beton baru.

(I)

dilakukan dengan cara

T
l4E

Nilai

Metoda Perancangan Perkerasan Jalan

Ew<t z 'PER^NoAN.^NPEeKERASANJAL^N

t@nGGfnt<ettr1J,41t

berani lebih tresar dari 14 kgl-crrf, maka nilai k


dengan k = 14 kglcm' dengr.fl oilai cBtrtrd*P=50/o.

k= t5 k&/cnf

dianggap sama
Asumsikan tebal pelat beton lepis

tmbah

cm.

BEBAN
RENCANA

JENTS

SUMBU

PER,

TON(kN)

RODA

SUMBU

FAKTOR
REPETISl

clengan diketahui, tebal lapis pelat beton yang diperlukan

a)

ANALISA EROSI

YANG

DAN
BROSI

(kN)

(1)

ANAUSA FATIK

cm

TE,GANGAN
REPETISI

TERIADI

(3)

(4)

(5)

UIN

(6)

l)#tuk

1 = r.ar/1 1.1,a _ C..T"r,)

abel Contoh Soal4.8a(1). Analisa Fatik dan Erosi.


BEBAN

r' = 15 cm'
menghittrng tebel lepis teobah yang dipetlutan digunatan rumus

Diasbil tebal laPis tambah

PERSEN

NEPETISl

C.=0,35.
sehingga T, =',n rl {17''o-O,lS. 1t S;',
Diambil tebal lapis tambah 14 cm.

(/")

UIN

(s)

6(60)

BFAAN

(e)
BEBAN

=(4)x100/(6)

5(5o)
4(40)
3(3o)

STRG

36pO
30,00

T'r

7.54x1U
4,+9x106

74,M

4F9x106

18,00

3J1r1tr

TE-1,03

rT

0
0

3,8X108

SUMBU
SUMBU

1T

TT

Fr.=2,32

TT

TT

'rT

TT

RENCANA

2Qa)

12,00

8{80)

2490

tl5xlff

TE=1,57

TT

3,9x107

t(),64

s(s0)

15.00

3,54x1ff

FRT=0J7

rr

TT

TON(IN]

PER,
RODA

Fr\K4()ft
REPETISI

21,00

2,37xl06

TE=1,26

1T

2x10E

DAN

En.)st

rJrN

PETSEN
NUSAK

ch)

(a

STNT

6(6E

36,00

454x1tr

5(s0)

3op0

4lqulff

24,N

4,4lxl#

(q

N,EPEI'ISI

TERJADI

0)

4(40)

14Oil0)

,ANALISAFAIIK

ANAI.ISAEROST

YANG

(LN)

FF.,I92
STdRG

cm>T" minimum= 1 3 cm

TEOANG,4N

a_66

mT=0.24

4,49x10r

cm,T"=15

Tabel Contoh Soal4.8a(2). Analisa Fatik dan Erosi.

f.4)

JENIS
ST'RT

= 1 3,26

'1.7

PERSEN

NUSAK

RUSAK

T=

(439e9)

3,51x1&

f)=

NEPBN9I

rlrN

?Ef,STN
TUSAK

f/",

{9

(4x100/(6)

TT

o,9xr0E

as?

TE=r,r,

T?

7110s

nfii

FRT=0,{

TT

TT

FE=440

1T

1T

TT

(5)

{6)

3(30)

18,00

2@)

laoo

8(80)

z4fio

4rIi1s

Tt.l,8l

TT

l,9xiO?

2l,u

5{s0)

r5,0o

3J4xiS

FRT=O37

1?

1?

rr

&.rs

030

1,18

{,49rIS

TT

FRT=OJO
STf,G

FE=a97

TOTAL

0<1Off/o

12,48<10ff/o
FE=3,01

CATATAN: TE=Tegangan Ekivalen,FRT=Faktor Rasio Tegangan,FE=Faktor Erosi, TT=tidak

Asamsikan tebal pekt 17,0

r4(r40)

STdRG

terbatas.

T. = {(

T'-

c,.T"1
dengan diketahui T"=18 cm. C, =0,35
maka didapat:
T. = { 117'-0,35(18)'z} ='1.3,25 cm < 15 cm.

TE=1,46

PE=3.08

Setelah dicoba dengan asumsi tebal pelat beton 16 cm, jumlah prosentase

kerusakan akibat fatik dan erosi lebih kecil dari l00oh.


Tebal lapis tambah yang diperlukan, dihitung dengan mengpnakan rumus
4.38.

2,31xlU

mT=oJo

crz.

faktor erosi lebih besar dari 700oh, sehingga diambil tebal pelat 17
cm.Karena bila dilihat Tabel Contoh Soal 4.8a.(2) diatas prosentase

21,00

Tr}TAT-

0<10y/,

25#<lcf/.

q
l5A XOUGt4ll?1e

^,4JrAn

E,(/!y. 2 : PERANoANqAN

PERKERASANJAT'4N

scrnen larna.
,.-i.rI.toh Soal4.8b:

Dilictahui

n$ncqnfien B0ilAn

Susunan perkerasan beton semen lama:


* tebal pelat beton semen 18 cm

?anahnqsfltc

* tebal pondasi bawah 12 cm,stabilisasi semen PI--7oh


* CBR tanah dasar 4,5oh
Kondisi perkerasan lama sudah retak,tidak ratz dan terjadi
fracture (potongan-potongan pelat 7 - 4 m2,sudah selesai
diperbaiki).

0A4n

Data lalu lintas sebagaimana Conqoh 4.3. tahun pembukaan

alam proses peranc ng

201,5.

perkerasan jalan merupakan bagian yang diutamakan

tebal
Jawab: Dari perhitungan Contoh 4.3 khusus untuk Overlaydidapat
lapis tambah total = 33 cm(f).
Tebal effektip perkerasan lama:
Tebal effektip pelat beton asPal
= 18 x 0,70 = 12,6 cm.
Tebal effektip pondasi bawah
= 12 x 0.30 = 3.6 cm.
76,2 cm.
lama
Tebal effektip perkerasan
Tebal perkerasan beton asPal yang diperlukan,dihitung dengan
rumus 4.40.
T. = T - T"- 33 - 16,2 = 16,8 cmlT-,r^.-=10 cm.

ialan, bahan

didalam pertimbangan analisis

Diminta : Tebal lapis tambah perkerasan beton aspal diatas perkerasan


beton semen.

pert.u, irS2rl

p^rametet

pefancangan,karena salah satu pafametef kekuatan konstruksi ialan, tedetak


pada pemilihan y^flg tepat dari material yang akan digunakan didalam suatu
r ncar,g fl perkerasan ialan.

Material yang utama didalam bahan perkerasan lentur terdiri dari

bahan:

TANAH

1..

yang umumnya dominan pada elemen pefkerasan tanah


dasar (subgrade) dan elemen bahu ialan; dan dapat pula digunakan
pada elemen lapis pondasi bawah (subbase),umumnya dalam hal
penggunaan metoda pelaksanaan stabilisasi,ataupun pada struktur
perkerasan dengan berbasis low cost mad Qalan dengan biaya rendah).

2.

PASIR digunakan situasional,misalnya sebagai material terpilih


untuk lapis pondasi bawah,atau sebagai bahan utama perkerasan
untuk fungsi drainase (sebagai fungsi filter pada drainase bawah
perinukaan,seperti subdmin, bahan fi.ltrase pada badan ialm dalam
situasi muka ar tanah yarrg tinggi),lapis penutup sesudah
penghamparan beberapa jenis lapis permukaan,bahan tambahan
suatu campuran aspal hotmix . Difungsikan juga sebagai bahan
utama pada struktur perkerasan kaku,sebagai bahan dasar
pembetonan.

ry
Rancangan BahanPerkerasan

152

lalan

3. AGREGAT PECAH (CRUSHED AGREGATE)

sangat

dominan pada elemen pefkefasan lentur,sebagai material lapis


pondasi atas, lapis Pondasi bawah,lapis permukaan, bahu yang
diperkeras/berpenutup,konstruksi pelebaran ialanJuga sebagai
bahan baku utama perkerasan kaku.

sebagai material lapis resap pengikat (pine coafl, laprs


pengikat/perekat (tack coal) dan material pengikat (bonding agenl
bahan campuran perkerasan beraspal.

4. ASPAL

5.1. BAHAN TANAH


o PERSYARATANBAHANTANAH
Tanah dasar (Subgrade) akan selalu meniadi pondasi dari suatu
perkerasan apakah stfuktur lentur atau struktur kaku. Tanth dasar ini dapat
t.*p, batuan keras,batuan lunak atau tanah. Batuan keras atau batuan
lunak biasanya secufe- teknis tidak memerlukan suatu pemilihafl ^tzu
perbaikan kekuatan material yang berarti. Hanya barangkali dari segi
pengerjaan yang relatif lebih sulit dari tanah. Yang lebih memerlukan
perhatian adalah subgrade yang terbentuk dari tanah'
Ada 3 kondisi yang akan ditemui dilapangan untuk penyiapan tanah
dasar, yaitu:
- kondisi tanah asli
- tanah dasar berasal dari timbunan,atau
- anah dasar berasd dari hasil galian.
Ketiga kondisi ini akan memberikan Penanganan pelaksanaan yang berbeda
satu sama lain. Untuk kondisi tanah asli,pemilihznhatya pada lokasi yang

memberikan jenis tanah yang men),umbangkan kekuatan yang memenuhi


pefsyafatan konstruksi tanah berasal dari timbunan disamping pemilihan
tersebut diatas,fuga perlu ditiniau kembang susut tanah (swelling),masa
konsolidasidan bila dua hal tersebut sudah dipenuhi,adasatu hal lagi,yaitu
pemadatan.Sedangkan untuk Anah dasar berupa hasil galiandisamping
pemilihan ienis tanah yang memadai,harus iuga muncul pertimbangan lain
yaitu pertimbangan kelongsoran. Apapun yang akan dihadapi di lapangan
para pelaksana tentu harus punya pertimbangan teknis (engineeringlilgenmfi
awaldalam menghadapi pekeriaan tanah.

Pada Mekanika Tanah sudah banyak dipelafari tentang Pengklassifikasi-an berbagai macam tanah. Melaniutkan ini untuk tiniauan
Konstruksi Jalan ztda, beberapa aspek yang menfadi perhatian khusus untuk
pelaksanaan konstruksi ialan yaitu:

xovr6cqilt<qt

74t4yt

By"ky. 2: PER,4No,+NqANPER-KER,4SANJ,4L N

l5S

\
nilai CBR.
potensi kembang susut (swelling),
sifat mengalirkan air (drainase),dan
tingkat kepadatan.
kapileritas (penting untuk tanah ekspansip)

Pada Lampiran A-1. menunjukkan pendekatan dari CAA (Civil


Aeronautics Administration) dari USA,yang dapat dijadikan referensi untuk
pemilihan ienis tanah subgrade,base dan subbase,dalam ttnja,an
cBR,mengacu pada sistem Klassifikasi cassagrande. Syarat cBR minimum
untuk tanah dasar yang umum bedaku adalah cBR=5. Pada Lampiran A-2.
merupakan pengembangan dari I(lassifikasi cassagrande,yang menunjukkan
pendekatan mengenai rating subgrade,potensi kembang susut, drainase dan
tingkat kepadatan yang mungkin dicapai.Swelling index untuk tanah dasar
biasanya diambil maksimum 3%0.

5.1.1. BAHAN TANAH UNTUK TANAH DASAR

(Subgrade ).

Fungsi kekuatan dinyatakan dalam angka CBR.


Pendekatan nilai sebagaimanaTabel 5.1.

5.1.2. BAHAN TANAH UNTUK I.APIS PONDASI BAWAI{


dan BAHU
Secara umum karakteristik tanah untuk Lapis Pondasi Bawah
ftila
digunakan tanah campur pasir) dan bahu hampir sama.
Sifat utama seperti Indeks Plastis berkisar 4-10 danlolos saringan

No.20O,maksimum 207o.

Tabel5.1. Pindekatan kekuatan CBR


CBR
TANAH
Soaked
IENIS
Unsoaked
Lempung
Lanau
Pasir

10+

10+
20+

Kerikil

60+

80

Tanah agregat

100+

130+

gradasi baik

xon6tfl4N6a74t4n

Rancangan Bahan Perkerasan lalan

154

ButKlz.

2 : PEe,{NCAN(ANPER]<ER^.SANJAL N

155

',('rnen dan abu kapur. Masing-masing harus dicermati sifat absorbsi

Tabel5.2. Sifat IJmum bahan tanah untuk Lapis

(pcnyerapan) aspal.

Pondasi Bawah dan Bahu.


CBR
Soaked
Unsoaked
IENIS TANAH
25
35
Pasir kelanauan berkerikil
30
50
Pasir kerikilan
30+
15+30
Laterit

b. Klassifikasi berdasarkan dimensi butiran.


Berdasarkan ukuran besar butiran dibedakan sebagai agregat kasar,
tlcngan ukuran butiran ) 1/+ inct (6,35 mm) yaitu bahan yang tertahan
'':rringan no.4 dan agregat ha/as,bahan yang lolos saringan no.4 dan tertahan
1,:rcla saringan no. 200 (0,075 mm). Yang lolos saringan no. 200

rliliategorikan sebagai abu batu. Secara spesifik dimensi butiran,pasir


t

5.2.

PASIR.

t.

Dapat berupa pasir sungai,pasir laut atau pasir vulkanis,de ngznsyar^t


yang harus dipenuhi sebagai bahan perkerasan.
Pasir dengan gradasi baik,dapat digunakan sebagai lapis pondasi
bawah,terutamablla tata salir (filnr) diperlukan untuk drainase.
Kadangkala digunakan sebagai lapis antan tanah dasar yang lunak
dengan lapis pondasi bawah.

2.
3.
4.

Sebagai bahan pencampur hot-mix, terutama pasir

halus

sampaisedang yang bersih,dibatasi maksimum 30o/o total campuran

5.3. BAI{AN

t'rmasuk

^gregat

5.3.1.1. Agregat

o
1).

halus.

berbutir kasar.

Sifat- sifat

berbutir kasar.
^gregzt
Kekuatan dan I(eawetan

Agregat adalah merupakan elemen perkerasan jalan yang


rrrempunyai kandungan 90-95o/o acvan berat,dan 75-85o/o acuan volume dari
liomposisi perkerasan,sehing3a otomatis menl'umbangkan faktor kekuatan
rrrama dalam perkerasan jalan. Berfungsi sebagai penstabil mekanis,agregat

lrarus mempunyai suatu kekuatan dan kekerasan,untuk menghindarkan


rcrjadinya kerusakan akibat beban lalu lintas.

AGREGAT

5.3.1. KLASSIFIKASI AGREGAT


a. Klassifikasi berdasarkan sumber bahan (resoutce)

Berdasarkan didapatkannya bahan,agregat terdiri dait agreg t


alamdan agregat baatan. Agregat alam diperoleh secara alamiah dialam
ini,dengan sedikit pengolahan,seperti pasir dan kerikil. Agregat alam dapat
ditemukan dialam terbuka diistilahkan sebagai pitrandan diambil dari sungai
yang memedukan
disebut sebagai bankrun. Agregat buatan adalah
^gregat
pfoses pemecahan batu dengan alat pemecah batu (stone crusber),:unttk
dijadikan material yang memenuhi syarat sebagai bahan petkerasan ialan.
Bermacam-m^cam ukuran butir dari hasilan pemecahan batu ini sesuai
dengan kebutuhan gradasi komponen perkerasan. Residu dari hasil
pemecahan berupa abu batu yang dapat digunakan sebagai bahan filler
t dan aspal tersebut.
(material pengisi) campuran dari bahan-bahan
^greg
Sumber lain bahan filler berasal dari produksi semen dan kapur,berupa abu

Sifat kekuatan dan keawetan dipengaruhi oleh

- gradasi,

- kompak dan keras (toughness),


- ukuran maksimum,
- kadar lempung,
- bentuk butir, dan
- tekstur permukaan.
Gradasi seragam (unrform graded)dati komposisi butiran,akan
rnenghasilkan suatu kepadatan y^ng bervariasi akibat kontak butir
sebagian,sedang stabilitas tergantung pada sifat penyekatan (confined).
Gradasi buk (we//gradea),memberikan suatu keadaan kepadatan dan
stabilitas yang baik akibat kontak butir yang hampir menyeluruh pada
l>idang permukaan.

Gradasi ielek (poor graded),kondisi yang terburuk karena kontak butir


buruk mengakibatk an kepadatan rendah dan stabilitas kecil.

Untuk mengukur kekompakan dan kekerasan diukur dengan ASTM


D3 dengan persy^rzta;n minimum 3;dan kehil^ngan berat didekati dengan

T
Rancangan Bahan Perkerasan Jalan

156

angka abrasi y^ng diperoleh dari hasil Los Angeles Abrasion test.
Indikasinya bila abrasi memberikan keausan lebih dari S}'h,agtegat
dinyatakan tidak baik untuk dijadikan bahan perkerasan jalan.
Elemen perkerasan terdiri dari komposisi butiran yang terdistribusi
dari ukuran besar sampai kecil. Sehingga brlamana ada ukuran butiran
melebihi tebal lapisan ada sebagian permukaan yang tidak akan terselimuti
oleh aspal. Hal ini dibatasi dengan persyaratan ukuran maksimum
^gregat
'/, a 1./3 dari tebal lapisan,atau bila dibalik tebal lapisan diambil 2 a 3 dai
diameter butir maksimum.
Pada dasarny^ agregat kasar,harus bersih dan bebas dari lempung,
lumpur,debu dll.Maksimum kandungafl bagian lunak adalah 5o/o. Sedangkan
untuk agregat halus,bahan yang lolos no. 40 (0,4 mm) harus terdiri dai
matett:^l non-plas ti s.

Bentuk butir sebenarny^ sarrgat menentukan kekuatan selain gladasi,


kekompakan dan kekerasan. Bentuk butir bisa bundar, lonjong, kubus,
pipih, atau bahkan tidak beraturan. Bentuk yang bundar relattf kurang stabil
dibandingkan permukaan dengan bidang patah. Prosentase agreg t yang
tertahan no. 4, minimum mempunyai 40o/o ag;egat,paling tidak mempunyai
satu bidang patahf pecah lurus.

Tekstur permukaan penting diperhatikan,dalam hal ikatan adhesi


t dan aspal.Tekstur yang licin dan kasat sebenarnya mudah
^ntara ^greg
untuk ditempeli lapis tipis aspal,namun adhesinya kecil untuk
mempertahankan lapis film tersebut. Jadi makin kasar tekstur,makin besar
stabilitas dan ketahanan perkeras an ialan.

ii).

NO?t6C4Ut<61

.)4J.4U

Btak'u.

2 : PERANCAN(AN PER-KERASANJALAN I57

Pada permukaan agreg t,teflrtalm dari Lgteg t alam,akibat


lrngkungannya,bisa terlapisi oleh bahan lain seperti,minyak,oksida,gipsum,air
lrcrlebih,tanah dan lain-lain.Yang jelas akan mengganggu pengikatan aspal
licpada agregat,sehingga adalah mudak untuk membersihkan permukaan
:rgregat, untuk menyingkirkan substansi bahan tersebut.
5.3.1.2. Agregat

berbutir halus.

Agregat berbutir halus,adal)h bahan yang lewat sadngan no.4 dan


tcrtahan saringan no. 20O,biasanya berupa pasir murni,hasil screening dari
rnesin pemecah batu,atau kombinasi dari keduanya.
Agregat halus harus bersih,keras,tahan lama,bebas dari lumpur,dan
lrahan organis. Butiran yang lewat saringan no. 4O,harus non-plastis,atau
rnempunyai nilai plastisitas yang masih dalam batas toleransi.
Tidak ada nlai batas gradasi untuk bahan berbutir halus,kecuali
lrahwa bahan yang lolos saringan 200,agar tahanlama dan campuran mudah
,likerjakan, memenuhi ketentuan dibawah ini:

Tabel. 5.3. Petsyara;tatt Agregat Flalus


JENIS AGREGAT BERBUTIR
HALUS

% LOLOS SARINGAN

Pasir murni

Max

Hasil Screening batu kapur

2OO

SYo

MaxZ}ok
Max 15Yo

Hasil Screening batuan lain

I(emudahan melekatnya aspal pada agregat, dipengaruhi

oleh:

ienis agteg t,
porositas, dan
mateial yang melapisi permukaan.
Makin bervariasinya jenis batuan agregat,makin bervariasi pula berat
jenis yang dipunyai bahan,sedemikian sehingga menentukan proporsi desain
campuran yang direncznakan. Batu apung yang ringan misalnya,mempunyai
stabilitas yang sangat rendah.

Porositas tidak terlalu berpengaruh terhadap adhesi agreg t d^n


aspal, tapi lebih kepada kuantitas aspal yang akan diserap oleh agregat.
t,berarti makin banyak kadar aspal yang akan terserap,
Makin poreus
^greg
sehingga makin boros penggunaan aspal didalam suatu campuran.

Bila pasir berasal dan sumber

alam,kehilangan soundness pada

rnaterial yang tetahan pada saringan no. 50 adaJah

< 1,5o/o.

Bila pasir yang mengandung g r^m dari sumber di pantai,diyakini


ridak mengganggu campuran,bzhzn tersebut dapat dipakai.

5.3.1.3.

Mineral

filler
\

Mineral filler,adalah
halus yang lolos saringan no. 20O,berupa
abu (dust). Abu kapur atau^greg^t
abu semen diyakini dapat memperbaiki adhesi
aspal dan agreg t.
^ntafa
Untuk persyaratan mineral filler,apakah abu kapur
^t^u
lainnya,gunakan tabel berikut ini.

T
Rancongan Bahan Perkerasan Jalan

t58

Tabel

5.4. Persyaratatr

KADARAIR

MAX 1%

SIFATUMUM

TIDAKADA
% LOLOS SARINGAN

Gradasi

0,6
0,15
0-074

100
90 * r00
70 - 100

2 : PERANCANqAN PER-KERASANJALAN

159

Pitch, berbentuk asphaltites

(keras).

- Bercampur dengan mineral:

* Buton Aspal,berbentuk padat


*Trinidad Lake Asphalt,berbentuk cair.

xRock

Asphlt (Eropa dan Amerika),padat.

Aspal

Misal : Agregat A digunakan untuk rekonstruksi memenuhi CBR


>80%.Agregat B digunakan untuk bahu dengan CBR > 600/0
b) Campuran Hot-Mix :
Contoh:
ATBL, ATB, HRS, AC menggunakan kurang lebih 70% Aggregat.
c). Lapis permukaan Qihat sub-bab 5.9):

Misal:

Burtu - Agregat batu pecah,satu ukuran 10


Burda - Lapis bawah ukuran 13 mm
Lapis atas ukuran 6,25 mm

dalzm istilah baku asphaltic bitumen,terdiri dari unsur


utama + 80% dalam keadaan kolloid disebut
arphaltene bercampur dalam cairan yang disebut maltene,Hidrogen (H) + 10%
sisanya unsur S (sulfur),membentuk berbagai persenyawaan hidrokarbon.
Aspal dihasilkan dari minyak bumi,melalui proses destilasi residue oil. Bahan
bensin,solar,minyak tanah merupakan hasil destilasi pada temperatur yang

^t^\
carbon (C),sebagai komponen

a). Digunakznpada lapis pondasi atas,pelebaraniz.l^n dan bahu

13 mm

Setiap minyak bumi menghasilkan residu,yang terdiri dari bahan aspal yaflg
berbeda,antanlain:
- bahan dasar aspal (asphaltic crude oil),
- bahan dasar paraftn (parafin base crude oil),
- bahan dasar campuran (mixed base crude oil).

t pada Gbr.S. 1

Aspal yang digunakan untuk perkerasan jalan berasal dari bahan

5.4.7. PENJELASAN UMUM


Aspal zdalah bahan alam dengan komponen kimia utama
hidrokarbon, hasil explorasi dengan wzrfla hitam bersifat plastis hingga
cair,tidak larut dalam larutan asam encer dan alkah atau air,tapi larut
sebagian besar dalam aether, CS, bensol,dan chloroform.

Aspal yang digunakan untuk bahan perkerasan ialan,terdtt beberapa


jenis, yaitu:

Alam : Aspal gunung (Rock Asphalt)y{.spal

berbeda.

Secara diagramatis dapat diliha

5.4. BAHAN ASPAL

- Aspal

Byl(.,I

5.4.2. SIFAT DASAR ASPAL

PENGGUNAAN BAHAN AGREGAT

. AGREGAT PECAH

74t4u

*Gilsonite,Granhamite,Glance

Mineral Filler

GUMPAI-AN PARTIKE.L
BUKAAN SARINGAN ( mm )

5.3.2.

t<ou6G4utlsit

Danau (Lake

Asphalt)
- Aspal Buatan : Aspal minyak,TetQarang dipakai sebagai bahan
perkerasan,karena cepat mengeras).
Kedua macam aspal terdapat dalzm keadaan :
- Murni atau hampir murni :
*Bermuda Lake Asphalt,berbentuk cair.

dasar aspal. Fungsi pada perkerasan lalan,adalah:


- sebagai bahan pengikat. dengan butiran

^ggregat,
sebagai bahan pengisi,mengisi rongga antar butir dan pori-pori
itu sendiri.

^gfegat

s.4.3. JENrS ASPAI


i). Aspal Minyak ( Petroleum Asphalt ).
Berbentuk padat atau semi-padat sebagai cikal-bakal bitumen,yang
diperoleh dari penirisan minyak.
Aspal Minyak dibedakan menjadi :
a). Aspal lGtas-panas (Asphaltic-Cement/,C).
Aspal ini berbentuk padat pada temperatur ruangan. Di Indonesia

T
Rancangan Bahan Perkerasqn Jalan

160

xotl6cqr,rt<sJMJ,A%
- Jenis

sc

B^'.^ 2: .ERAN'ANqAN.'RKERA.ANJAL,+N

16l

(Slow curing): Bahan peflgeflcer solar dengan SCn sampai

SCo.

t,ATATAN:
+

LOW BOILING
DESTILLATES

( PETROLEUM

aiprlnLrrc

') AC 60/70 berarti bahwa pada percobaan penetrasi dengan jarum, menggunakan beban
,,19.
s."-, pada temperarrr 25" c(77on setelah 5 menit, ian:m penetrasi rurun zntaru 60 x

cm.

tt,01 cm dan 70 x 0,01


I
+ +)
Semakin besar indeks, semakin banyak mengandung aspal, dan semakin kental.

srruueru

MALTENE

ASPHALTENE

c). Aspal emrzlsl( Emulsion Asphalt )


Disediakan dalam benruk emulsi, dapat digunakan dalam keadaan
rlingin.

I
NITROGEN BASE + ACIDAFIT

| ""i?""11

.t

pnnnrrru

Gbr.5.1. Diagram Jenis Aspal.

l)ibcdakan dua jenis emulsi;


- kationik ( aspal emulsi asam ), emulsi bermuatan arus listrik
positip.
- anionik ( aspal emulsi alkali ), emulsi bermuatan arus listrik
negatip.
llcrdasarkan bahan emulsifier ditambah air, dibedakan :
- Tipe RS ( rapid setring ) RS,
'
- Tipe MS ( medium setting)
: MS, sampai MSr.
- Tipe SS ( slow setting ) : SS,

ii).
aspal semen, dibedakan dari nilai penetrasinya,misal :
40/ 50,60/70,85-100x)

AC dengan penetrasi

Aspal dengan penetrasi rendah digunakan didaerah cuac panas


^ta:u
lalulintas dengan volume tinggi,sedangkan aspal dengan penetrasi tirgg,
digunakan di tempat bercuaca dingin atau lalu lintas dengan volume rendah.

b). Aspal dingin-catu(Cut-back Asphalt).


Aspal ini digunakan dalam keadaan cair dan dingin. Aspal dingrn
adalah campuran pabrik zntair aspal panas dengan bahan pengencer dari
hasil penyulingan minyak bumi. Berdasarkan bahan pengencer dan
kemudahan menguap,bahan pelarutnya,aspal dingin dibedakan meniadi:
- Jenis RC $.apid Curing) : Bahan pengencer bensin dengan RCo
sampai RCr.**)

Jenis

MC (NIedium Curing): Bahan.

fterosene) dengan MCo sampai MCr.

pengencer minyak tanah

Aspal Batu Buton.

Aspal ini merupakan aspal alam,yangterladi karena adanya minyak


l>umi yang mengalir keluar melalui retak-retak kulit bumi. Setelah minyak
rnenguap, maka tinggal aspal yang melekat pada batuafl y^ng dilalui. Kadar
aspal pada Aspal Batu Buton berkisar
lOoh +25oh
^flt^ra
Sebagai bahan pelunak biasanya dtgnakanflux
oil, sebanyak 3% - 4oh berat
total campuran.
5.4.4.

PENGGUNAAN ASPAL

a). Prime-Coat : aspal cutback 80 - 100 pen dapat MC atau RC


b) Tack-coat : aspal cutback 80 -100 pen M- atau Rc,atau emulsi
c). ATBL : 80 -100 pen

d).

e)

ATB
HRS

: 80 +100 pen,ukuran butir


: 80 +100 pen.

maksimum 25 + 3g mm

q
Rancangan Bahan Perkerasan Jalan

162

5.5.1. SIFAT CAMPURAN


aspal'ada beberapa kondisi

dengan
-iti^di,dicampurkan
^ggregat
pttt"Lu^t'

akan diselimuti
y^ito
^grcg^t
umum yaflg ,ttu"
Demikian pula dengan rongga
aspal,diikuti dengan po'i-poti ugg:ts:t
aspal' N11un baik pori-pori
diantan butiran ^gregllt akan tensi
selalu terisi penuh oleh
aggregaLmaupun rongga diantara.'gg"g^t'tidaklogis makin
pasti terisi"oleh udara. Adalah
aspal,ada bagian tersisl-yang
dan pori- yang"terisi oleh aspal'
banyak kadar aspal,-^ttin U1"yg .ru3'g
r"nui yang tidak diingtnkan,misalnya
selama partikel oi^i air.ri-,rt
af,sorbsi masih dalam batas
lempung, atau 'ot'!f^c.,ktiP bersih'atau
rcq g dengan
kadar aspal yang digunzkan akan
toleransi, iumlah "oilit't
baik.
empat syarat' yartu
Campuran yang baik, harus memenuhi
1)' Stabititas tinggi'
- 2)' Durabilitas lama'
,. Flexibilitas cukuP' danresistance'
4) Tahan terhadap skid
5.5.1.1.

Stabittas'

padz

kekuatan

yang berarti'
lintas,tanpa pt*f,J"t
-ge, deformasi
saling mengunci (interlocking)'yan8
kekuatal
., ^r^u
tahanan t.rhadap
aspal' Stabilitas
lekatan y"ng disoribangkan oleh
dipunyai bahan
^grigrt,a11
tt'k"'ii t'to sama lain dengan
akan teriaga rctap tittgg bilamana 'g'?g't
banyak bidang

harus ?rkondisikan Zttf'

adanya

lain'yang sudah disebutkan diatas'


pecah,kekasaran,gradasi dan syar^t-sy.^rat
r"ira., tir,8gi,ki...,a akan menyebabkan

stabilitas'il;;;-j;#"
lintas'
mudah ,"[-t akibat beban lalu
perkerasan -.r1#-Llo,d-m
dengan
tedalu rendah'karena deformasi akan
Demikian

iog'

2 : PERANCAN(AN PEI'KER,+S.+NJAL-+N

163

desintegrasi akibat beban lalu lintas. Tiniauannya men)adi luas,karena bisa


berarti'tahwa perkerasan harus bertahan selama umuf fencana. Ini aftlnya
dengan adznya rentang waktu sekian lama,akan teiadi perubahan lingkungan
lain iuaca,kadir zirdegradasi bahan ataupun beban yang semakin

^rtiru
bertambah.

Banyak cakupan yang akan terjadi,misalnya bila volume rongga


antar butir kurang,berakitat kadar aspal kurang,sehingga ikatan aspal mudah
tedepas; bisa )uga akibat ini aspal yang menyelimuti permukaan agfegat tipis
,r.rg *..rg"kibat film aspal tidak lagi kedap air,hingga oksidasi mudah
t.4r'ai. Bisa iuga akibat betan hlu lintas yang semakin meningkat,akan lebih
memampatkan posisi agregat,sehingga aspal yang berada didalam fongga
muntah keluar,yang disebut bkedingDengan demikian agar perkerasan dapat berumur lama,maka desain
campufall haros mendapatkan kadar aspal yang cukup untuk melindungi
,.l.rrrh partikel uggrrg^id^n iuga dapat mengisi rongga butir secukupnya
sesuai desain. Aggt"gat dilindungi iuga terhadap masuknya ar pori tanah
atau akibat intrusi dari permukaan,yaitu dengan mengisi fongga dengan
aspal secukupnya. Jang^i iug^ aspal kebanyakan karena dengan tebalnya
film aspal,berakibar seolah-olah aggregat mengaPung didalam aspal,sehingga
tzhanaigeser tidak mungkin teriadi lagl,atau seperti diatas teriadi bleeding"

5.5.1.3. Fleksibilitas (Kelenturan).

terkait
Pengertian stabilitas'kurang lebih
terhadap beban lalu
bertahan
struktur,yaitu bagumzna - perkerasan
Intr da^ri stabilitas adalah

baik. lni

B,(L<LI

Durabilitas adalah tolok ukur ketahanan perkerasan terhadap

5.5. CAMPURAN BITUMEN

Bllamarra

xotlctSut<GJ 74J,4tt

iangan

agar ai.".ouit
repetisi yang dilakukan oleh kendaraan'

mudahnya ..rirail ii;i_litas

5.5.1.2. Durabilitas ( Keawetan )'

r., dengan beban lalu lintas dan

Fleksibilitas perkeras.an adalah berupa kemampuan bahan untuk


mengikuti deformasi permukaan dan turunannya kebawah,tanpa teriadi
keretakan akibat perubahan volume.
Untuk mendapatkan fleksibilitas yang tinggi,dapat dilakukan dengan
cafa menggunakan campufafl agregert open graded,atau bergradasi seniang.
Dari sisi penggunaan aspal,gunakan aspal yan1 lunak berarti yang
mempunyai ,"gf., p"rr"t rri tingp;i,atau peflggunaan -ka-d-ar aspal yang lebih
tinggi,tapi *"rih dalam batas belum akan teriadi bleeding. Sayangnya
p"igg""r^" material open graded, bertolak belakang dengan kekuatan yang
m.rl-erl.rkrn angka kepadatan yang tinggi,sehingga dipe4ukan kehati-hatian
dalam memilih desain camPuran.
5.5.1.4. Skid Resistance ( Kekesatan terhadap Slip )

mengakibatkan slip adalah


perkerasan yang sodah mengalami bleeding,dan akibat aggfegat sendiri.

Dua faktor y^ng paling banyak

I
xon6c4wGt'74J.4fi

Rancangan Bahan Perkerusan Jalan

lM

Faktor pertama sudah ielas,karena bleeding menyebabkan jzlan meniadi


licin;faktor kedua adalah baik aggregat halus maupun kasar padz dasztnya
mempunyai kecenderungan mempunyai sifat tidak tedalu tahan tefhadap

BylKy. 2 : PERANCAN(ANPER.KER,4.SANJAL,4N l6E

Standar penerrasi tersebut adalah diakibatkan oleh beban 100 gram yang
dibetikan pada jarum selama 5 detik,pada kondisi temperatur 25" c. Sketsa
peralatan dapat dilihat pada Gbr.5.2.

pemolesan permukaan akibat melajunya kecepatan kendaraan. Apalagi bila


yang muncul ke permukaan izlan, misalnya akibat
ada bagran

^ggregat
terkelupasnya lapis permukaan, atau bisa saia akibat ukuran aggregat
maksimum tedampaui.
Kekesatan dapat dipertit gg dengan menggunakan kadar aspal yang
tepat sehingga tidak teriadi bleeding,menggunakan ^ggreg t dengan
dengan bentuk kubus
permukaan kasar,menggunakan
^t^n
^ggtegat
cukup'
kasar
yang
komposisi prosefltase aggregat
Metoda,kritena dan prosedur f^nc ngan campufafl akan dibahas
pada sub-bab tersendiri.

5.6

PEMERIKSAAN BAHAN PERKERASAN JAI.AN LENTUR

Disini haaya akan dibahas pemefiksaan bahan pefkefasan lentur


saja, terutama untuk pemefiksaan yang dianggap cukup penting,didalam
kepentingan :ranczflgan perkefasan ialan. Adapun Pemefiksaan untuk

perkerasan bahan pefkefasan kaku,tidak dibahas,karena umumnya sama


dengan pemefiksaan yang dilakukan pada penguiizn bahan beton,yang
sudah banyak diketahui dan dipaparkan di buku-buku I(onstruksi Beton.

5.6.7. BAHAN ASPAL


Cukup banyak pemeriksaan laboratorium yang memefiksa sifat-sifat
aspal untuk perkerasan ialan.Beberapa pemeriksaan dibahas berikut ini.
5.6.1.1.Penguiian Penerasi Bahan-bahan Bitumen.
Secara lengkap dapat

iIi

ha t pada

SNI-06-245

6 -199

Pengujian Penetrasi dimaksudkan untuk

mengukur
kekerasan/ kelunakan aspal denga fl Pfa;syafat teftentu. Hasil test berupa i arak
sepefsepuluh centimeter,dari sebuah iarum standar penetfasi,masuk secafa
vertikal pada suatu contoh kecil aspal,yang ditemPatkan pada wadah tepat
dibawah iarum tersebut.

Gbr.S.3. Penguiian Titik Lembek

5.6.7.2.P eneuiian

Gbr.5.2.Penguiian Penetrasi

Titik Lembek Aspal

Secara lengkap dapat dilihat pada SNI-06- 2434_1991


Bahan aspal tidak mempunyai titik leleh tetap,sebagaiman a bahan
lain,tapi karcna mempunyai stadium transisi d,art c,t,r ke padat, terdapat
variasi temperatur.umumnya makin ti.gg, titik lembek aspai,makin rendah
variabil-itasnya.Metodanya sendiri dikenal sebagai metoda i.bola-cincin,'(ring
and balldilustrasikan pada Gbr.5.3. Air dalam tabung dipanaskan d".rgri
dipertahankan pada temperatur tidak melebihi 56" c
rer,dan 111; c
""t"t pefiamz..
untuk aspal,dengan kecepatan pemanasan 0,5"C/ tiga menit

Temperatur dibaca dari thermometer,sesaat sesudah aspal atatr ter


menyentuh dasar pelat,dibawah cincin.
5.6.1.3. Penguiian D

aktilitas.

Secara lengkap dapat diliha

pada SNI-06-243 2-1991

'T
Xorl6a4l,lt1&t

Rancangan Bahan Perkerasan Jalan

lffi

Pengujian ini akan mendapatkan paniang aspal


(dalam cm), yang dapat ditarik sampai menielang
putus dengan kecepatan 5 cm/menit, pada suhu 25"
-; yut g merupakan indikator dari kuat adhesi dan
elastisitas dari aspal. Aspal dengan daktilitas yang
tinggi,akan mengikat aggregat lebih baik,namun
-^ki.r baik daktilitas,makin besar dipengaruhi oleh
tempefztuf.
5.6.1.4. Penguiian

I)cngetesan dengan

BqKq 2 : PERANoAN(,4N PER-KeRASANJAL.4N

t^g open cup,hampir sama dengan cleveland ,hanya

5.6.2. BAHAN AGREGAT.


5.6.2.1. Penguiian Abtasi Los Angeles.
Secara lengkap dapat dilihat pada

SNI- 03-2417_1991.
Alat yang digunakan berupa mesin abrasi Los Angeles (Gbr.5.6).

I)idalam silinder baja tersebut,terdapat bora-bola baia @ 4,6g cm,berat


190 gram- 445 gram. Benda uji yang telah diketahui beratnya, dimasukkan
kedalam

atatTagop,."c"i;

open cup

+ - rdklra
6btd Edir d

(Gbt.5.5b.)

F&pLir|eF

rc*rpdul.-ffi
'
-...t{!9titi

Gbr.5.5.a).Cleveland dan
Tag OPen CuP

IemdhsJh
lFr*|enH
SKTEF

n6
rFd
pcgFIF

- l-bdao
thEla6ffiEtr2
ha-trrrb!&

*#^'e

"

/.1.

{..
t--

Penguiian dimaksudkan untuk menentukan


pada suhu benpa aspal mulai menyala dan
terbakar, sehingga batas zm n bilamana
aspal dipanaskan dapat diketahui.

Titik nyala adalah batas tempefatuf Pemanasan, dimana tedihat nyala api
singkat kurang dari 5 detik,pada suatu titik dipermukaan aspal,bilarnafll
didekati api.

adalzh suhu pada saat tedihat nyala sekurang-kurangnla 5


detik,pada suatu titik dipermukaan aspal
Material aspal pada c^w^n dipanasi langsung dengan zpi,yada suhu dangan
kenaikan yang^konstan. Paia interval teftentu,cawan didekati dengan api

Titik bakar

kecil

lain untuk pengetesan nyala.. Temperatur terendah dimana api


menyebabkrr, -rrrr..rlnya uap diatas permukaan aspal
menyala kurang dari 5 detik,disebut titik nyala yang dicarl

mesin,
diputar
dengan kecepatan 3033 rpm selama 500
atau 1000 putaran.
Hasil pemutaran,
bahan
disaring
dengan saringan no.
12 dan bagSan yang
tertahan dicuci,
dikeringkan dan
ditimbang. I(eausan
adalah prosentase
selisih berat bahan
sebelum dan sesudah
percobaan.

kemudian

ffi

SNI03-6722-zooz(dengan
SlLt;,1'"guiian
Pada material ienis aspal cut-back tipe slow
curing,penguiian dilakukan dengan alat cleaeland uPetx caP (Gbr.5.5a.),sedang
untu[ tipe medium dan rapid curing O'IC dan RC )'karena lebih cepat
meriguap,digpnakan tag

167

rrspal ditanrh didalam^l^t


gelas kaca

Titik Nyala dan Titik Bakar'

Secara lengkap dapat dilihat pada SNI-062433-1991.(dengan alat Cleveland Open Cup dan

74J4rl

test

cat dan mulai

Gbr.5.6.Abrasion Test

5.6.2.2. Penguiian Kelekatan Agregat Terhadap Aspal


Secara lengkap dapatdilihat pada SNI-O 3-243g-1ggl.
Iielekatan Agregat terhadap aspal adalah prosentase luas permukaan agregat
vang terselimuti aspal,terhadap keseluruhan permukaan.

l]enda uji adalah


t yang lolos saringan 9,5 mm
^greg
saringan
6,3
mm
(1/+
" ).
lrada

(3/g " ) dan tertahan

l]enda uji dimasukkan kedalam wadah, kemudian wadah diisi dengan aspal
vang sudah dipanaskan pada suhu sesuai standar. Setelah bahan diaduk,
ivadah dimasukkan kedalam oven suhu 60" c selama 2
iam. Setelah

q
Rancangan Bahan Perkerasan Jalan

168

dikeluarkan dari oven, dinginkan dan kemudian masukkan kedalam gelas


kimia berisi air suling, dan diamkan selama 18 iam.
Perkirakan prosefltase luas permukaan yang masih terselimuti aspal. Hasil
pengujian dinyatakan dalam prosen lebih atau kurang dari95oh.

xou6c4uxet74J4il

Bt Kt 2 : PERANCAN(AN PEIaKER. SAN-JAL N

160

Secara lengkap dapat dilihat pada SNI-06-2489-1991.

I)engujian Marshall dikembangkan

oleh US. Army Corps of

5.6.2.3. Keawetan (Soundness).

Maksud dari test ini adalah untuk mengetahui ketahanan aggregzt.


terhadap pengaruh cuaca.

Media kimiawi yang dipakzi adalah Sodium atau Magnesium Sulfat.,untuk


menguji ketahanan aryreg t tersebut.
Pada test, agregat halus disaring melewati saringan 9,5 mm,kemudian
diambil benda uji masing-masing 100 gr. dengan variasi ukuran sbb.:
no.16;tertahzn
Tertahan No. 50,lolos no.30;Tertahan No.30, lolos 3h
.
no.16,lolos No.8;tertahan no.8,lolos no.4; tertahan no.4,lolos
benda uii
dibuang,variasi
No.4
lewat
saringan
kasar,yang
Pada test aggfegat
adalah:
3/+ ",lolos L
''/'
Tertahan 1 1/z ",\olos 21/z ",diambil 3000 gram;tertah^n
3/+
dan
gram
1000
"
diambil
",lolos
3/8
",diambil 1500 gram;tefiahan
tertahan No.4,lolos 3f 8 " diambil 300 gram.
Secara terpisah semua benda uji, direndzm dalam latutan sodium atau
magnesium sulfat, selama 16 - 18 iam. Kemudian keringkan benda uii dalam
oven sampai berat tetap. Ulangi untuk setiap benda uii,selama 5 kali. Benda
uii kemudian didinginkan,dicuci dan dikeringkan sampai berat tetap didalam
oven dengan suhu 110" c. Saring benda uii dengan saringan yang sama
seperti awal percobaan.
Prosentase kehilangan berat dihitung terhadap masing-masing berat semula,
sehingga didapatkan pfosentase total kehilangan berat aggteg^t halus dan
^ggfegat

kasar.

llngineers,bertujuan untuk memeriksa dan menentukan stabilitas campuran


lrgregat dan aspal,terhadap kelelehan plastis (flow). Flow didefinisikan sebagai

perubahan deformasi arau regangan suatu campuran mulai dari taipa


beban, sampai beban maksimum,dinyatakan dalam millimeter atau 0,01".
Benda uji (campur^n agreg t dan aspal ) dibentuk dengan cara menumbuk
campuran didalam cetakan (molS berbentuk silinder dengan diameter 10 cm
clan tinggi 7,5 cm. Penumbuk ftammer) yang digunakan mempunyai berat

4,536 kg00 pound) dan tinggi jatuh 45,7 cm(18"). Jumlah pukulan
tergantung pada beban tencana lalu lintas misalnya untuk lalu lintas ringan

35x, sedang 50x dan berat 75x. Setelah dibiarkan 24 ja',,, dalam suhu ruang,
rendam benda uji dalam bak atau dipanaskan dalam oven selam a 2 jam
clengan suhu tetap 60" c,dan letakkan pada segmen bawah kepala penekan

dari alzt Marshall (Gbr.5.7.). Sebelum pembebanan diberikan kepala

CATATAN.
Pemeriksaan bahan perkerasan kaku,tidak dibahas secara spesifik didalam buku ini.
Pemeriksaan ini meliputi pemeriksaan bahan semen,air,dan agregat, yang pada

dasarnya sama dengan pemeriksaan standar yang baku dibedakukan untuk


sedikit dibahas di sub-bab 5-6.2- dtatas.
konstruksi beton. Pemeriksaan
^gregat

5.7.
.

Gbr.5.7. Penguiian Marshall

PEMERIKSAAN BAHAN CAMPURAN ASPAL


Penguiian Campuran Aspal dengan alat Marshall-

uji dinaikkan hingga menyentuh alas cincin penguji.


lJerikan pembebanan dengan kecepatan tetap 50 mm/menit, sampai
lrembebanan maksimum tercapai,atau pembebanan menurun ."p.iti
clitunjukkan oleh jarum adoJi bacadan catat pembebanan maksimum yang
tercapai.(Stabilitas Marshall), dan catat pula nilai kelelehan (Flow)yang
rlitunjukkan jarum arloji kelelehan.Yaitu nilai regangan dalam unit 0,01 inci
tcrjadi diantara kondisi tanpa beban dan beban maksimum.pedu dicatat
l>ahwa selang waktu dair saat benda uji diangkat dari bak rendaman,sampar
penekan beserta benda

q
Rancangan Bahan Perkerasun Jalan

170

didapatkan angka beban maksimum,tidak boleh melebihi 30 detik. Contoh


sesudah direndam 24iam diperiksa pula berat ienis dan void'
Dari proses persiapan benda uii sampai pemefiksaan dengan alat
Marshall,akan diperoleh data-data:
a).Kadar Aspal.
b). Berat Volume.
.). Stabilitas.Angka stabilitas menuniukkan kekuatan dan ketahanan
terhadap alur (ru tti n!.
d). I(elelehan plastis (flow).Flow merupakan indikator perkerasan terhadap
lentur
e). \flM,pefsen rongga dalam campuran. VIM merupakan indikator dari
durabilitas,kemungkinan bleeding.
prosen rongga terhadap aggregat,VMA dan \llM merupakan
\'NdA,
0.
indikator durabilitas.
g). Hasil bagi Marshall (kuosien Marshall, merupakan hasil bagi stabilitas
dan flow. Merupakan indikator kelenturan terhadap keretakan'
h). Penyerapan aspal. Memberikan gambaranberapa kadar aspal effektip.
r) Tebal film aspal. Merupakan petunjuk durabilitas campuran
i). I(adar aspal effektip.

Contoh hasil pengujian Marshall ditunjukkan pada Gbr. Contoh Soal 5.6.,
yaitu:

- Hubungan
- Hubungan
- Hubungan
- Hubungan
- Hubungan

kadar
kadar
kadar
kadar
kadar

aspal
aspal
aspal
aspal
aspal

terhadap
terhadap
terhadap
terhadap
terhadap

(%o) dengan VMA (%).


campuran (%), dengan VFA.(o/o)
camPutan (o/o) dengan berat isi.
campuran(o/o) dengan stabilitas.
campuran (%) dengan Flow.

campuran

BI,tKt( 2 : PERANCAN(AN PER.KER-4.SANJAL-4N I7I

NOltt4l,ltl&l ML/4U

l)alam bentuk paling sederhanaJOB MIX terdiri dari dua bagqan.


Bagian pertama adalah gradasi
t hasil blending dari dua fraksi
^greg
batuan atau lebih.
Bagian kedua adalah berapa jumlah kadar aspal yang akan digunakan
clidalam campuran.
Setiap blending agregat akan memberikan porsi kadar aspal yang berbeda.
oampuran hasilan blending
plus aspal harus mengikuti spesifikasi
"gregat
yang disyaratkan.
Umumnya karakteristik perkerasan seperti kekuatan,kepadatan,keawetan
clan tekstur akan sangat tergantung pada gradasi agregat yang harus
clikontrol/dikendalikan dalam pelaksanaan.
5.8.1.

BLENDING.

i. Cara Coba-coba(Taksiran)

I3lending adalah proses trial dv en'or\coba-coba). coba kita lihat contoh


berikut.

Langkah pertama dari prosedur adalah meneliti data, Maksudnya adalah


kita memedukan analisa gradasi untuk setiap material yzng akan
diblendingJuga batas gradasi dari spesifikasi y^ng harus dilihat dari
dokumen kontrak atau
lainnya.
^cuafl
Spesifikasi untuk gradasi
selalu memberikan baras atas dan bawah dari
persyaratan.Blending dari job mix harus masuk dalam enaelope$otak batas)
batas atas dan bawah ini.
^ntara

a rel 5.5.

VlM,VMA,VFA,Stabilitas,Flow,Stabilitas/Flow cari y^ng


memenuhi syaf t dengan menggabungkan grzfrk diatas dengan kriteria

Dari nitai

BATAS BAWAH

80
65

8
16

pefencanaan.

Kadar aspal optimum,ditentukan dengan cara menggabungkan nilai-nilai


tersebut,sehingga didapat suatu selang kadar aspal yang memenuhi syaratsy^f t tersebut. I(adar aspal optimum dapat diambil sebagai nilai tengah dari

30

4A
2A

50

100

3
2

2AO

selang tersebut.

Contoh: Spesifikasi.

NO.SARINGAN
3/8"

BATAS ATAS
100
100

100
80

65
40
20
10

Catatan: Pada metoda cara Brna Marga ditambahkan relasi antara kadar aspal tehadap
campurafl (u/o) dengan Stabilitas/Flow @{arshall quotient).

Pada No..sartngan 4 prosen passing ant^ra 80 dan 10O;No.saringan 16


40 dan 60 demikian seterusnya.

5.8.

Langkah kedua adalah memilih nilai target untuk kombinasi agregat.Awal


percobaan nilai target yang diambil dapat batas tengah dari limit spesifikasi

^ntzlra

JOB MIX DESIGN (DESATN CAMPURAN).


Apa

itu JoB MIx?

ll2

Rancangan Bqhan Perkerasan Jalan

xo%6ttr14x6,J

yang diberikan.Pada kenyataanny^ l<lta dapat memakai nilai lain berdasarkan


pengalaman, j enis agreg at dan problem y ang ada.
Berikut pada Tabel 5.6. adalah nilai target yang diambil.

Tabel5.6. Nilai
NO.SARINGAN

BATAS BAWAH

BATAS ATAS

NILAITARGET
100

80

100
100

100
80
65

83
60

4A

23

3/8',

T abel 5.7.t. L)ata masins-mas


NO.SARINGAN

AGREGAT

3/9"
8

100
90
30

16

8B

30
50

J
I

41

100

0
0

kombin asl
s0

6s

16

40

30
50

20
7

100

20

12

200

10

42

BLt|(l^ 2. PER^NoANqANPERKER^.SANJAL N

tr4t4t1

200

AGREGAT
100

r00
100

32
24
10

l,imit gradasi menurut Spesifikasi dalam I(ontrak adalah:

T abel5.7.b. Batas Spesifikasi CamDuran


No.4
Hasil akhir nilai target kombinasi

Pada saringan

tengah tersebut.

angka 90 adalah batas tengah antara 80 dan 100.

^gregat

NO.SARINGAN

mungkin tidak akan pada batas

Langkah ketiga adalah membuat 'taksiran logis' untuk proporsi

setiap

t dalam campuran.
^greg
t dicampur kita bisa menaksir Agregat 1
Sebagai contoh jika dua
^greg
sebanyak 30o/o dan Agregat 2 sebanyak 70%.I(ombinasi agregat adalah hasil
campufan dengan proporsi tersebut.
Langkah keempat adalah menghitung gradasi yang menghasilkan material
dengan proporsi sesuai taksiran logis diatas.

Langkah tetakhir adalah membandingkan hasil dari perhitungan

3/8"

100

80-100
65-100
40-80
20-65

8
L6

30
50

SPESIFIKASI

7-40

100

3-2A

2AA

2-1"0

l-angkah kedua: Pilih nilai t^rgetkombinasi agregat.

dengan

nilai target.
Jika nilai perhitungan blending mendekati nilai target berarti kita selesai
memecahkan persoalan blending.Kita akan tahu berapa proporsi masingmasing mateial.
Tapi bila hasilnya tidak mendekati atau malah keluar dari nilai target,maka
kita harus mengulang taksiran logis lainnya. Seyogyanya taksiran logis kedua
harus mendekati target karena kita akan tahu dimana sebaiknya taksiran
kedua dibuat,berdasarkan hasil taksirzn pefiarna. Mungkin taksiran akan
dilakukan berkali-kali sampai betul-betul nilai target didekati se-dekatdekatnya.

Langkah pertama dapatkan data dan masukkan dalam Tabel. 5.7.a./b/c.

Tabel 5.7.c. Nilai T


NO.SARINGAN
NII*AI TARGET

3/8"

100

90

83

1{}

60

3A

43

50

24

100

t2

zAO

[-angkah ketiga.
I)agaimana kita menebak taksiran logis?

l7l

NOvr6CWr<6A

Rancangan Bahan Perkerasan Jalan

174

Dalam menebak kita harus beranya'berapa banyak agregt 1 danagregat


yang dipedukan?'
Dalam contoh ini ambil saia dulu angka 50oh agtegat 1 dan50oh^gregat2.
Langkah keempat menghitung hasil taksiran sbb.:

takslfan Ca
abel 5.8. a. ProDorsr taksi
sO%AGREGAT 2
5O%AGREGAT 1
NO.SARINGAN

3/8"

50

45

8
16

15

50
50

BAKL 2 : PERANCAN(,AN PER-KERASANJALAN

74J4%

l)engan demikian kita harus menggunakan lebih banyak material 2.(karena


material 2 lebih halus) dan lebih sedikit mateial l..
l)apat kita lihat bahwa %o passing no.S dan 16 hampir semua berasal dari
,\gregat2.
Untuk meningkatkan o/o passing no.8 berarti kita harus banyak
rnenggunak an agregat 2.
Jadi untuk taksiran

logis kedua, kita coba 70oh agregat2 dan30o/o agregatl..

Tabel5.9
.y.L.Taksira
,-akslfan DfoDorsli kecluaked
No.Sarinsan

31ahfuEreEat

3,5

s0
44

3/8"

30

30

1.5

20.5

27

70
70

50
100

0,5

L6

21

70

12

1,6

2.1

61,6

200

30

0"9

28,7

50

0,3
0
0

22,4

Langkah terakhir adalah mengkombinasikan kedua


menambahkan kedua proporsi
^greg^t
ntlat target

agregat,yaitu
meniadi satu dan bandingkan dengan

100

240

rsi taksira n.
Tabel5.8.b. Kombi nas I dari
NILAI
sO%AGRHGAT 1+
SPESIFIKASI
NO.SARTNGAN
TARGET
50% AGREGAT 2

I(ombinasi kedua

3/8"

No.Saringan

100
95
65

Jt-

47,5
22
1.6,5

t6
30
50

12

100

200

5--E

CrT-r

ok
hampit sama

100
90
83

60

43
24
't1
6

100

6s-100
40-80
20-65

7-44
3-20
2-10

t2

o/o fuaksi harus naik .lni berarti


tefnyata mengindikasikan hampir semua
kombinasi 50-50 terlalu dekat dengan batas bawah. Jadi kita perlukan
perbaikan agar sedikit naik keatas.
Artinya material tedalu kasar,kita pedu menambahkan material halus.

^greg

7}o/aLsresat2

16.8

70

sesuai Tabel 5.9.b.:

Tabel 5.9.b. Kombinasi taksiran kedua.

B0-100

Indikasikan tanda panah kebawah untuk kebutuhan angka turun dan tanda
panah naik untuk kebutuhan prosen matetnl naik(seperti diatas)
Dari pengamatan hasil kita ambil kesimpulan bahwa dengan 50o/o agtegatl.
dan 50o/o agteg

175

TAoh

3/8"

Awesat?

100
97

91

t6

63.7

30

29,6

100

22.7
16,8

200

7 hampir sama

50

NIt"tl

30YoAgregat 1+

SPECS

TARGET

rl

{-l

f]-

100

100

90

80-100
65-100
40-80
20-65

B3

60

"+

T_ 24

12
6

7-40
3-20
2-10

Sekarang kita malah mendapatkan materta,l yang halus (mendekati batas


atas). Tanda panah menunjukkan kita mendapatkan nilai lebih besar dari
txget lebih banyak dari yang nilai lebih kecil dari target.(empat tanda panah
kebawah dan 2 tanda panah keatas, 1 angka hampir mendekati target).
Lakukan taksiran ketiga dangan 35oh agregat 1 dan 65oh agregat 2didapat:

Roncangan Bahan Perkerasan Jalan

176

NOU6G4W$J14J.4n

B\KL 2 : PER.4NC,4N(AN PER_KER-4.S,4NJAL_AN

177

I- aKslfan oan hasil kombitnasl ke


Tabel5.10.. Taksi

NO.
SARINGAN

AGREGAT

3/8"

35

65%

35%

AGREGAT

KOMBINASI

TARGET

SPECS

65

100

100

100

3t"5

65

96.5

{-t

10.5

65

l6

2.45
1.05

51.20
26.65

59-65 hamoir samd

30

27-7A

-43

80-100
65-100
40-s0
20-65

50

0.35

20.80

21.15

'24

7-4A

t2

3-20
2-10

I)icari proporsi blending bila diminta terpenuhinyabatas tengah spesifikasi.

100

15.60

1s,6

200

6,5

6,5 hampir sama

90
-dJ
60

{-L

awab:

- Langkah pertama pelalari kondisi kedua agreg t. Agregat rnana y^ng


palling menlrumbang material untuk suatu ukuransaringan. Dalam hal ini
pilih saringan no.76 dimana agregat 2 akan meny.umbang proporsi besar
trnruk agregat 1.
Selanjutnya hitung o/o-agregat 2 harus ditambahkan agar passing no.16
mencapai 7oh @atas tengah 4/1,0).

Ini

adalah blending yang paling baik dari ketiga percobaan,hampir


mendekati posisi ditengah envelop.

Persamaan (5.2.):

. P-A 60-7
b=_=_=0-654
B-A 88-7

Cara coba-coba taksiran ini dapat dilakukan juga untuk kombinasi 3


agregat,hanya proses menjadi agak panjang(identik dengan contoh dua
zgreg t diatas).
Ukuran

Berikut ini c r^ blending dengan menggunakan

. P-A

formula

A-B

syzra;t

t2

^greg
spesifikasi

sebagaimana Tabel Contoh Soal (5.1),sama dengan Tabel 5.7.b.

No.B

No.16

No.30

No.50

No.100

No.200

70/e0

s0/70

35/sA

18/29

8/16

4/10

0,35
20,93

100

80/1oo

34-6

3t.14

10"38

2,42

r.04

65,4ohfuEresat2

65.4

65.4

65-4

57,55

26.81

15,70

TotaI

100

96.54

75.78

59.97

27.85

21,28

15.70

TARGET

100

90

83

60

43

24

12

6,54
6.54
6

Hasil proporsi agregat dengan cara coba-coba matematis memberikan


34,60/0 agregatl dan 65,40/0
t 2. Tidak berbeda jauh dengan
^gaeg
perhitungan cata coba-coba taksiran.

Persamaan dasar untuk mengkombinasikan aga agregat adalah:


P=Aa+Bb+Cc
(s.4.)
dalam hal ini a*btc -1
(5.s.)
Penyelesaiannya lebih komplek dari kombinasi dengan dua agregat.Tapi

dengan pengamatan data yang bersesuaian dapat disederhanakan menjadi


seperti kondisi kombinasi dua agegat.

abel Contoh Soal (5.


No,4

No.8

No,16

No.30

No.50

20/65

No.100

No.200

3/20

2/10

0
24

Sarinp"an

Syarat
Snesi6kasi

100

80/100

65/104

40/80

Acresat

100

90

30

100

100

100

88

41

32

No.4

2. I(ombinasi Tiga agregat

5.1.

untuk mendapatkan campuran yang memenuhi

Astesat2

/a"

P_B

.........(s.2.)

B_A

Misalkan suatu agregat tunggal 1 akan di-blending dengan

% PASSING
Ukuran
3/8"

Spesifikasi
34,6ohAsremt1,

S1'arat

matematis,yang dianjurkan oleh Asphalt Institute (sebagai catatan sebaiknya


carairi tidak dikombinasikan untuk caraBrna Marga 1988).
Persamaan dasar untuk mengkombinasikan dua agregat adalah:
P = Aa - Bb
................. (5.1.)
karena a*b =1,maka a -- 1-b.Substitusi persamaan ini ke persamaan 5.L.
mendapatkan:

CONTOH SOAL

1- 0,654= 0,346

Sarinoan

.Kombinasi Dua zsreE^t

h=-

'/o PASSING

ii. Cara Coba-coba(A4atematis)


1

/40

10

CONTOH SOAL

5.2.

1
Rancangan Bahan Perkerasan Jalan

178

xo%.attut16,1

Misalkan suatu mineral filler C akan di-blending dengan Agregat A dan


Agregat B untuk mendapatkan campufan yang memenuhi syzfat spesifikasi
sebagaimana Tabel Contoh Soal (5.2.)
dan proporsi blending bila diminta terpenuhinya batas tengah

Ukuran
Syarat

0-47x B

Tabel Contoh Soal (5.2.

0,30x C
"2,

3/ 4*

Ukuran

PaSSmc

3/8"

No.4

No.8

No.30

No.50

No.100

No.200

50/7A

3slso

18/29

t3/23

8/ 16

4/1,0

,,16

a)

1.2

3/4"

r/2"

3/8"

100

80/ 100

70/eo

179

%PASSING
No.4
No.8

No.30

No,50

No.100

No.200

s0/7a

35/54

18/29

t3/23

8/ t6

4/10

0-6
4.3

Sarinpan

Spesifikasi
0,50x A

spesifikasi.

B\Kq 2 ; PER-ANCAN4AN PELKER,4.SANJAL-AN

ML/4t

Total

50

45

29_5

1-6

47
3-0

4'7

47

45,1

38,5

24

16.9

9.9

3.0

3.0

3,0

3,0

3.0

2,8

')(

100

9s.0

79_5

56,1

43.1

3,0
27.6

14.9

12.7

6,8

Sarinmn
Syarat
Snesifikasi

1m

801100

'70/90

Asreeat A
Agresat B

100

90

59

100

100

Filler C

100

100

100
100

iii. Cara Grafis.

96

82

51

36

21

9,2

100

100

100

98

q3

82

Jawab:

Pengamatan datzbzhan:
1). tfaterial dengan gradasi lewat dan lolos saringan no.8 menuniukkan
zgr eg^t s afl gat kekurangan proporsi bahan untuk mengikuti spe sifi kasi'
"
i1. V^i" saringan No.B agregat A sangat kekurangan bahan ini,untuk
mencapai t^rget batas tengah yaitu 42,5o/o.

menggunakan persamaan 5'3' untuk


passing no.8 mengikuti terpenuhinya batas tengah

Hitung proporsi
menyeleksi

proi.n

^gaeg

t A

spesifikasi.

L Kombinasi Dua asreszt.


Berikut ini adalah perunjuk cara grafis yang diberikan oleh Asphalt
Institute.
Mengambil contoh soal 5.1. dapat dicari dengan c r^ grafis
(Gbr.5.1 1.) dengan petunjuk:
- a). Skala absis dan ordinat harus dibuat sama,dimana ordinat kanan
disiapkan untuk prosen lolos saringan Agregat 1. Sedang yang
sebelah kiri untuk prosen lolos saringan Agregat2.
- b). Posisikan masing-masing nilai prosen agregat 1 diordinat kanan,dan
nilai prosen agregat2 diordinat kiri. Hubungkan kedua titik
bersesuaian pada nomor saringan yang sama dan namai sesuai
saringannya.

- c).

,=P-B_42,50-82_0,50
A-

3.2 -82

3). Pada saringan no.200 pfosenrase hanya ditentukan oleh agregat B


dan filler C. Jadi hanya kombinasi dua bahan B dan C.Gunakan persamaan
5.2 dengan parameter B dan C. Jadi :
c:

P -0,58

C_B

7
= -4'6

82-9_2

=0,03

Proporsi bahan Passing No.200.


P =Aa t Bb + Cc ---+7 = 0(0,50)+9,2b+82c . . . . .'''"' {.\./
Dengan meng;unakan nilai a=0,50 yang didapat pada butir 2dan
menggunakan pefsamaan 5.5, maka:
b+c =1-0,50 = 0,50 -> b =0,5 - c

*) -+ 7 = 9,2(0,5-c)+82

didapat: b=0,50-0,03=0,47

Untuk masing-masing ukuran butiran


tenrukan dimana limit
^gregat
persyaratan gradasi memotong garis pada
butir b).Sebagai contoh
untuk saringan No.100,limit batas atas adalah 2Oo/o dan limit batas
bawah 3olu.
d). Bagan potongan tersebur di butir c). adalah menunjukkan proporsi
agreg^t 1 dan
t 2 yang ditunjukkan oleh angka absis bawah
^grr'g
dan atas. Angka
merepresentasikan limit yang tidak boleh dilewati
untuk ukuran gradasi yang bersangkutan.
e). Tentukan garis vertikal yang dibentuk oleh perpotongan tersebur
dibutir c).yang paling dalam dari masing-masing arahkiri dan kanan.
Dalam hal ini pada grafik didapat 14%-50%
1 dan 500/o-860/o
^gregat
agregat 2 yang akan memenuhi syarat spcsifikasi
bila di-blending.
f). Untuk mendapatkan prosentase blending adalah batas tengah selang
yang dibentuk pada butir e) diatas. Disini adalah 32oh agregat 1 dan
68oh agregat 2. Bandingkan dengan cara coba-coba taksiran dan
matematis diatas.

T
Rancangan Bahan Perkerasan Jalan

t80

l,lU

,@
-iil .e{i ll,

ruf

l4tAfi

xot

6c.&ut1s,1

d).

Garis lurus ditarik dari titik A dan S demikian juga dari titik B ke

.)
f).

g)

Bt Kq 2: PER4NCAN(ANPER-KER4.S,4NJAL N

c.
Potongkan garis A-s dengan perpanjangan garis B-c untuk
mendapatkan titik B'.
Adapun panjang masing-masing garis diambil dari perbedaan
prosentase titik-titik acuan.
Prosentase agtegat yang akan diblending, dicari dengan persama^n
matematis yang diturunkan dari rumus dasar persamaan 5.4.Qthat
Contoh SoaI 5.2a.).

drtl

5i.r

7ll

fil

.{t)

..1{l

2{t

1
&ll

?{r {li{t {.}0


...-..--...>

Gbt. 5.11. Metoda grafis dad Asphalt Institute.


( untuk blending dua agtegat).
2. I(ombinasi Tiga Agregat.

Berikut

ini

luga dari Asphalt Insitute untuk blending tiga fraksi

agfegzt.
Petuniuk solusi cara grafts lj'ga agregat adalah sebagai berikut:
- a). Skala absis dan ordinat harus dibuat sama,dimana absis diiadikan
kedudukan prosefl bahan yang tertinggal saringan No'8 dan ordinat
kedudukan prosen lolos saringan No.200.
- b). Hanya databahan^gtegat prosen yang tertinggal saringan No.8 dan
prosen lewat saringan No.200 yang di-plotpada grafik.

t kasar, titik B bahan


me-representasikan bahan
^greg
halus(biasanya pasir) dan titik C adalah gradasi filler.Titik S
^gregat
dari nilai tengah limit persyar tan gr d^si,untuk
representasi
adalah
material tertahan saringan No.8 dan material lolos saringan No.200.

- c). Titik A

l8l

--+

Gbr. 5.12. Metoda grafis dad Asphalt Institute.


( untuk blending tiga agregat).

Y
Rancangan Bahun Perkerasan Jalan

r82

CONTOH SOAL

5.2a.

NOn6G,4UtlC,t
f

. Luas permukaan bidang

.1.

Data sebagaimana contoh soal No.5.2.


Dari Contoh Soal 5.2. didapat:

Berat Isi Agregat

B4Ku' 2 : PERANC.AN(AN PER-KER,4SANJ,4L_AN tEl

^greg^t.

AGREGAT
A

AGREGAT
B

FILLE.R

9,2-9

82

BeratJenis Aspal
Tekstur permukaaan dan bentuk dari agregat
5. I(arakteristik bahan yang lolos saringan no.200
(r.
Jenis bahan bitumen
7. Besar rongga(void).
tt. Absorpsi agreg t terhadap aspal.
Penenruan metoda untuk mencari kadar aspal menjadi suatu hal
yang sangat spesifik dalam r^nczng n perkerasan bahan campuran aspal dan

57,5-58

96,8-97

18

;lgregat.

1.

,1.

Tabel Contoh Soal5.2a


SYARAT
SPESIFIKASI

6arasteNcaH)
I-olos No.200
Tertahan

74J.4n

No.8
5.8.2.1.

Metoda Luas Permukaan.

Absis dan koordinat masing-masing titik:

Titik A ( 97; 0,0 ), titik B (18;0; 9,2), titk C (0,0;82,0).


Titik S ( 58;7,0)
Perpotongan AS dan CB adalah titik D(17,0;13,0) +- grafik.

KoeJisien

Karena a*b*c=
Dari Grafik:

"

t=-

tt-11

o=?'l
=1=0,51
Y:xs-x' =
Garis AD x,c - xo 97 -17 80
1 -+b + c=1-a

(l-a)garis DB (l-a)(yo-yu\ (l-0.50)x(13-9)


-1,96 -^,.,..
73
82 -9
(Y, - Y u)
garis CB
1-0,51 -0,03 =0,46
b = 1^-c=

Jadi blending dengan komposisi :


51oh Agregat A + 460/o Agregar
Coba-coba matematis).

B + 3% Filler.(Bandingkan dengan cara

5.8.2. PENENTUAN KADAR ASPAL CAMPURAN.


Kadar aspal didalam suatu campufan sangat menentukan didalam
suatu fancangan bahan perkerasan lentur. Disamping menentukan faktor
kekuatan perkerasan juga sangat berperanan dalam penentuan hatga sruan
bzhan campurall.
Pada dasarnyakadar aspal sangat tergantung pada

Metoda luas permukaan merupakan salah satu metoda yang


cligunakan secara luas dalam menghitung prosen birumen didalam
campuran. Metoda lain adalah berdasarkan pada konsep 'void', yang
mendasarkafl perancanganpada banyak aspal yang mengisi rongga butir.
Pada metoda luas permukaan,jumlah aspal yang dipedukan dalam suatu
campufan,sangzt tefganrung pada gradasi aggregat yang dipakai. Gradasi
'terbuka' lebih sedikit memeilukan aspal daripada gradasi yang lebih padat,
karena gradasi padat mempunyai lebih banyak permukaan y^ng harus
dilapisi.

Didalam campuran aspal terdapat beberapa variasi

agreg

campuran,sehingga untuk menghitung luas total permukaan


t
^greg
dilakukan pendekatan melalui penggunaan ap^ y^ng disebut Faktor
Luas
Permukaan(dinyatakan dalam m'/kg). Agregat yang disaring dengan
susunan saringan 3 f 4",1. f 2",3/8", No.4,No.8,No.16,No.30, No.50,No.100
dan No.200 berturut-turut mempunyai Faktor Luas permukaan
0,41;0,41,;0,41;0,41;0,82;1,64;2,87;6,14;12,29 dan 32,77. Luas total
permukaan
t adalah penjumlahan dari seluruh perkalian (Faktor Luas
^grcg
Permukaanx%o lolos saringan).
Parameter lain yang banyak terkait dengan luas permukaao agregat
adalah *ba/ kpisan aspalflm,yairu perbandingan antara volume aspal efektip
dcngan luas permukaan. Semakin tinggi kadar aspal efektip,semakin tebal
lapisan aspal film pada masing-masing butir agregat.
Berikut ini beberapa hasil pendekatan,yang didapatkan berdasarkan
metoda luas permukaan.

T
a). California ( Mc Kesson

Metoda Asphalt Institute metoda campuran dari USA, banyak dipakai di


Indonesia pada periode 1970 -1980.

& Frickstad ):

P=0,015a*0,03b*0,17c
dimana:
P=

o/o

bitumen dalam campuran (dalam skala berat)


a = aggregat tertahan saringan no. 10
b = oh aggreg tlolos saringan no. 10 dan tertahan no' 200'
lolos saringan no. 200'
c = o/o
^ggreg^tyang

5.8.2.2. Sifat Bahan Campuran yang dipadatkan.

o/o

b). Montana:
P = 1,25 ( 0,015 a

Idealisasi penampang dari suatu campuran aggreg


sebagaimana tergambar pada Gbr. 5.13.
SKALA

0,03 b + 0,17 c ).

-f-

G
(f

v{-

a
P = 1,30 (0,015 a * 0,03 b + 0,17 c).

d). Japan Road Association:

P = 0,023a

0,065 b

+ 0,13 c * 0,11 d +

vllu

c). Wyoming:

VOLUI'E

SKAI.A EERAT

dan

aspal,adalah

SKALA BERI|TT
JEHI$

vitA

1,13

dimana:

a
b
c
d

vy.Kt/. 2 : PERANCANqAN PER.KERA.SANJAL^N lE5

NdtlE4lttlGJ 74JJU

Rancangan Bahan Perkerasan Jslan

184

= o/o aggregat tertahan saringan 2,5 mm.


= oh aggregat lolos saringan 2,5 mm,tertahan saringan 0,3 mm'
= oh aggtegatlolos saringan0,3 mm,teftahan saringan 0,074 mm'
--

o/o aggregat

E
G

A
T

J_Lr

lolos saringan 0,074 mm.

e). Asphalt Institute:


P = 0,035 a f 0,045

Gbr.5.13. Idealisasi Volumetrik Bahan Perkerasan

b + K.C + F

dimana:

KETERANGAN:

C=

''KAI-A Volume bulk dari campuran


V-u
yang telah dipadatkan.
=
V-= Volume bulk campuran tanpa volume udara.

a = o aggregat tertahan saringan No.8


b -- oh aggregat lolos saringan No.8, tertahan

VOLUME.

saringan No. 200.

o/o

t lolos saringan no. 200.


^greg
0+2o/o tergantung absolpsi
^gregat @ila
disarankan menggunak an ntlai = 0,7).
K = 0,15 bila yang lolos no. 200 antarz 11-15oh
= 0,18 bila yang lolos no. 200 antan 6 - 1,0%
= 0,20 bila yang lolos no. 200, < 5o/o

F-

tidak ada

data

Metoda Perencanaan Campuran yang umum dipakai di Indonesia saat ini


adalah Metoda Bina Marga 1988,yang mengadopsi standar Inggeris C[RRL).
Pada 1997 metoda ini dilengkapi pemadatan PRD @ercentage
'
Refusal Densiry). Penulis mengakomodirnya meniadi Perancangan
Campuran Metoda Bina Marga 1997 Qthat sub-bab 5.10.1.3).

v"

V.u

= Volume void udara dalam campurufl


VIM (Voids in Mixture)
= Volume bulk aggregat.

V."

= Volume effektip

V-.
Vu
Vu"
Vro

V
V,
VP

v.
%
V,

y^ng telah dipadatkan,disebut juga

aggregat.

Volume poi antara aggregat.=VMA(r'oid in Mineral Agregat)


Volume aspal dalam campuran yang telah dipadatkan (effektip+absorpsi)
Volume aspal yang diabsorpsi aggregat
Volume pori terisi aspal effektip. Vrn=VFIA-Vu.=( V5 - Vu" ).
= Volume total agtegat
= Volume pori tidak lolos air.
= volume pori lolos air
= Volume aggregat solid
= volume pori tidak lolos aspal.
= volume pori lolos aspal

=
=
=
=

T
Runcangan Bahan Perketasan Jalan

186

SKAI-4 BERAT:
Ws
= Berat I(ering Agregat.
!7u^ = Ilerat aspal yang terabsorPsi.
Wr^ = Rerat aspal effektip.
!7-- = Berat contoh yang belum dipadatkan
!7-...r = Berat contoh yang telah dipadatkan SSD

xotl6z4ux6J

trAt4fi

Btty'y. 2 : PERANC,AN(AN PER-KERA.SANJAL^N l8Z


Berat Jenis Apparent(Semu) dari Campuran:

G:wno
sq

(v,o +v,)y,.

(saturated surface dry= kering

..."......(s.6.)

permukaan ienuh ).

SKAI-A BERAT JEI'ilS'

Gu
G,"
G.r
G,"
C,t,
G,,b

= BeratJenis AsPal.
= BeratJenis Bulk Campuran.

G-b..d = BeratJenis Bulk Campuran

G-b.d

Gbr.5.14a.

'

= Berat I(ering Agregat.


= Berat Jenis Efektip Agregat'
= BeratJenis Bulk Agregat.
= BeratJenis Campuran Semu(apparent).

Secara praktis adalab

u;;,u,*rd;{###4ramrm,,*,
2). Balk specifc g;auifi =Berat Jenis bulk

dalam kondisi SSD (kering permukaan

ienuh).

= BeratJenis Bulk Campuran dalam kondisi OD (kering oven)'

PROSENTAS'E BALIAN:
= ohkadx aspal terhadap berat campuran.
= ohkadar aspal efektip terhadap berat campuran.
= %o absorPsi aspal terhadap bent agtegat.
= o/o kadar ^greg t terhadap berat campuran total.

Pu
Ps.
Pr^
P.

CATATAN:

Perdefinisi: Perbancling^n antzra berat agregat kering dan berat ur


suling yang isinl,a sama dengan isi agregat dalam keadaan jenuh pada suhu
tcrtentu.
Sccara praktis adalah

wn

;t"r rt,

Ada dua keadaan yairu:

-V,,"(cm3)=VMA(%) adaiah volume intergranular ruang void diantara partikel-partikel


agreg^tyang dipadatkan termasuk void terisi udara dan void terisi aspal effektip.
partikel-partikel
-V6"(cm3)=VFA(o/Q adzlzh bagian dari volume void intergrand^t
^t1t^r^
agregat(VMA) yang terisi aspal effektip.

i). BeratJenis bulk (atas dasar kering oven):


Berat Jenis'bulk' campuran kering oven:

G*uoo:#atauG-uoD

V^(cm3) =VIM(%), adalah total volume dari seluruh kantong-kantong kecil udara
diantarz partikel agreg?t yang diselimuti aspal.

- Ps. adalah kadar effektip aspal merupakan kadar

aspal total campurafl minus bagian

aspal yang terserap oleh agregat.

ii). BeratJenis bulk (atas dasar permukaan):


Berat Jenis'bulk' campurafl kering permukaan SSD:

BE,RAT JENIS :
Dalam perhitungan camPufan,dibedakan adanya 3 klassifikasi berat jenis

G^t

.s,sD

^tto

oo
wmms
-w

( s.7b.)

1). Apparent spectfcgraaifl

=BeratJenis Semu:

bef t
Perdefinisi i Berat Jenis semu adalah perbandingan
^ntz;rdengan
s^m
volumenya
agregat. kering dan berat air suling yang
dalamkeadaan kering pada suhu tertentu
volume
^gteg^t

dimana:

W-oo
WmSSI)

W..
V-o

= berat kering oven(oven-dry) campuran(gram).


= berat kering permukaan campuran padat(gram).
= berat campuran padat dalam air(submerged)-gram.
= volume bulk campuranpadat.

T
Rancangan Bahan Perkerasan Jalan

188

BAKI 2 : PER,ANCAN(AN PER-KER.ASANJALAN IEg

Xqn66'&4t(9, trA.tAtl

dimana:
3).

ffictiue

Specific Crauifi.

Secara praktis adalah

berat jenis bulk agregat total.


prosen berat masing-masing
^gregzt
berat jenis masing-masing agregat.

G.u
P1rP2,....P"
G1,G2,...Gn

Berat lenis Efektio Asresat


Pori

lak lolos aspal

Vc

Pofl lolos as

*.rt

Berat Jenis Effektip = G"" =

w,b

,..........(

rg$egat

(V* +V")y*

G"" =

**-Pu

(s.10.)

Pu

-!r- G** Gb

s.8.)

dimana:
Gb.5.14.b

CATATAN:

= berat jenis efektip agregat.

G,.

'bulk' maupun 'apparent'akan terfadi kesalahan pada saat


perhitungan fancangafl camPuran, karena nilai berat ienis aggregat dalam camPufan'
i.rgr.torrg pada banyak aspal yang masuk pada pori lolos aspal. Dalam 'apparent'

G-P--

diaiumsikan-pori lolos aspal seolah-olah sama dengan bila diisi ait; sedang pada'bulk', aspal
diasumsikan tidak masuk pada pori lolos. Padahal kenyataannya aspal masuk pada ruang
pori lolos air.Jadi yang lebih tepat adalah penggunaan dengan berat jenis 'effektip'.

Gb

1. Baik dengan menggunakan

BeratJenis semu

BeratJenis bulk

=berat jenis maksimum campuran(tanpa volume udara).


= prosen berat campuran belum dipadatkan total (100).
= prosen kadar aspal terhadap berat campuran
= berat jenis aspal.

Pb

Bera t J en is ma ksim am

2. Berat

uran

P**
G^.: P,.Ph

Pendekatan praktis BeratJenis effektip =

( SSD*Saturated Surface Dry),adalah


kering permukaan ienuh dan berat air suling yang

Jenis Kering Permukaan Jenuh

pefbandingan antara berat

ca m?

G,"

dimana:

(s.l

1.)

Gb

^gyegat
vr:lumenya sama dengan volume agfegat dalam keadaan fenuh pada suhu tertentu.

ini diambil dari Manual Series No.2 Mix


Design Methods dari Asphalt Instirute y^ng merupakan sifat-sifat
Rumus-tumus dibawah

P,

G--

= kadar ^greg t terhadap total berat campuran.


= berat jenis maksimum campuran (tanpa volume udara)

volumetrik dari campuran zspai yang dipadatkan.


Berat Jenis bulk Agregat

pto =

Agregat terdiri dari agregzt kasar,halus dan bahan Pengisi yang


masing-masing mempu nyai betat ienis sendiri-sendiri.

P, + P,

t.......P,

P.P"P
--'- + '-- q.... "
Gt G2

G,

-G b .....................(s.12.)

dimana:

Rumus berat ienis kombinasi dan agtegat adalah:


G,b =

L00xW

.(5.e.)

G,.
G.u
Gb

= berat jenis efektip


^greg
t.
= berat jenis bulk
^greg
= berat jenis aspal.

t.

T
Rancangan Bahan Perkerasan Jalan

1m

t<oilgctutlsJ
s.8.2.3.

Kadar Asba I efektio cd mbil ran

"-

Pot'e= P^

P,

'^-u!
100

xP,

(5.13.)

dimana:

=
=
=
=

Pu

Pb
Po"
Po"

Volame

kadar agrcgat terhadap berat campuran total


kadar aspal terhadap berat campuran.
kadar aspal efektip terhadap berat campuran.
t.
absolpsi aspal terhadap berat
^greg

prosen
prosen
prosen
prosen

Poi antar

asresat

vMA=100-(

G,r,

BI KA 2. PERANoANqANPER-KER,ASANJALAN

19I

KONSEP RONGGA (VO[D).

Seperti sudah dijelaskan diatas kadar aspal selain tergantung luas


;rermukaan,juga ditentukan oleh besar void. Sehingga metoda uoid juga
menjadi hal yang spesifik dalam penentuan kadar aspal.

Pada bahan yang dipadatkan besar void sangat tergantung pada


ukuran dan bentuk agregat,iug gradasi dari bahan
t. Sama dengan
^greg
metoda luas permukaan,metoda void lebih tepat digunakan
untuk campuran
bahan bergradasi padat (dense graded) dan tidak terlalu tepat untuk gradasi
terbuka (open graded). Pada gradasi terbuka kadar aspal akan cukup besar
mengingat gradasi demikian membentuk lapisan film aspal yang tebal.

Metoda void r^ncangan camprran dilaksanakan

dengan

mengkorelasikan hasil dari laboratorium dengan perwujudan campuran


clilapangan dalam kondisi beban sebenarnya yaitu beban lalu lintas.

fi'AIA).

94L )/

MtAu

.................(s.14)

Berikut zdalah contoh perhitungan besar void yang diberikan untuk


rnemperjelas konsep metoda void.

Contoh Soal5.3.

dimana:

Diketahui prosentase campuran sebagai berikut:

VMA = volume pori antar aglegat(o/o terhadap volume bulk)


P,
= prosen agregat terhadap berat campuran total.
G.u = berat jenis bulk agregat total.
G-' = berat ienis bulk campuran.

G-- G^u
G.^ )'

=t00x(

V^

= ( prosefl

..

CAMPURAN

% DAU,M.CAMPI}RAN

BEBATJENIS EFBKTIP

,70

2,70

25

2,6A

1,10

Agregat Kasar

Agegat halus dan filler


A$pql

Prosen uolame?oi dalarn cam?aran ?adat (l/a,|.

V"

JENISBAHAN

.....(5.15.)

Tentukan kadar rongga udara Y^ (air void),bila berat jenis bahan campuran
padat=2,30 gr/cc.
Jawab:

terhadap volume total).

BEfRAT
Volame

Poi teisi arbalfi.GA).

, VMA_Va
vFA =100x( ).............
'vMA/
VFA
V^

\,,OLU]vlE

"T

.(5.16.)

= prosen volume pori terisi aspal terhadap \&IA


= volume pori dalam campuran padat (oh terhadap
volume total)

O.zOre"eb=

r,er

+
T
o.r=o

""'

o.o5x2.

J-

(JDAFIA

AGTiEGAT
}(ASAR

{o .

AGftE(}AT

HA!-tJS +FIt-l-EFi

*+I

o.rr +

r,6

ASPAL

e2- O,5a

{o
.4.

lO-O-lt *, ,J,

T
B4rcu. 2 : PERANoAN4ANPER-KER,4SANJAL-AN,93

xdnggwrlet7,4aln

Rancangan Bahan Perkerasan Jalan

192

Berat contoh dilapisi parafin

Catartzn V dimana

= 1370,0 gram
BeratJenis panFn = 0,90
Berat contoh dilapisi pal,aCn didalam air = 780,0 gtam
Can BeratJenis bulk (kering oven) dari contoh padat tersebut.

G"xY*

V = volume, G. = betat jenis, W =

berat, Y*

berat isi ait'=

1'

*/cc'
Didapat 8o/, rcnga udxa (air uoi$ pada campuran yang

dipadatkan

tersebut.

Jawaban:

Volume campuran dilapisi parafrn= berut zt yang dipindahkan=


1,370 - 780 = 590 cc.
BeratJenis bulk atas dasar kering oven = 1.235/440 = 2,81 gr/cc.

VOIUMH

BERAT
5. 8.2. 4.

KON SEP BEKA*T JENI S.

1I

I+

*\

dapat
Jika berat cian berat j-enis parafin diketahui'volumenya
5'4'
dicari. Prosedut dapat dilihat pada contoh
Menimbang contoh diudara bebas dan ]uga menimbangnya
didalam air' Dalam hal ini menggunakan prinsip hukum

Archimedes,yaitu kehilangan berat didalam au adalah setara


dengan volume bahan yi'ng ditenggelamkan' Disini berarti
"b.b,t aiU'gi dengan perbedaan
bila berat contoh diudara
berat diudara dan berat diair adalzh merupakan berat f enis
yang dicad. Prosedur ini biasanya akurat unluk contoh yang
telaaf padat.Prosedur dapat dilihat pada contoh 5'5'
sekaligus menghitung kadat rongga udara'

Mengukur dimensi contoh,kemudian hitung volume dibagi


b.raf Cara ini paling -odri, dan cepat,rramun hasilnya tidak
akurat. Tidak terlalu disarankan untuk menggunakan
prosedur ini'
Formulir penghitungan nilai berat ienis dilabotatorium

3.

tercantum di Lampiran A-4.

Rongga

Ei

T
il
*;

r5Gr35/1(0.61

parafin

@l

1,. Melapisi contoh dengan panfin dan timbang beratnya diair'

*otu*.*
,1

r ees{r

Campuran
bahan

oooe.ssP/r{0

++

Contoh Soal5.5.

Dari hasil 'core' dilapangan,material bahan perkerasan aspal mempunyai


data teknis sebvagai berikut:
- Berat sampel kering oven S7-,ro='1,320 #am.
- Berat sampel di air W-. = 705 gram
- Berat sampel da.lam keadaan SSD, W^ssD= 1349 gam.
Sementara dari hasil test laboratorium didapatkan berat jenis semu(apparent
specific graviry) aspal = 7,63 grzmf cm3.
Bila kadar aspal dari test ekstraksi 5,45oh dan absorpsi diasumsikan

l,2ohxberat sampel core total, hitung prosen ronrye- udara

(at void) dari

sampel tersebut.

JAWAB:
o BeratJenis:
1. Berat Jenis kering oven dari campuran yang sudah dipadatkan.

Contoh Soal5.4.
Diketahui:
Berat kering oven contoh padat

l.

r35{

{T

aspal beton . Tiga prosedur itu adalah:

2.

+t
i

Umumnya salah satu dari tiga prosedur berikut digunakan untuk


menghitung betat lenis bulk (batk densi4t) dari contoh r^ncarugzfl campuran

Vo l u me s amp e l c o re

1235,0 gr:am.

= V. t

=W

n*r-

W'"

=D

-J

9!

= 644

"

*'

I
Rancangan Bahan Perkerasan Jalan

194

V-o= volume bulk agregat

2. Berat Jenis

volume efektip aspal.

bulk atas dasar kering oven dari sampel yang sudah

dipadatkan:

ru'h oD

l/^oo-

o/o.

Catatan:
3. BeratJenis

Kurva Flow-Kadar Aspal tidak menentukan pemilihan kadar aspal


optimum,karena tidak masuk dalam selang kurva Gbr.Contoh soal 5.6.b.

bulk atas dasar permukaan'

t- =- W,tso -Y-=99'=2,19
graml cmj
Q.h
-= 1:ZO-ZOS- 6tS
Wj;_n- Berat total aspal - \flu= 5,45/100x(1320)= 71,94 gtam'
ssD

- Berat aspal terabsorpsi =


-

.Wr^=1',2f

erat bulk agregat total =!r,b =

(1

1'00x(1320)=15,84 gram'

00- 5,45) / 100x(1, 320) =


4-1 5'84=56'

248,0 6 gr^m.

,4

,t

dsr.g,BF.t is,til

0 gram'

- Berat efektip aspal = srb.=!7u-\7u"=


cm3'
- volume bulk agregat=v,o=w,6/ G^boD--1248'06f 2'15=580'49
7 1''9

- Volume efektip aspal=Vo"=W6./ G,"= 5 6,1'0 / 1',63=34,42 cmr'


- Volume maksimum campufan =V-,,=V.o+Vo"=

V--=

580,49 +34,42

-volume ait void(tongga udara) =v"=v-o-v' *=

614,91 cm3'

644-61' 4'91' =29'09 cm3


oh

(29,09 / 644)x1,00oh= 4 r52


Jadi prosen V^= V"/V- o=
GATATAN: Campuran cukup baik karena variasi v" berkisar antan

,l(*#rvserMhry

3+5o/o.

ti

5.8.2.5. Metoda Matshall.

Metoda pengujian seperti diielaskan pada bab 5-7-' Untuk mencari


kadar aspal opti^ulm' dari iangkaian graftk hasil ujr_ Marshall dikaitkan
dapat
dengan prrry^r^t^nkriteria ,^n ing^n Marshall (Iabel 5.9.). Kalkulasi
dilihat pada contoh soal 5.6.

it

,dI

Gbr.

ontoh

So

al

5.6 a.

Hrrbungafl

\---/

trtrneter

arshall

5.8.3. Langkah Penyiapan Rancangan di laboratorium.


LangkahJangkah penyiapan r^ncang n campuran adalah:

Contoh Soal5.6.
Misal hasil pengufian Marshall sebagaimana tetgambx pada Gbt' Contoh
Lalu Lintas
Soal 5.6.a. P.r.yrrrtm rancangan sebagaimana Tabel 5'9'untuk
Berat.

195

I(adar aspal optimum diperoleh dengan menyusun batas-batas rancar,g n


pada suatu grafik (Gbr.Contoh Soal 5.6.b.). Akan didapat suatu selang
afltara yang memenuhi syarat(disini 6oh-6,5o/o). Batas tengahnya adalah kadar
aspal optimum yang dicari. Dalam contoh ini didapat kadar aspal adalah
6,25

=z1s groml cmr


=,l3zoJo5=!1^20====W
615 -

BqK\ 2 : PER ANCAN(AN PELKER.4S,4NJ,4L-AN

Nortgtqiltl&J rAtAU

A.

Persiapan baban

/).

di l-.aboratoium

Persiapan benda uji.

Rancangan Bahan Perkerosan

tx

lalan

xofloGqw$ittr4tAu
dimana

ffi$.s9h
/&Fqs"7,0sl,

55$b&5lfi

61'?5qi
sre- B.gtt,

Gbt Contoh Soal5.6.b. Pemilihan Kadar Aspd


CemPula'l

DisiapLan lima benda

i.l,ffiii.-0"*n dilakulan
' iondisi
khusus 75 ka.li.

,n.

Pnguknat kEadalan bnda

0,5olo terhadap kadar

aspal

,"

y,,

$i.

Kondisi permukaen mulus tapi ebsorbsi tidak

=ltt !"*]
t G"

diab"ikan.
c. Kondisi permukaan kasat.

j-

D-E--

P^l

--.-------.-.................-(5.20.

(%\

=/Oooo

-----.--.-.--.-........-...(s.2r.)

dimana:

daPat

V,

= tongga udaa(void- %)'


Vo^ = void tedsi oleh *poJ (oh).
G,* = beret jenis beflda r\i. (gr/ c:tl
G.r = berat ielis teoritis Qrlcm), dihitung dari pers. (5.22)
V6 = volume aspal per-unit volume camputaa( % )dihitung dari
pets' (5'23 )'

c",=:* il*.xr_ ("r")

G.22.

e;* LG,

a. I(r,.,"'.;......................................
.\
(518)
o=*r,

d----

dan Void teisi arpal ( Von ).

sebanvak 35 kali'so kali atau dal^m

pada peoguiian
D. Kepadat'o benda uji l{atsha.lldiptioritaskan
stabilitas,
"""-*K.p"dr* dihiro,,g dengn salah satu formula penghitungn tekstur
p-sJr.o *fr,ai"bari""
a. Koodisi Permukaan mulus dan absolbsi diabaikan'
4r..........................................(s.17.)^t00
)......----.-..".-- "-".-.d=71r*tsrc.

b,

= berat benda uji diudara ( gr* )


= berat kering permukaan (SSD) diudara G.u*).
= berat benda uii didalam air ( gram ).
=berat benda uji terselimuti parafin diudara (g.r*)
= berat benda uji terselimuti parafin didalam air (gram)
= berat jenis parafin.
= berat jenis air ( 1 g/cm3 ).

Void dan void terisi aspal dihitung dengan rumus (5.20.) dan (5.21.)
berikut ioi:

Optimum

uli untu} dilakukan te6t Mffshal, ,ang

' ;#;*-i;*;-'",iJ'u'-J';

2).

3). Void (,2"

:A
B
C
D
E
F
y*

B,('(I^ 2 . PER.ANCANqAN PER-KER.4SANJAL,4N I97

v,=mff.*1nn

Ch)................................(s.23.)

dimana:
Wh, V, = proPotsi aspal, proPorsi setiap agregat. ( yo ).
Gu Gr = betat jenis aspel, berat ienis agregat ( % ).
(1g/c.,.l).
= uo,tl."t

G,",t\.. .. ....................(5.1e.) r*

^r

Ranccngan Bahun Perkerasan Jalan

108

4).

Penentuan kadar aspal optimwn

(ihat contoh diatas)'

Plot besaran Marshall (berat jenis, void, V,'^' Stability' dan

Flow ) terhadaP kadar asPal.

jr.

Bandingkan hasil plotting dengan standar l\{arshall dari Tabel


s.g. d^., pilih kadar u.pd yu.rg sesuai diantatz nilai-niiai pefsyarztan
Marshall ya.rg -.-.roti' fnaar aspal yang didapat'nungkin kadat
aspal yang oPtimum.

5).

P en enttt an p ropo

rsi

car@ uran 1 ang

rptim a l'

Lakukan iangkah 1) sampai 4) diatas,dengan mengganti tip'


,gg."grt,gradr-si dan kadar aspal' Pdih proporsi y^ng paling
ekonomis diantata hzrga-hargayang didapa t,y^ng memenuhi seluruh
persyaratan dan menunjukkan kineria yang paling baik'

NOU6G4U|IA 14J.4U

VqKq 2 :

PER

4NCAN(AN PER-KERASANJAL,4N 199

Pertimbang^nny^ adalah mzn yang memberikan material yang paling


ekonomis. Ketersediaan bahan zgteg t sarigat menentukan yang kadangkala
tidak sepenuhnya dapat memenuhi spesifikasi sehingga dipedukan adanya
blending.

ii.P e n e n tu an p rop o rsi dmgan b k n di ng.

Blending adalah usaha trial & error dengan memvariasikan prosenrase


agregat agar memenuhi kriteria gradasi spesifikasi. Blending dapat dilakukan
dengan cara coba- cob a (taksira n),cara coba-coba(matematis) maupun dengan
penggunaan cara grafts(that sub-bab 5.8.1.)
2).Kadar Aspal Optimumyng akan digunakan.

Dengan proporsi yang sudah memenuhi syarzt spesifikasi hasilan dari

blending lakukan prosedur y^ng sama dalam penyiapan bahan


dilaboratorium diatas.

CATATAN:
saat test dengan beban yang
a).sebenatnya adalah paling baik melakukan penumbukan pada
x pukulan sebenarnya tidak
50
.r"-,.rr,
dibuk",
lalu
lintas
saat
.b^r,
pri.
identik dengan t
berat pakai nilai pukulan
lintas
lalu
memadai untuk kondisi lalu lintas berat, jadi untuk kondisi

5.9. METODA RANCANGAN CAMPURAN DARI ASPHALT


INSTITUTE.

75 x.

i).Pengamatandilapanganbiasanyapemaclatanberkisarg8-100%darinilaipukulan50x.
ii)'Pengamatanlain,menuniukkanT5xpemukulanidentikdengankondisiawal,padasaat
lalu lintas dibuka'

b)'BilaczmPufancenderungtidakmemadai,lakukanpengulanganlangkahrancangan
camPuran.

c).LakukanpengulangantestMarshall,bilamanadidapattekananMarsha]l.vangkurangdari
750

d).Cermatibilaaspalmengalamisti?pifi&walaupuntekananMarshallmelampauiT5To.

"ji

5.9.1.

Ptosedur
i. Perniliban bahan.
/. Semua bahanlang

digunakaru memeruuhi persltaratan spesfikasi


2. Blending agregat meruenuhi persjtatan gradasi spufikasi.
3. Untuk analisa kepadatan dan aoid,tentakan berat jenis bulk dari seluruh

dgrega t de ni ki an j uga b erat j e ni s aspa l.


ii. Perytiapan contoh bahan.

Kadar aspal lang diharapkan' mengikuti persamaan beikat:

e).Prosedurumumbiasanya,kadaraspaloptimumyangdiambil'adalahmengambiiharga
rata'rzrta dari selutuh test.

0,035 a

* 0,045b +K.c + F

diruana:

B. . PersiaPan baltan di
I

laPangaa.

).

Pemilihan gradasi bahanlang akan digunakan'

i.

Pemilihan bahan agregat.

Dalam kondisi praktis gradasi terbuka adalah gradasi yang digunakan


sendirididalam campufan. Nr-r.r .."airp institusi memPunyai spesifikasi
ukuran
dengan
Gradasi
sendiri misalnya ASTM Designaton D 3515-76.
butir 1:2 in banyak d.ig,rnakan tefutz.mz untuk lapis pondasi atas'

P
a
b
c
K

=pendekatan kadar aspal campuran (/o berat camparan)


=Prosen agregat turtaban no.8
=prosen agregat lewat no.8 dan turtaban n0.200
=prosen agregat /eutat n0.200
=0,15 bila / / +/ 5% bahan lewat n0.200

-0,/ 8 bila 6+/ 0% lewat n0.200

=0,20 bila <5% lewat n0.200

=0=20/o- Tergantungpada absorbsi agregat. Bila data lain tidak tersedia


disarankan mengambil angka 0,70.

xou6t4utl6JMIAU

Rancangan Bahan Perkerasan Jalan

200

iii.

Pengajian Stabilitas dan Flow

adalah kadar aspal taksiran awalJlka seluruh besaran tidak memenuhi

Analisis kePadatan dan aoid.

lakukan redesain.

5.g.2. Evaluasi Data Penguiian Matshdl'

Tabel5.11. Kriteria Marshall untukJob Mix


(Sumber:Asphalt Institute MS-2).

- Pengamatan nilai stabilitas dari contoh bahan uii


- Pengamatan nilai flow
- Penggamb aran grafrk berikut (ihat Gbr'Contoh 5'6')
Kadar Aspal vs. Rongga Udara(Air voids)
Kadar asPal vs. VMA
Kadar AsPal vs. VFA
Kadar AsPal vs. Berat Isi
Kadar AsPal vs. Stabilitas
Kadar AsPal vs. Flow.

laramotur

ilctdfl ilnmhnll

0
0

b.

Gtafik berat isi dari total camPuran mengikuti pola


stabilitas,kecuali berat isi maksimum(tidak selalu) teriadi pada

Atflx

lflflx

ffiu

t[in

il

lil
I

ll

?0

llir

illu

ffi

$tililitnnllhl
Ihu$Sms{0,8lirl

Pffifrtan

tCIrgflrhng

p&

ffi

It

l{

?[

$5

l\

ffi

lmdfui dilapmg ynng mmffiali.

L lihi tlou dirytilpde leidiri hhm

penentuan camparanlang memenuhi slarat'

Asphalt Institute memberikan data pada Tabel 5.9. sebagai data yang

mnhi

nomrur

Tabel5.12. Void minimum dalam

kurva
kadar

minimum.
Prosen void pada agregat0'rMA) umumnya menurun sampai batas
minimum kemudian bertambah dengan bertambahnya kadar aspal.
makin
Prosen void terisi aspal vFA secafa konsisten bertambah dengan
bertambahnya kadai aspal. Karena dalam hal ini VMA makin banyak
terisi oleh asPal.

dirlkomendasikan untuk mendapatkan campuran yang memuaskan'

P*rmu[mn&Pnufuii

itfls

hilffit,iffi
samPai

Stabilitas bertambah dengan bertambahnya


maksimum kemudian stabilitas menurun'
Secara konsisten flow akan naik dengan betambahnya kadar aspal

Kinia

Pmukaan&Punda*{

Itafi

UIT,lT,l[: L lilamffik*rilah lhlurirymr ffi,i.10{,mfug B,tl04+1ffi,

ti"Sg, dari stabilitas maksimum'


prosen fongga udara(air voids) menurun secafa konsisten dengan
bertambahnfi Ud^, aspal,maksimum akan mendekati kadar void

Inhlintarhmt

Nlilltihtfsrl[41

aspal sedikit lebih

Ialulintnrmdang

ffi

firddtfua

ftondisi ini berlaku umum)'

kadar aspal

lalulintarrhgan
hmrknan&Psilturi

llin
lem&truJmHmhh

f,Wil

a. fulasi paranteter camparaz

201

Penentuan kadar aspal optinal dilakukan secara trial&error,bisa dimulai


dengan memilih void udara pada batas limit pertengahan yaitu 4oh(antara
persy^ratan 3o/o dan 5%). Hasil besaran yang didapat dengan penganggapan
ini harus dicek kembali sesuai dengan Tabel 5.9Jika memenuhi r.-ru irri

beikat:
Berat Jenis Balk

ilratan test sebagai

2 : PERANoAN(AN PER-KER-4SANJAL*N

c.

P ro s e dtr r P e ng/i i an

Melakukan

Bul.Kl,l.

UKURAN BUfiR

23s
4,75
9,5

VOID

&o)

3r0

4,0

5,0

21,5
19,0

22,5
20,fi

23,5

16$

L7,0

1S,0.

L4,0

15,0
14,0
13,0

1q,0
15,0
1.4,A

fi,a

13,0

12,5

13,0

19,0

n,a

25,0

'11,0
10,0
9,5
9.0

37,5
50,0
63

(VMA)

MINIMUMVMA(0/O)

MAKSIMUM(M}N
1,18

^gregat

1,0

10,5
10.0

21$

12,0
1,5
11-0
1

xofi6c4ux6JtrAtA%

Rancangan Bahan Perkerasan Jalan

202

fnal adalah yaflg paling ekonomis yang memenuhi


semua kriteria.Namun tidak dibenarkan untuk mengoptimalkan salah satu
besaran safa.
Misalnya stabilitas yang teflalu tirgg, akan menyebabkan perkerasan tidak
tahan lzma karena mudah terj adi retak(crack). Sebaiknya kadar aspal
diberikan suatu selang semPit diantzra batasan-bataszn Paf^meter yang ada

d,. Rancangan kadar aspal

untuk mencapai spesifikasi yang disyaratkan.

B\Kq 2 ; PER:4N{CANQANPELKER-ASANJAL-AN

203

lintas akan menyebabkan kurangnya rongga untuk menyebarnya aspal.Flal


ini yang akan menyebabkan kontak agtegat dengan
t berkurans
^gaeg
malahan mungkin juga hilanq. Akibatnya muncul alur dan
gelombang pada
permukaan perkerasan.
I(esimpulannya:
VA,tr\.

Ada campuran yanf\ mernbetikan kurva VX,{A sangat datar,yang


d1. Evaluasi kurva VMA.

Tufuan utama dari pemberian void yang cukup luas adalah agar zspal c.ukup
banyak sehingga cukup adhesi untuk mengikat agfegat.Namun iru iuga
beriampak pada nilai ekonomis,makin banyak aspal makin tidak ek'rnomis
struktur pefkefasan disamping batas-batas kekuatan,maupun keawetan.
Karakteristik kurva VMA adalzh
I
berbentuk U hampir datat,menurun

menuju batas minimum,baru naik lrg,


dengan bertambahnya kadzt aspal. Ada *
y^ng beranggapan bahwa VMA tetap Id
seiring dengan berkurangnya void udara >
tetisi crleh aspal.Pada kenyatzannya ini
tidak benar,karena perubahan volume total
sangat tergantung pada variasi dari
perubahan kadar asPal. Dengan
bertambahnya aspil camPuran akan
mudah dikeriakan dan dipadatkan, berarti
makin berat zlat Pemadat akan
menyebabkan makin mengecilnya volume.
Ini berarti kepadatan bulk campuran
bertambah dan \r1\{A menurun.
Sangat disarankan untuk

--_

ii
-----___-/

ltudn&d{Sl

dan

^ta;u

akan teriadinya flow

plastis

dilapangan.

Adanya tambahan beban dari lalu

si

fat campr"r ran,blTamana VN{A bertamba.h secara drastis.


Bila dasar kurva vMA berada diatas kriteria minimum dari ukuran
agreg t maksimum nominal (Gbr.5.15b) ini mengindikasikan job-mix
harus dirub ah,arany a gradasi agregat harus dimodi fikasi angan mengambil
J
kadar aspal padabatas ekstrim walau memenuhi spesifikasi ataupun Latas
minimum terpenuhi.Pada kuna bagian kiri titik minimum,campuran
mungkin tedalu kering menyebabkan segregasi,mungkin juga void udan
terlalu ti.ggr. sedang sebelah kanan,perkerasan akan mengalami ratting.
Bila seluruh curva vMA terletak dibawah minimum(Gbr.5.15c)
redesain dan perubahan agregat mutlak dilakukan.
d2. Pengaruh void udara
Lakukan rancangan selalu dengan
void udara pada selang 3:5%o.Selang
ini cocok untuk perubahan pembebanan lalu lintas cukup lama.Rancangan

{
E

l(adaA$d{1t}

menghindari pengambilan kadar VMA


pada daerah 'basah' atau disebelah kanan
batas minimum,walaupun void minimum
dan VMA memenuhi syarat.Ranc^ngan
kadar aspal seperti ini akan memberikan
kondisi sangat mudahnya teriadi bleeding

berarti campuran yang dipadarkan tidak sensitif terhadap adanya perubahan


kadar aspal akibat beberapa faktor.Dalam keadaan normal sifat kekompakan
campuran sangat ditentuka.n oleh sifat
Namun ada kondisi suatu
^gregat.
saat,kuantitas aspztl a.kan rnencapai kritis
karena tiada ruang lagi untuk
aspal.Hal ini akan membcrikan dampak, iumlah aspal akan mendominasi

*.
a

r{s&ilrudfrl

Gbr. 5.15. Pemilihan YMA.

void ini

pemadatan

biasanya drcapai bila campuran cukup menerima daya


Perubahan diluar selang ini akan mengurangi unrur

rericana,teru tama blla kurang dari 3oh,perkerasan pasti mengalami alur dan
gelombang,terutama pada lalu lintas yang padat.Hal seperti ini
dimungkinkan bila partikel passing no.200 tedalu banyak digunakan atau
bisa saja akibat bertambahnya aspal diluar takaran yang ada.
Hal yang sama bila void udara lebih dari So/o(atau mu,gkin pacra
pelaksanaan dilapangan void udara sebelum perkerasan dipadatkan lebitr
dari 8o/o).Dampaknya adalah retak,rauelling dan stripping.Batasi pengaturan
pada rancangan kadar aspal kurang dari 0,5Y0 void udara (0,5/100 x
4uh--2o/o) terutzm^ pada daerah kiri dair batas minimum.Artinya

I
Rancangan Bahan Perkerasan Jalan

m4

pefubahan kadar aspal optimum tidak melebihi 2o/o pada pengatufan


pemilihan r ncanga;n iob mix.
d3. Pensaruh VFA
VFA membantu mencegah ratrczng n VN{A dipenuhi tapi dalam
batas marjinal,yaitu membatasi level maksimum dan VMA,sekaligus
membatasi level maksimum penggunaankadat aspal maksimum. VFA iuga
membatasi void udara untuk campufafl yang mendekati kriteria VMA
minimum.Campufan untuk lalu lintas ringan tidak akan lulus kriteria VFA
dengan void udara relatif tinggi(5%),walaupun selang void udara tetap
dipenuhi.Tu)uannya adalah menghindari tidak awetnya struktur pada
kondisi lalu lintas rendah.
Rancangan campuran untuk lalu lintas berat tidak akan lulus kriteria
VtrA dengan void tdara relatif rendah 3,5o/o,walatpun iog" tetaP
memenuhi selang void udara.I(arena void udara rendah sangat kritis dalam
pertimbangan deformasi permanen,kriteria VFA membantu ^g r
campuran tidak mudah rutting pada situasi lalu lintas berat.
VFA menambah kriteria pengamanafl proses struktur dilapangan
dalam segi perw'ujudan perker^safl .

5.10. METODA PERANCANGAN CAMPURAN ASPAL.


1).

Tipe Campuran Aspal Panas.

Beberapa tipe campuran aspal panas(ihat iuga sub-bab 3.1.4) adalah:


a. LATASIR ( identik HRSS=HoI Rolled Sand Sheet) kelas A dan B'

* Jenis ini untuk jalan dengan lalu lintas rendah,pada daenh


t kasar.
yang kesulitan
^greg

xCampuran memPunyai ketahanan rendah terhadap

raltingsehtngga tidak disarankan untuk digpnakan pada lalan dengan


kemiringan memanjang besar dan tebal lapisan jangan tedalu tebal.
b. LATASTON(HRS=HoI Rolled Sheet).

NO,\6EWN6J 7414U

d.

ATB (Asphalt Treated Base)


* Dirancang terutama sebagai lapis

pondasi untuk
memperbaiki durabilitas dan ketahanan faak.
x Dalam posisi lapis perata disebut ATBL (Asphalt Treated
Base Levelling).
Tebal nominal rartczng n campuran aspal panas sebagaimana dapat
dilihat pada'f abel 5.1 3.
Tabel5.L3. Tebal Nominal Rancangan Campuran
Panas.
TIPE CAMPURAN

x I(arakter ut^ma adalah durabilitas,fleksibilitas dan


ketahanan fatik yang tinggi,sedangkan kekuatan perkerasan
mempunyai tingkat kepentingan kedua.
c. LASTON (AC=Asphaltic Concrete).
* Digunakan untuk jalan dangan lalu lintas tinggi,kemiringan
memanjang lalan besar,persimpangan atau lokasilokasi dimana
teriadi konsentrasi beban roda.

TEBAL RANCANGA},J

NOMINAL

(cm)

1(

HRSS(A)
HRSS@)

HRS

AC

3
4

ATB

>4

2).Bahan Campuran Aspal Panas.


i. Agregat I(asar.

Agregat I(asar umumnlra harus terdiri dari batu pecah,kerikil pecah


atau bahan lain yang mempunyai bidang pecah. Ketentuan batas
gradasi untuk agreg t kasar sebagaimana tercantum padaTaber 5.14.
ii. Agregat Halus.

Agregat halus termasuk setiap bahan pengisi mineral yang dapat


ditambahkan,harus sesuai dengan peffyaratan gradasi Tabel 5. 1 5.
iii. Bahan Pengisi.
Bahan pengisi harus terdiri dari abu batu,kapur,abu dolomite,semeri

PC,abu terbang,abu tanur seme n atau bahan mineral non plastis


lainnya dari sumbet y^ng disetujui Direksi.

* Cukup baik untuk jalan dengan lalu lintas ringan sampai


sedang.

Eq<'l 2 : PERANCAN(AN PER-KERASANJAL,AN 20i

Tabel S.l4.Syarut Gradasi Agregat Kasar.


UKURAN SARINGAN

% BERATLOTOS SARINGAN

(mm)
20

(ASTM

Camuuran Normal

Camouran Laois Perata

12,7

t/,

100
30-100

,5-100

9r5
4,75
0.075

No.4
No.200

3/8

9-s5
0-10
0.1

100

50-100
0-50
0-5

I
t<o*1.664W$J

Rancungan Bahan Perkerasan Jalan

206

Tabel 5.15.Syatat Gradasi Agtegat llalus'

'

eJ
4Js

2,36
60 mic*:u
75 micron

207

Tabel5.16b. Persyaratan Sifat Campuran Aspal panas.

% BERAT LOLOS SARINGAN

SARINGAN

(ASTlq

Bvtr<l 2 : PERANoAN(AN PERKERASANJAL,4N

ftanya sebagai pedoman untuk cara durabilitas tinggi)-sumber:Dokumen Kontrak.

UKURAN
{rnm)

MJAtl

1ATASIR
rA)

r-ATASIn@)

LASTON&ATB
r,l{TASTON

3/8

100

100

100

No.4
No.8
No.30
No.200

98.100
95-100
76-100
0-8

72-fi4
25-100

90-100
80-100
25-100

0-8

3-11

"72-100

BATAS*BATAS SIF,TT
SIFA?CAMPUNAN

'rlltli'

KADAfl.BffiJMENEFFEK]I{F I

:'
.

(hanya sebagai pedoman untuk

cira tradisional)-Sumber:Dokumen
HRSS

run

9r1

7,9

6"8

makp

2,0

2'0

1J

SIFATCAMPUSAN
Kadarbitumen efektiP
Kadar bitumen yg diabsorPsi
Kadat Arpal Total ygsebenamya(Yo

'

HRS

3a/o

TEBAI. FILM BITUMEN

,, },g,

.AC

STABILITAS MARSHALL

ATB

STABILITAS YANG TERSISI SETEI-TH


PEREND"{MAN,S.E|4$A 24J4M rr:rl)A 600 c

HR}i KEI-AS

ATB&

ATtsL

> 62,

> 5,5

4%"8%

SARTNGAN

1J

1J

CAMPURAN

6,0

10,3

8,9

7,3

FRAKSI FILLER AGREGAT HALUS. LOLOS


SARINGA,N NO, 2OO, TERH.{DAT TOTAI
CAMPURAN.

ABSORPSI BITUMEN

Kadar Rongga Udara dari carnpuran


padatf.6 thd.,vol. camPurao tota!

frun

maks

Marshall Quotient
(AASHTO T 245-78XkN /mm)

1Tlln

0,8

0r8

1,0

1,8

118

nraleg

d0

4"0

5.0

Stahititas Marshall

filln

2*0

200

BASHTCI T 24s-78xk$

850

Stabilitas Marshall tcrsisa setelah


perendaman 24 iam pada 60oC(%
stabilitas semula)

rnm

850
15

750,
1s00

750

maks

4,0
450
850

t5

v5

t:t

t)

: MIKRON
' 1,8* 5
550 -1250

ts, .

>

,r&
5,9

TOTALBITUMEN

4,5

tg

>8
MIKRON

1,8*5
kN/mm
450*

1250
kC

>75Vo

7504

30-

20-40

0*1,7,'
>7J

kN,/mm

450;850

'

6q/a.

>8

,'

1-,5,

Nc.8 ( CA,), TEn}rApdp To:rAL

6,7

3a/o

6810

kN/{flm

FRAKSI AGREGAT KASAR YANG TERTAHAN

5,)

6,2

'mir]

terhadap berat total)

6,8.,,

MIKRON

Kontrak

HR$S

ANGKA PORI

MARSHALLKUOTIEN

Tabel 5.16a. Persyar^tun Sifat Campuran

KtrLA$A

< 650/

50

*7,5

: :0:+1J

rl

. >63 ,.,

0*

r,7

> 6,0

Bitumen harus diekstraksi dari benda uji sesuai dengan AASHTO T


164. Setelah konsentrasi larutan bahan pelarut bitumen y^ng
diekstraksi mencapai kira-kira 200 mm,partikel mineral y^ng
terkandung didalamnya harus dikeluarkan dalam suatu mesin
sentrifugal.

3). PersyaratanBahan Sifat Campuran Aspd Panas'

Campuran Aspal Panas harus memenuhi Persyaratan

yang

diteniukan dalam Tabel 5.1,6a atau Tabel 5'16b'


asumsi kondisi ialan
Jenis campuran yang ditetapkan berdasarkan
lintas perkotaan.
lalu
datar datatau kemirilngan landai,untuk kondisi
Bahan aspal yang terkandung dalam benda uii pada campuran
kerja,harus mempunyai nilai penetrasi tidak kurang dari 700/'
terhadap nilai peneirasi aspal sebelum pencamPuru: ^ qT "iloi
l'
daktilitas sekurang-kurungnyi 40 mm bila diuii sesuai AASHTO
49 dan

51.

5.10.1. Philosofi Rencana Campuran Aspal.

Ada dua philosofi umum r^flcang n campuran aspal yang


di indonesia. Periode sebelum 1988,meng3unakan
pendekatan perenc i^ n campuran aspal tradisional. Metoda ini dianut
dilaksanakan

banyak negara dan organisasi profesi. Sesudah tahun 1988 dengan


pertimbangan di Indonesia mempunyai banyak variabilitas bahan
agregat,digunakan c.ara Bina Marga 1 98S (CQCMU)

Rancangan Bahan Perkerasan Jalan

208

5.10.1.1. Rancangan Campuran

NOngGqilNCJ94J4n

Tradisional

B\Kq 2:

PER,4NC4N(ANPER-KER-,4SANJAL

N 2N

EI ATAS DISTRI gUSr UKUR AN PANTIT<EL


UNTUK AGREGAT HRS, AC DAN ATB

C(Ii'TO H AATAS -

Prosedur tencafla. campufan,disiapkan secara khusus untuk


t yang ada di Indonesiadan untuk
menampung berbagai fenis
^greg
menampung berbagai kendala konstruksi. Pendekatan yang diambil,berbeda
dengan pendekatan Asphalt Institute atau orgarisasi jalan di luar negeri
lunnya,karena diwaktu yang lal:u telah mengakibatkan seiumlah besar
kegagalan campuran di Indonesia(C.P. Corne).

CONTOH BATAS - 8ATA3 D]STR gUS I UKURAN FAATTKE L


UNTUK AOREGAT LAPIS PERATA HRs. AC OA" ATB
T

o). CARA TRADISIOI!AL

,a

T 06,
SUMBER'
DOK.KONTMK-GBR-RENcAilA
OITJEN BINA MARGA

PARTICLE SIZE

Gbr.5.17.Batas Distribusi ukuran

parikel

agregat aspal.

. o Campuran Aspal Tradisional.

t *."Q

I(omposisi Umum Campuran Aspal.


Campuran aspal akan terdiri dari agregat mineral kasar,agregat
mineral halus dan bahan bitumen. Dalam beberapa hal,penambahan suaru
bahan pengisi mungkin diperlukan untuk menjamin sifat campuran aspal
memenuhi persyar^tan (lihat Tabel 5.16a.).
b. Kadar aspal campuran harus ditetapkan sedemikian rupa sehingga
kadar aspal efektip(sesudah kehilangan akibat absorpsi) tidak akan kutang
dari nilai minimum yang ditetapkan sesuai Tabel 5.16a. Nilai yang ditetapkan
berdasarkan dzta pengujian y^ng harus lebih besar dan batas yang
ditetapkan Tabel 5.16a.
c. Proporsi Komponen Agregat.
Harus dicatat bahwa fraksi rencana ini tidak sama dengan proporsi
takaran@atching). Dalam penentuan campuran,untuk menghasilkan fraksi
reflcan yang disyaratkan,maka gradasi dari setiap
t dan bahan pengisi
harus ditentukan oleh penyaringan basah. Fraksi^greg
rencarr campuran harus
terletak dalam batas komposisi sesuai Tabel 5.17.
a.

tsINA

MAR.A

Gbr.5.L6.Philosofi a;;;IRrtiN
Pendekatan perenc nazn yang umum dan tradisional (Gbr.S.16a.),meliputi:

1. Memilih pencampurafi agtegat y^flg tePatsesuai dengan

2.

persy^r^tan

bahan dan gradasi.

Melalui penggrnaan beberapa variasi kadar bitumen, dicari kadar aspal


optimum,untuk beberaP^ c mpvrzn/gabuogan zggregdt yang tertentu.
3. Stabilitas maksimum,merupakan kriteria pokok untuk optimalisasi,
campuran

^ggfeg^t-

I
Rancangan Bahan Perkerasai Jalan

zt0

Tabel 5.L7. Fraksi Rencana Campuran.

Tabel 5.19. Persy arataln Gradasi agregat halus.

r,

% BERJ|T TE,RHADAP TOTAL CAMPURAN

KOMPONEN

BqKu 2 : PERANoANQAN PERKER,4.94N-JAL,4N 2ll

NOvt 68 8U t1,64 tr41,/+rr.

CAMPURAN

HBSS(A)

r.rRssF)

HRS

AC

ATE

CA

0-10

5.,3

2440

30-50

40-60

FA

643-78,3

53,{>-72,6

47-6:l

39-s9

26-$,5

FF

12.15

8-13

5.9

4,5J,5

4,5-7,5

UKURAN
SARINGAN

%BERATLOLOS

3/8"

100

No.4

90-100

No.8

80-100

No.30

25-100

No.70

7-60

No.200

5-11

d. Pengujian Campuran percobaan laboratorium harus dilaksanakan


dalam 3(ugu) tahap:

i.

Memilih resep campuran nominal untuk dipakai acuan bagi

percobaan campuran.

ii. Melakukan percobaan campuran untuk mencari resep camPufan

Fraksi

SARINGAN

t kombinasi

rencanz-

^greg
dihitung,dengan menggunakan
T abel 5.20.

sesuai

y^ng

dapat

optimal.

Tabel 5.20. Proporsi Campuran Nominal.

iii. Konfirmasi campuran optimal dengan melakukan testing dan bila


Sebelum percobaan laboratorium dilakukan estimasi dulu resep
campuran nominal. Prosedur pemilihan reseP campuran nominal untuk
perkiraan suatu fesep campufan nominal yang sesuai adalah sebagai berikut:
Propotsi penakatan campurafl nominal ditetapkan dengan
^.
memperhatikan bentuk kurva gradasi untuk agregat yang sesuai secara baik
dengan batas gradasi yang ditetapkan sesuai Tabel 5.18 dan Tabel 5'19.
kasar secara umum harus terdiri dari batu pecah atau kedkil
Untuk
pecah.

afi

nan

pedu melakukan perubahan-perubahan resep campuran


KOMPONEN Cd,MPURAN
RENCANA

PROPORSI NOMINAI, TOTAL


( % BERAT DARI IUMI-AH CAMPURAN ASPAD
HRSS(A) HR$SG)
HRS
AC
AT]B

CA

0-1p

5-23

35

45

50

FA

88-CA-b

92-CA-b

65-FF-b

5s-FA-b

50-FF-b

FF

12

27

e4,5

>4,5

Total Kadar Aspall Carnpuran

TOTAL

100

100

100

r00

100

^gregat

CATATAN: Nilai b sesuai dengan Tabel

Tabel 5.18. Persy atatatr Gtadasi agreg^t kasar.


SARTNGAN

%BERATLOLO$
'' i'r,sARINGldN ,:l

314"

,, 100

'Y2':

3fl-100

318"

p-Es

No.4

0,10

No.200

,o-tr

UKURAN

5.14a.

campuran percobaan laboratorium harus dipersiapkan atas dasar


resep campuran nominal,tapi dengan vanan-vatian dalam proporsi
campuran

^gregat.,kadzr

bahan pengisi dan kadar aspal.

variasi campuran agregat sekurang-kunngny^ 3 proporsi terpisah


dari zgregat kasa43 campuran terpisah dari campuran pasir dan abu
batu,untuk setiap propotsi zgrg t kasar yang dipilih. proporsi pasir dan abu
batu diselidiki pada batas antzra kira-kira 2:l sampu 1:2. untuk setiap varian

campuran yang akandicoba sekurang-kurangnya 2 biket Marshall dan


sekurang-kurungny^ 2 camparan lepas yar.g tidak dipadatkan untuk
penentuan berat jenis maksimum. Sifat campufan yang disyaratkan harus
mengikuti rabel 5.1.6a. Gradasi dari kombinasi agregat dengan bahan
pengisi harus sedemikian rupa memenuhi persyaratafl batas gradasi untuk

I
xofl6G4ut<$J.)4t4U

Rancangan Bahan Perkerasan Jalan

212

ada
sesuai tabelaris atau grafrk gtidi:i kombinasi;trdak
kombinasi
^greg^t
baik diantara batas-baas
penyimPangan yang taiam dan terletak dengan
gtri"si. t"i adalahgradasi optimum dari campuran'
bergradasi terpilih'harus
Suatu campufan yang mengandung agregat
kadar aspal. Variasi kadar aspal
diperiksa dengan ,iauk krrrig drri 5 _.,u.i^i
ufut berat,sekurang-kurangnya
harus dipilih iengan penamb"aha n O,5o/o mefl
Benda uii diperiksa
,uanp^,,z,.,,i,.i"dibuo,ahkadaraspal y,rng diperkirakan.
dan I(adar Rongga Udara'
untuk stabilitas Marshal,Marshal Flow,Berat Jlnis
korelasi campuran
Pemeriksaan akan merlggambark'an hubungan-hubungan

5'8'

sebagaimana sudah dijelaskan pada sub-bab


memenuhi kriteria:
Biasanya kadar aspal optimum secaragaris besar
maksimal'
-kadai aspal yang memberikan stabilitas

- kadx
- kadar

aspat yat'g memberikan berat isi nraksimal'

^.prt

yo,,i memberikan kadar rongga udara minimum

yaltu

B|l:r'u. 2 : PERANCAN(,ANPERKER,4-S;4N-JALAN A!

minimum b' = 5,5 %o (untuk ATB=Asphalt Treated


ATBL = Asphalt Treated Base Levelling ).
minimum b' = 6,3 7o (untuk HRS= Hot Rolled Sheet,kelas

Base,atau

B, kondisi lalu lintas berat ).


.
minimum b' = 6,8 7o (untuk HRS kelas A,dengan kondisi
Ialu lintas rendah).
Nilai tipikal absorpsi aggregat di Indonesiadalam campuran
aspal adalah 1,2o/o (skala berat total campuran). Jadi nilai total kadar
aspal adalah

b = 6,7oh (untuk ATB dan ATBL).


b = 7,5 o/o (untuk HRS-B),dan
b = Boh (untuk HRS-A).

47o'

b. Propotsi nominal Campuran.

5.1l.7.2.Rancangan Campuran Bina Marga 1988'


RancanganCampufaniniberorientasiuntukmendapatkzrrcampuran
dengan durabilitas Yang tinggi'
:
Pendekatan p,,.ni^no:^t' Bil' Marga 1989 (G!r.5'16b')'adalah Spesifikasi
1. Kadar i*, effektip ditetapf,an lebih dulu,sesuai
yangada.

2. Campur^n aggreg^t,dilaksanakan dengan banyak variasi'untuk


r\purzn yang sesuai dengan kebutuhan
mendapatkan campuf
^rr-c
dan sifat- sifat Yang ditetaPkan'
ContohbatasdistribusiukuranpartikeluntukHRS'AC'ATBdan

lapis perata dapat dilihat pada Gbr'5'17'


3. Rongga ,io" t"tr"p'kut kriteria pokok'dalam hal optimalisasi

campuran aggreg t'

Untuk kebutuhan praktis kadar bitumen effektip ant^ra 4,7o/o sampai


7,4 o/n, kurva gradasi aggregat campuran,agar memberikan
camplrran yang tidak tedalu poreus maupun menyebabkan bleeding
adalah dengan void kira-kira sebesar 4oh. Contoh kurva perkiraan

distribusi ukuran partikel dan kadar aspal


^ntar^
effektip,untuk
campuran aspal dengan durabilitas(keawetan)
tinggi,dapat dilihat pada Gbr.5.18. Kurva ini berlaku untuk

hubungan

campuran aspal dengan menggunakan pen 85/100 dan kadar aspek


effektip untuk void udara 4o/o. Angka kadar aspal effektip
tersebut,adalah dalam prosentase total campuran aspal,sedangkan
kurva distribusi ukuran partikel,digambarkan terhadap berat dari
gabungan
^ggtegat-.

I(urva ini tipikal untuk seiumlah

a. Kadat Bitumen Rencana'

paling-pentiflg ant^t^
Berdasarkan philosofi diatas,perbe daan yang

jenis -fenis camPurall,ad^tit: kadar bitamen 'f'kt'p .@)'y"g


(b)'dikurangi
aia.firri.it un sebagai total kadar aspal campuran

tJUngrn

(A b)'
bitumerikarena absorpsi kedalam aggregat

b'=b-Ab

aspal
Didalam Spesifikasi yang baku,ada 3 tipe campuran
(hotmix),

panas

di Indonesiadan dapat
^ggregat
menentukall
campufan
nominal.
digunakan untuk
resep
Jumlah tipikal aggregat gabungan yang tertahtn saringan no.8
disebut CA(Fraksi Rencana Agregat Kasar). Jumlah yang diinginkan
untuk aryyegat yang lolos saringan no.200 dalam campuran, disebut
FF(Fraksi Rencana Bahan Pengis). Nilai FF,untuk campuran tipikal di
Indonesia,kirz-kira sebesar 4 sampai 5o/o dari berat total a,ggregat
gabungan. Karena kita mengetahui nilai CA dan FF nominal,dan
jug nilai total kadar bitumen nominal,kita dapat rnenghitung

NOU6T4U'<AJMI4N

Rancangan Bahan Perkerasan Jalan

n4
rsl,sborl il!*lt
ASTI'

'"rj
to !-

16

r.

I llt;iltl
r11i1

Proporsi reflcanz- campufan nominal ini,selalu dicantumkan clidalam


I)okumen I{ontrak Jalan untuk Perkerasan Lentur dengan

l0?

SIEVE SIZE

,mt3&O:Sro.olo rst3 El I { ?i 7t

,:F

'"r

IE

l.rrls q r1

tolrfsr iu*vl

otSiiell.rrt
tr4ltJ*

dengan rumus berikut ini.

lauts F[8lliEL

orf,un{ril tct(tr?

'or

r0F

*l,:I

Campuran Panas.

CA, FA, dan FF, dinyatakan dzlam skala berat toral campuran
(termasuk bitumen). Bilamana kita ingin mengetahui fraksi yang
setara dalam aggtegat gabungan,tanpa bitumen,dapat dihitung

I r ill

,"[-

B^K^ 2 : PER.ANoAN(ANPER-KERA,.SANJAL4N 2I5

Illrli

c/,_l00.cA
100-6

I rllt

'',r,-49'F!
- 100-b

oo,-W'!4
'"*
t00-b

............ (5.2s)

Gbr. 5.L8. [Iubungan kurva distribusi


ukuran Partikel
saringan no'
proporsi agrgegatyang lolos saringan no'8,tapi tertzha;fi
)OO,yuit" Flt(Fraksl Rencana Agregat Halus)'

cA + FA + FF + b = 100 %.........

""

200

*I

20mm

UkuronSoringon

cAl

'^

Lolos
Soringon

(5'24)

Kulvo grodosi

oggfegoilgobungon
liqil(ol

adalah'sesuai
Dengan demikian proporsi rencana campufan nominal
Tzbel5.21..

FA'

)rt

Tabel5.21. Proporsi Campuran Nominal BM'


ftanya sebagai Pedoman)

Gbr.5.19. Kurva gradasi fraksi gabungan


tanpa bitumen.

Ftaksi rencafl^ CA',IrA'dan FF',dapat digambar seperti pada Gbr.


5.19.

f
Rancangan Bahan Perkerasan Jalan

n6

NOy|6G8U116J

1424il

BAK\ 2 : PERANC,AN(ANPER-KERA.SANJAL^N

217

beban lalu lintas t^npa flashing) bleedingdan hilangnya stabilitas,namun


cukup rendah untuk mencegah masuknya udara dan kelembaban yang
berbahaya.

d) Cukup mudah dikerjakan,untuk

dapat melaksanakan penghampzran


campuran,secara effi sie n tanpa mengalami segregasi.

ii). TUJUAN KHUSUS

e).

W:,
Gbt.5.20. Fraksi rencana dan fraksi

Menetapkan batas

durabilitas (keawetan).

d. Kriteria Rancangan Campuran untuk Durabilitas tinggi.

Rancangan campuran,selalu tefcantum dalam

e. Prosedur Rancangan Campuran.

1.

a). Bitumen yang cukup untuk meniamin keawetan perkerasan'


b). Stabilita, yrrig memadai,sehingga memenuhi kebutuhan lalu lintas
tanpa distorsi atau teriadi pemindahan'

c)Ronggayzngmemadai_didalamtotalCampufanpadat,sehingga
adanya sedikit tambahan pemadatan akibat
masih

-.-rnlgkirrkan

Spesifikasi

I(ontrak,yang setiap saat bisa saja ber-ubah-ubah. Contoh kriteria rancangan


campuran seperti pada Tabel 5.16b.
Catatan: Durabilitas bitumen ditunjukkan dengan perubahan dalam
sifat penetrasi dan viskositas,terutama akibat udara panas yang mengganggu
keutuhan tebal lapisan aspal film.

c. Sasaran Perencanan Camputan Perkerasan Aspal Cara BM88'

i). TUJUAN UMUM


Tufuan umum r^nc ng^tl campuran aspal .adalah menetapkan
standar acuan)
penggabungan gradasi aggreg t y^ng ekonomis(dalam batas
ir., bi,orn"., yangakan menghasilk^n campvran dengan:

stabilitas campuran,untuk mengurangi

terjadinya retak.
0. Menetapkan batas atas dan bawah dari Marshall quotien,untuk
menjamin fleksibilitas dan membatasi deformasi dari campuran,
akibat lalu lintas.
g). Menetapkan maksimum ketebalan film aspal,yang mungkin unruk
mengurangi kecepatan oksidasi bitumen dan meningkatkan

batching.
batching
Proporsi fraksi renca na iangzn disamakan dengan,proporsi fraksi
hanya
tidak
.^-'p,.rrrt,dari masing--urirrg a'ggregat' Batu pecah misalnya
pory, fraisi CA saiJlapi |"ga fiaksi FA dan FF' Demikian iuga abu batu
fraksi FA'
misalnya,tidak hanya' punya"fraksi FF saia,mungkin saja punya
dalam
Dalam f^nc ng^n."*prriu.r (mix design),selalulah bekerja dengan
analisis fraksi
pengertian kadlr aspal effektip,bukan kadar aspal t.tal,dan
rencana,bukan fraksi batching.

^tas

2.

Pemilihan Agregat dan penentuan sifat-sifatnya.


- Gradasi
- BeratJenis dan Absorpsi
- Kerentanan agregat terhadap pengelupasan

Bentuk butir
tk^s^r
^gteg
Bentuk dan tekstur butir pasir
Penentuan Campuran Nominal
- Menentukan proporsi campuran nominal
- Data Gradasi
- Perkiraan absorpsi bitumen campuran
- Penentuan total kadar bitumen minimum dan kadar bitumen
fencana.

1
Rancangan Bahan Perkerasan Jalan

218

Penentuan campufan-camPuran percobaan untuk vatiasi gradasi

3.

agfegat.

4.
5.
6.

Perhitungan fraksi rencana dan luas permukaan'


Pembuatan dan Penguiian Briket'
Penentuan camPuran terbaik'

Membuat dan menguii variasi aspal dan bahan pengisi dari

B.

campuran pilihan.
Cek apakah kadar ronggz-rongga uclara tedalu tinggi'atau
I(adar roflgga-fongga r'tdara rendah,atau

9.

Kaclar ."riggn

7.

tingg4i,atau

",lri,

baik,dan Stabilitas maupun angka l(ucsien

rongga udara baik,tapi Stabilitas clan angka kuosien rerrdah


11. Pemeriksaan akhir labr-rratoriutn
12. Proporsi batching produksi dan kecepatan umpan'
10.

K;i;;

Secara diagramatis langkah-langkah diatas digambarkan pada


diagram alir pada LamPfuan B -1' 2.
5.10.1.3. Rancangan Campuran
o

Bina Matga

7997

'

Philosofi Dasar

I{eretakan pada perke tasan padaperiode 1,970-an umumnya disebabkan


fatik yang ,"rirai pu.1u wakt., ,.trtir dini dari umuf fencana. Periodc
lebih
selaniutnfa yaitu periode 1g80-an dimana kerusakan perkcrasan
'f.ant,'ngzn
yang
bznyak iisebabkan oleh deformasi plastis (pla.rtic flow).
dimana
ideal
a'spal
dihadapi adalah,bagaimana mendapatkan campuran
plasus dan
teriadi keseimbangin ant,.fL kemampua, menahan deformasi
retak hingga akhir umur fencana.

fatik yang terlalu


Secara teoritis untuk mencegah agar titlak terjadi retak
menjadr
sehingga
rupa
harus cliren.unLnn sedemikian

dini maka campufan


terhadap
lebih awet (clurabilitas tirgg,). Beberapa faktor yang berpengarutr
aspal dan
keawetan antar^ lain sifil aspal,kadar aspal efektip,tebal film
aspal darr
kadar
bahwa
ron+Ia didalam campuran. Teiah disebutkan diatas
t.UJ nn, aspal dalam campufan secafa 'rlumetdk dapat dinyatakan dalanr
volumt'
besaran ,ol.rme aspal dalam camPuran (\1trA)' Campuran-dengan
demikian
dengan
aspal vang ting3i akan *"*p,rnyui clurabilitas titgg.Jadi
.rrrtot'-"rrd"pirkr.r campufan yang awet harus disyafatkafl VFA minimunr
tertentu vang harus diPenuhi'

xou6c4uK6JxAtA%

Bu4,r'u.

2 : PERANCAN(AN PER-KER,4SANJALAN

219

Mengapa perkerasan mengalami deformasi plastis adalah pertanyaan


yang memedukan kaiian mendalam. Ada korelasi yang erat ant^ra deformasi
plastis dengan penurunan rc)ngga uda:a dalzm c^mpura;tr (VINQ selama
umur rencana perkerasan. Penurunan ini bermula dari rendahnya fongga
odara ranczfigan campuran Selanjuml,a laju terjadinya def<rrmasi plastis
ditentukan oleh faktor luar yaitr"r l,olume lalu lintas,beban gandx
kendaraan,tekanan ban,suhu perkerasan dan geometrik lalan. Dari hasil
penelitian campuran dengan VIl\{ dibawah ambang 370 mempunyai peluang
untuk mengalami defolmasi plastis lima kali lebih besar dari pada campuran
yang mempunyai VIiv[ lebih Lresar. Demikian pula perkerasan dangan VIM
yang lebih besar Cari 9rXr mempunyai peluang lima kali lebih besar untuk
mengaiami retali ilr'ri rracla campuran dengan VIM
3o/o-6oh. Dengan
demikian memhatasi VII4 pada masa pelayanan jalan^rftara
berkisar ant^r 30l,60/o
adalah persyarriran yang harus diikuti dengan cermat.
o Persyaratan

Karakteristik Campuran Aspal.

Pada Tabel 5.22 merupakan persyaratan kekuatan,kekakuan dan


kelenturan.Pada Tabel 5.23 adalah persyaratan keavietan dan pada Tabel

5.24 merupakan peffya;t^t^n ketahanan terhadap

deformasi

gradasi
dituangkan dalam Tabel 5. 25.
^t^tan
^gregat
Hal yang baru dari spesifikasi rancangan campuran Bina Marga 1.997 ini

p ias tis.

Pers y

adalah:

1.
2.

-)"

4.
5.

Diperkenalkannya prosedur pemadatan PRD (Percentage Refuml


Density) yaitu pemadatan hingga campuran tidak mampu
memadat lebih laniut.
Batasan rongga udara didalam campuran ditetapkan berdasarkan
prosedur pemadatan PRD.
Persyaratan batas minilnum rongga diantara
(VMA)
^gregat
relatif tinggi.
I)ipersr"aratkan volume minimum rongga terisi aspal $/FA)
disamping persyareLt^n VIM clan VMA.
Penumbukan untuk benda uji AC dan HRS disyaratkan 2x75
tumbukan tidak tergantung pada volume lalu lintas.

Pers1r21212n diatas nrempunyai satu sesa{an yaitu pemenuhan persy,.}ratar'}


ro,ngla terisi aspal(t/FA) dan rongga diantarz
(V\4A) dengan
^gregat
Marshall
2x
75
tumbukan
dan
persyararan rongga udara OIN,I)
irrosedur

dalam campuran setelah PRD.

Rancangan Bahan Perketasan Jalan

220

B\Kq 2 : PER-4NoANQANPER.KER.4S,*NJAL-AN

NOU6c4UNet74z4n

abe 5.25.

Tabel 5.22. P ercy

^rutafi

Kekuatan, Kekakuan dan Kelenturan


ilffitlilllil

HI]IIilW

$tflll0amPl]Mt

tl[$$

t00

fltt

8frt

{mml
87,5

r,5

totmhl

?rt

1,0

t$

850

tulorffm

trshfltloutml
[m$

2/

/t

aratafi Gradas

[fts$

[ll$t

nafi

llltt

lll

Iti

lt/[

B/{l

lf/c

B/C

il[

9ll-rrilt

$0-ffit

.sl

fim

ru0

,t

100

lffi

ilm

7Ii85

fi[ffi

9,5

B/8

$ll.t00

75-8[

35.55

28"58

l$.{5

2,36

il0.8

9tl-ilm

flt-?2

IFSIi

11,58

t$.45

ll,6110

iltt.Bll

15.60

rffi5

l|J75

il0J00

0.12

2-9

lz,[

8ffi

A{l

{inlril

TIBMTMNTII

Sililitrulliltullt[!)

T,

25

H[$

ffi

A[

-r:'ffi

'
'i'

ffi

Tabel 5.23. Persy

ffil"lf

illia

Iffi.Nil.05x1fl

ilttor

ffil"0,ixlff

[lir

^t^tafi

Keawetan'
ill

,tt

$/u

fl/{

$/{l

t8

l8

l$

16

illSti{tliunhl

65

$a

$[

$5

lalulida*bmat

$8

08

$8

$8

7l

7t

75

lfr

illin

}'l[[{y,}

til$.i

fiftsl.ll

20

20

7b

7h

m'$

m$

ft/{

B/C =Binder Course'

ffiurse,

Defotmasi Plasti S.

''r'^t.al ( ?4 PerswltutaLtr Ketahanan te

util

am['rf]rMDll[,tN

llrx

*-T--T-*rl
ml

[RSl

0,5x106.ffi['1ff

gtr.ggxl0r

mMli'lmltfl[
itmhdmlhtnrlurli

lalulinhs

80!/o clari agresat yang

lolos saringan

t
til

Persvaratan minimum VI]B merupakan upava untuk mcmperolch


campuran )/ang iebih arvet c'lan lentur sehingqa mempunyai ketahanan
rctak fatik yang iebih baik. Dipenuhinya rongga udara dalam campuran
dan rongga terisi aspal akan memberikan campuran veng seimbang yaitu
mempunyai stabilitas terhadap defrrrmasi permanen dan sekaligus
mempunyai ketahanan tcrhadap retak fatik yang tinggi. Hal ini tcrpenuhi
jika tersedia cukup VMA dalam campuran. Campuran aspal dengan
VN{A rendah akan menimbuikan kontradiksi terhadap dua kepenringan
diatas. Bila pada VMA rendah diberikan cukup banyak aspal untuk
mengisi ronsla 1.ang ada akan mucul masalah deformasi plastis karena
rerrdahnya VIM. Namun sebaliknya blla diberikan kadar aspal yang
relatif rendah untuk memenuhi syarat VIM akan timbul masalah
keawetan dan retak fatik karena kekurangan aspal.

VN{A vang cukup besar akan memberikan cukup ruang sehingga


cukup banyak aspal yang dapat ditampung tanpa harus mengorbankan
VIM. Besar VMA dalam campuran sangat ditentukan oleh gradasi
Oleh sebab itu faktor gyadasi sangat menentukan dan
^gregat.
merupakan faktor kritikal pada campuran ini.

$ngnomhpi
mhlalpmadatan

,tflillRs

NA,lff

l-7

2,36 mm hatus lolos pula pada sarin.gan 0,600 mm.

ffii

ffi

$ITITffMPtlMil

0,

,lffi

80

lilr$

Untuk campuran HIiS disyaratkan agar minimr:m

[ohhil

ll+ils[tuolfut{trlnnI
msl

l0-r5

CATATAN:

t0

ffi

l]lililrff$tftIilcilil

221

Penguiian PRD ( Percentage Refusal Density).

Pemadatan PRD dapat dilakukan dengan t,ibrating ltammer ata]o


mengikuti metode Marshall tapi dengan iumlah tumbukan 2x400 tirp
muka lapisan benda uji(extended A,larshalll.

I
Rancangan Bahan Perkerasan Jalan

222

Prosedur pemadatan PRD dengan uibrating hanmer dilakukan


alat untuk
dengan..r..rggo.rrkan cetakan cBR. Perlu sedikit modifikasi

$$tm

?cnqncfinfiAn

?enUen$sl|rc

Gbr.5.21. Alat PRD

dengan
memperrnudah proses pengeluaran benda uji dari tt?I^"- yaitu
Telapak
(Gbr'5'21)'
sisi cetakan
membuat potongan -.-*lrtg pada
-berdiametet
mm' Pemadatan
lingkaran
f.-rdut i.rb.Itok -diseluruh permukaan. 102
pemadatan pada
Lzrnz
clilakukan secafa mefata
pemadatan
semua titik adalah 2 menit. Unt.rk meratakan permukaan
terakhir clilakukan dengan telapak pemadat berdiameter 1.46 mm'
pada sisi
Setelah itu benda uii di[aik dan proses pemadatan diulangi
kedua.

?AHn

istem perancangan perkerasan jalan disini dimaksudkan suatu


sistem untuk pefancangan perkerasan ialan umumnya
dipolakan untuk kebutuhan pemantapan perkerasan pada saat
umur rencana bedangsung,untuk mempertahankan perkerasan ag t tetap
berfungsi dengan baik. Pemantapan ini tetap mengacu kepada standar baku
yang berlaku untuk per^ncarrg n. Pada periode 1980-an sampai sekarang
dikenal suatu sistem perancangan yang disebut RDS(Raal Design Syten)
y^flg memformulasi suatu perancangan perkerasan lentur untuk
memberikan arahan petunjuk (guideline) bag1 paru perencana agar waktu
perancangan yang dilakukan rutin dapat dilaksanakan lebih
cepat,komprehensif dan memberikan konstribusi kearah penyelesaian
masalah ialan secara terintegrasi sehingga dapat disusun program yang tepat
guna (efektip dan efisien) untuk mencapai ketersediaan dan berfungsinya
prasaran jalan yang handal dan bermanfaat dalam usaha untuk tetap
mempertahankan fungsi perkerasan jalan.
Program penanganan jalan dapat berupa:
- pembangunanialanbant
- rekonstruksi kembali jalan ada yang sudah mengalami kerusakan,
- peningkatan ja)an,untuk meningkatkan kondisi jalan yang sudah
mulai mengalami degradasi kerusakan,dan
- pemelihanan jalanuntuk mempertahankan kondisi jalar agar
tetap eksis pada perwujudan rancangan awal.

n3

I
224

1<ou6G4U116,J

trAJ.Au

B,t|<,. 2 : PERANCANqAN

PER-KER,4S,4N

Sistem Perancangan Perkerasan

JALAN

Disini tidak akan dibahas secafa rinci RDS ini,namun dasar


pemikiran yang melandasinya akan dibahas secara umum'

6.7.

PROSES PERANCANGAN

Road Design System sebenarnya merupakan suatu

slstern
perhitungan biaya untuk desain dan pembuatan dokumen tender dengan
spreadsbeelPemikirannya adalah untuk suatu pfoyek ialan yang

posisi:

6.I.1.. PENGUMPUI-AN DATA

rutin untul< kepentingan

225

Gbr.6.1. Beban dibarva oleh truck standar dengan berat kosong 5


ton,dimuati beban sehingga masing-masing roda belakang ban ganda 4
ton,dengan tekanan angin ban 5,5 kg/cm'.'Iumit batang (beam toe)
diposisikan di-tengah-tengah ban ganda belakang tepar dibawah pusat
muatan sumbu gandar. Lendutan balik dibaca pada jarum alatbzcadengan

-..rg4rrrr^kan
,.rrJm cli seluruh Inclonesia,memeflukan suatu sistem agar didapatkan
suatu estimasi biaya dan penyiapan dokumen lelang yang relatif cePat.

Secara

Jalan

posisi awal(posisi pertama),posisi dimana beban tepat beracla


pada tumit batang(d,).
posisi kedua,sejarak 30 cm untuk penetrasi,40 cm untuk aspal

beton dari posisi pertama(dr=pembacaan antara).


posisi ketiga,sejarak 270 cm(iarak C) dari posisi awal(d.)
posisi akhir,sejarak 9,00 m dari posisi awal (do).

kemantapan kelangsungan

jalan,dilakukan pengumpulan data sebagaimana pada Tabcl


perkerasan
^
Survai Benkelman Bcam menggunakan al2;t sebagaimana pada

6.

abel6.1. P

KELOMPOK
DATA

nData (Rutin
PE.NGAMI]1

DE,SI{RIPSI DATA

Surva.i Benkelman
Beam

Mencari data lendutan pada

Test DCP(Dynamic
Cone Penetrometer)

Mencari data CRR tanah das*r

Survai Iiekasaran
NAr\SRA

AN CONTOI{

WAKTU

LOKASI

<)

setiap 5-th atau


bilamana diperlukan

<)

<+ b.ilamana

<>

dioedukan

fencarta

Nlcncari data kekasatan


permukaan jalan

<+ setiap 1-th.

<) kekasamn rata,

Survai RNI(Road

Tipc dan lebx permukaan,jenis

<+ sctiap 5-th.

<+ gabungan pcr-km,

Neturotk
Ioventorv)

dan lebar bahu,tipe rlan dalam


saluran samping

Suroai Jembatan

l)ibatasi untuk bentang

Kecil/Culvert &

<+ setiap 1-th.

<+ setiap

iembatan

jalan eksisring

<

Survai'fraffic

r^ta per-segrl!en

iembatan/culvert

I)rainase

Survai Geometrik

t Ata-

ratr/l<m,

10,0 meter.

Inventarisasi perubahan
alinrcmen dan oenamnanq ialan
Suruai LHR drri Lalulintas

rata-ram per-segmen
fencanx

c*

setiap 10-th.

c)

4 Luniungan
per*staslon
pengamatan per 1th.. 48 iam utk iaiaa

utafira. 16 iam utk

(+ per-50,0 meter.

) 1+3 pengamatail
per-stasion pd.setiap
rurls,atau settanlak
dipedukan yang
tergantung pada
perubahan lalin.

ialan non-utama.

Survai DRP(Data
Reference Point)
Survai Kondisi

Gbr.6.1. Alat Benkelman Beam

Ialan
Survai Quarry

Surmi posisi titik


kilomeier&hektometer,iembatan
dan gorong gorong

(+

pada lokasi-lokasi

setiap 5-th. atau


bilaman diperlukan

penting pd,ruas

Kondisi permukaon,
bahudrainase a,Ltekstuf , retak
deoressi. lobans.alur dll.

+> setiap l-th,

pertimbansan ada.
<+ grbungan per-km.

Jenis,iumlah dan iarak sumber


material ialan.

<+ trilamana
dioerlukan

ialan,atau sesuai

{:)

lokasi sumber

duaffi.

I
226

14ofi66RUt<6,J

E;'itL({ 2 : PER^NCANq,AN PE1eKER^SANJ,4L*N

tr*J,Art

Sistem Perancangan Perkerasan Jalan

227
;

lRI = a.x2* bx *

Lendutan balik d*=pF.F-.FL(d4-d1)


dimana: Fr.,= faktor tergantung lingkungan
F-= faktor batang
Fr = faktor penyesuaian beban defleksi'

STOP NUT

(e-kruP lrclru)
HAMMER

lpalu prmukul)

NUT

ruF pmrukLll)

XAIX

ROD

(biltiuA unmal

( kc rucut)
-.COXE

Gbr.6.2.DCP

x
a,b,c

Skala

Test DCP(Dynamic Cone Penetrometer)


dilakukan dengan alat DCP (lihat
Gbr.6.2).AIat ini meruPakan alat
pengujian tanah dasar,dilakukan pada
kedalaman t 80 cm dibawah permukaan
tanah dasar.Hammer diiatuhkan pzda
ti.gg standar 20 inci(50,8 cm),dimana
keruiut(cone) masuk kedalam tanah Plot
relasi
iumlah Pukulan dan

^rrtzir masuk
kedalaman

cone,sehingga

mendaparkan suatu kurva. Dengan


mempiesisikan kurva yang terbentuk
dengn kurva standar,akan didapat nilai
CBR dari tanah dasar tersebut.
Survai Kekasaran Jalan dilakukan

dengan metoda NAASRA

untuk
suatu
kekasaran
mendapatkan angka
permukaan iilan yang dapat digunakan
untuk menilai kondisi ialan.

Prinsip dasar alat ini

adalah

mengukur iumlah gerakan verikal sumbu roda belakang terhadap tubuh


kendaraan sewaktu berfalan pada kecep^t^n tertentu (30+35 Vn/iam).
alat
Gerakan sumbu roda beiakangdalam arah vertikal dipindahkan kepada
pengukur kekasaran melalui Iabel yang dipasang di-tengah-tengah sumbu
selaniutnya dipindahkan ke counter melalaui flexibk diae.
,odi'b.lrt
"ng,yang
vertikal
Setiap putaran counter adalahsama dengan 1'5,2 mm gerakan
^t7t^r
kendaraan.
sumbu roda belakang dan tubuh
Ketidak-rataan j^lan mempengaruhi tenaga gerzk kendaraan dan
kenyamanan perialanan. Ketidak-tata-an besar akan menambah waktu
prri^l^r n d^., *.nyebabkan kerusakan suku cadang kendaraan. Ketidakrat^ -afl dibedakan dengan tolok ukur Indeks kekasaran Intemasional
data mentah harus dicatat
$Rl=Intemational Roughni Index). Pembacaan
pada kecepatan noriinal, 32 l<m/iarn dengan 5 lintasan pada setiap
t...."prt^tt nominal tersebut,untuk setiap seksi uiinya'

= hasil pembacaan NAASRA


= koefisien yangdidapat dari hasil kalibrasi.
IRI dapat dilihatpada Gbr.6.3.

THE TNTERNATTONAT. LOUCI{NESS rNDnX


sqAlp oF R0AD n0UGHNASS

irmt

'*--'":

20
18

::,i
,.{

EROSIONGULLEYS and
DEEP DEPRESSIONS

l6
t4
t2

t. ,..'....;

"' '

J0 ltrdh

-j tr

trnurt

FREQUENT SHALLOW
DEPRESSIONS SOME

l0

DEEP
FREQUENT MINOR

6
4

DE,PRESSIONS
SURFACE

tu

IMPERFECTiON

, *'',"., l
:
. ", *..'. j

t*l

kdlt

"*",.i

-*--i
""*-{ 80 Lntnr
*ILiroorn,ir,

:;
."'l

.. ' .*1

0
0=absolute
perfections
s

urnber: II RMS-Bin a Mar ga


Gbr.6.3. Skala

IRI

Survai RNI(Raal Nenaork Inaentory) merupakan survai inventarisasi


jalan,yang dilakukan untuk mendapatkan data:
- jenis dan lebar perkerasan
- jenis dan lebar bahu
- jenis dan kedalaman saluran samping.
Survai Jembatan dan Gorong- gorong(Calue@ untuk mengidentifisir
jembatan dan gorong-gorong,jenis,bahan,dimensi dan kondisi.
Jembatan
didalam program terpadu dengan jalan untuk bentang relatif kecil.Biasanya

dibatasi <10 meter. Untuk iembatan dengan bentang lebih dari

10

228 *on6c4ut16,J X4J,4n

E;'lI';. 2 : PER^NCANqAN

PETAKER,ASAN JAL-AN

Sistem Manaiemen
meter,d.imasukkan kedalam program yang terkait dengan
J

embatan @ MS= B i

dge s

M a n age nt n t 51 s.( m)
e

alinyemen
akibat
misalnya
horisontal alinyemen vertikal du., perrampang melintang

Survai Geoiretrik lahn,metiputi survai perubahan

jalanbaruatzubarangkaliakibatbencanaalam.Atausurvaiperbaikan
alinyemen
,li.r,u.*..t akibat p",-ri.rgi,,tut' lalu lintas atau peningkatan kualitas
itu sendiri.
Survaitrafflcdilaksanakanpadasimpul-simpullalulintasl,ang
diamati selama 48 iam untuk ialan
besar pacla

berpengaruh
iaringu.r,.l1t-t
1,61am
..rr-n |ang dianggui sebugui lokasi konsefltfasi lalu lintas utama,dan
untuk lalu lintas pada lalan-ialan sekitarnya'
Referensi,meliputi
Survai DRP(Data,R"f.,..,.. Point)=Data titik
survaipengumpulanlarak^nt^ra,patclk-patokkilometer,lrektometerSecafa
'ditupunlurr;k.b. tadaannya hilang
masih. utuh'Dapat i'g^
,-rfrt^
^t^u
dalam
sebagai
inventarisasi titik referensi lainnya yang berguna
^u)afl
untuk pcnclataan lain seperti RNI,RCS'atau I(ekasaran'
masuk'an

Sun.aikondisila|an6'CS=RoodConclitionsSurvel),meliputi
pengumpulandatapenampangmelintangialan,ilwentarisasidimensi,jenis
hrr-r'' t o.rasi perkerasan,kemiringan melintang ialan(camber),bahu,saluran
dengan
dan photo-pho,, yang dianggap penting per-stasion'perlintasan
sungai atau ialan lain'Dari sini akan didapatkan:
dll'
tekstur permukaan ialan apaiah bergelombang'leleh
- kondisi laPis Permukaan bitumen
- cekungan (de'pression) permukaan
- retak-retak (crack)
- iumlah lubang (Potlto@

daerah tambalan (Patchin!


alur bekas roda (rutting)

kerusakan tePi Perkerasan


kondisi bahu
beda tinggr ant^rabahu dan permukaan perkerasan
kondisi saluran samPing'
ini,baik
Penilaian konclisi jalan didap atkan dart survai kondisi ialan

Secafadestruktifmaupunnon_destruktif(lihatGbr.6.4.)
Survai quarry -trupuk"' survai kebutuhan. akan material
memang iauh dart lokasi
lokasi
ialan.Apakah tersedia disekitar
^t^v
perkiraan kuantitas
(terutama rencn ialan baru)Jenis material'iumlah

bahan,kualitas

buhu. p"'k"""tt'Dipertimbangkan pula untuk


cara eksplorasi,apakah cukup dengan alat bent zt^rt

mengidentifikasi
rnemerlukan car:' Peledakan dll'

Sistem Perancangan Perkerasan Jalan

229

6.1,.2. PEMASUKAN DATA


Data hasil pengumpulan data dikompilasi pada pangkalan data (data
data back-up periodik sesuai dengan sasaran waktu
pengambilan data.Lebih dikenal dengan SMD(sistem masukan
data),menyangkut deskripsi ruas,DRP,RNI,RCS,Roughness dan Data lalu
lintas. Data masukan ini dialokasikan untuk diintegrasikan dengan subsistem lain dalam rangkuman ?pa yang disebut IIRMS (Indonesian
Integrated Road Managemenr System).
Bagan Alir Road Design Module untuk prosedur perancangan
pekerjaan-pekerjaan utama dapat dilihat pada Gbr.6.5. sedangkan prosedur
petancangan untuk pekerjaan-pekerjaan minor dituangkan padabagan alir di
Gbr.6.6.
base),yang merupakan

6.2. TAHAPAN PROSES PERANCANGAN


Rangkaian tahapan proses perancangan didalam Road Design
System adalah:

Peryiapan data Proyk

Tahap

ini

merupakan pengumpulan data proyek yang sedang


berlangsung(on going projecl)data proyek barusiwayat penanganan
ruas jalan,perbaikan data paket dan lokasi proyek,pembentukan file
dan lokasi paket,commited proiect dll.

Segmentasi

Merupakan modul batas-batas administrasi jalan,batzs

ruas
jalan,r entane LHRT,rentang kekas aran,kekuatan perkeras an,kondisi
ialan(SDI),tipe permuka an,lebar perkerasan dll.

- Data Sectioning
Menyrrsun penyebaran segmentasi menjadi bagian-bagian sublink
untuk mengelompokkan seksi-seksi jalan atas lebar lajur jalan untuk
masing-masing identifikasi fl]as jalan,SN(structural number
=/ -6),voltme lalu lintas,jumlah lajur,tipe permukaan
-

Progrumning

Pembuatan progfam melalui proses desain berdasarkan standar


penanganan yang ada.
- Tiniauan keterbatasan dana (constrain budget)
Pemilahan proyek atas dasar ketersediaan dana,yang disusun
berdasarkan urutan prioritas sesuai kondisi ruas jalan dilapangan.
- Cetak reporr

280 xor16c,8uK67

74/,4fi

Pt Kq 2 : PER NCANqANPERKERAS.ANJALAN

Sistem Pe rancangan perkerasan J alan

231

Menampilkan hasil rancangan sistem sesuai dengan sistem masukan


data berupa susunan proyek menurut tip. dan tahun
pcnanganan,biaya,tipe program dan lain-lain.
- Pemaketan
Penyusunan paket penang^n n jalan berdasarkan lokasi,tipe program
untuk kepentingan tenderQelang) pekerjaan.
- Perancangan
Rancangan rinci untuk mendapatkan suatu gambaran struktur dari
perkerasan untuk masukan dokumen lelang.
- Review F.konomi.
Mengevaluasi kembali skenario penanganan berdasarkan moda
ekonomi,ketersediaan dana pendamping,merujuk pada masingmasingproiecl

6.3.

case.

STANDARPENANGANANPERKERASAN
Didalam proses perancangan perkerasan diperlukan adanya suatu

standarisasi peflanganan perkerasan untuk mendapatkan suatu standar baku


dan sekaligus pengendalian penanghnan dilapangan.
S tan dar pen afl ganan perkeras an beberapa diantar any a adalah:

b.

Standar penanganan proses desain perkerasan dalam konteks


Pro5ram penanganan,diberikan pada Gbt.6.7 .
Standar praktis penentuan tebal perkerasan diberikan pada
bagan alir di Gbr.6.8a sampai dengan Gbr.(r.Be.
Gbr.6.Ba. digunakan untuk desain tebal ponciasi atas dengan
bahan
t (agregat base).
^greg
Gbr.6.8b. digunakan untuk desain tebal pondasi atas dengan
bahan soi1-cement ( soil-cement base) dan atau lapis pondasr
bawah (soii-cement base equir.alent).
Gbr.6.8c. digunakan unruk desain tebai permukaan
fIURDA(DBS f) dengan bahan lapis ponclasi atas tnenggunakan
agregat,dan 6.8d. bila lapis pondasi atas menggunakan soilcement.
Gbr.6.8e. digunakan untuk desain tebal pondasi atas dengan
agregat basc-/ATB/lapis tarnbah IIRS.(seperti cliielaskan padr
buar 4.1.1.7.).
Standar Penanganan Perkerasan menurut RDS untuk program
Betterment (?eningkatan) dan program Periodic Maintenancc
(Pemeliharaan) clibcrikan pada f'abel

Pdfi0ftdldn ltofidiri

Fe{smrtfi Jilen

Gbr.6.4. Pengujian Kondisi Perkerasan


Jalan.

BIKu. 2 : PERANCANqAN

212 Xotl664ut<6J74J4u

PER.KER,4S,4N -JAL-AN

Sistem Perancangdn perkerasan Jalan

I,HR I]]\IUR R-L]NCANA


BEBAN SUMBU

TIPE PERMUKAAN
TIPE PONDASI

I)F,SAIN TEBAL

l,ENDLITAN

TtiRAt,
PRAKTIS
ACRtr)CAT

TE,tsAL PRAKTIS
ASPAL

PF]RIIITL]NGAN
I<I]ANTITAS

Gbr. 6.5.Prosedur Pek. Utama

Gbr.6.6.Prosedur Pek. Minor

2!B

234 Xonoteut$JtrAJ'Avt

P;LlldL.

Sistem Perancangan Perkerasan Jalan

2 : PER,ANCANqAN PERKERASAN JAI-AN

2t5

Gbr.6.6.Prosedur Pek' Minor(lanj utan)

0
TAN])A
PIiRKTiRT\SAil

pnoc;na,lr

> Blil*l'l,tRNIIiN'f

iRANC,\NGAli

I'F]RI{tr.lt AsAN

(-BR

N
V

Y
lRt>12

>l

IRI>llltmin

>

il.Flll/\Rr\N!0

IJIi'l"fFl.RNl[rNff

PIiRI()Dt(l

| '*""'

I
PI

tilirr'IjRr\lliNl

>

tlliTflrRMliNi'f

Iilt()Dt

PIiRIODI(]

SIiAI

st)I>50

N
V

TlDr\ K r\ D,'\
PT,N,\N(i,\N.'\iN

Gbr.6.7 . Standar Proses Penanganan


Perkerasan Jalan ( Sumber: IIRMS )

216

E;LLI',,.

2' PER-qNCANqAN PERKER,ASAN JALAN


Sistem Perancangan Perkerasan Jolan

'1ou6aquN6J74t4'1

237

Gtrr"{r'8tr'

Ghr.6"8c

Gbt6.8n

Gbr.6.8d.

SUIvIBER: RDS-Bina Marga


SUN,{BER : RDS-Bina Marga

ada bahan soil-cement a,= koefi sien kekuatan soil-cement dengan fumus

ai= 0,075 +0,039 UCS -0,00088 UCS (menurut HDM III-World Bank)
dimana : UCS= nilai unconfined compressive strength bahan pada umur
1,4hari (dalam MPa)

238 *on664ut1&1tr4tAtt

Pl;il<{ 2 : PER.ANCANqAN PERKER,ASAN JAL-AN

Sistem Perancangan Perkerasan Jalan

Pada Gbr.6.8a.

T,
T"+b

Pada Gbr.6.8b.

2!S

= tebal teoritis total (asphalt equivalent)


= total agrcgat base * sub-base(gravel equivalent)

\c = total soil-cement

base*tebal sub-base(soil-cement

base equivalent)

Pada Gbr.6.8c dan Gbr.6.8d sama dengan notasi Gbr.6.8a dan b.

+ T (lihat sub-bab 4.4.1.7dimana


4.25 dengan D= 8 mm,dznT dari persamaan 4.26_
Pada Gbr.6.8e. T..=1

sesuai persamaan

Tabel 6.2. Klassifikasi tipe penanganan(Sumber: RDS)


a). I{odefikasi dan ptogram

KATEGORI
PENANGANAN

TIPE STANDAR

PENANGANAN

KODE
PENAN

TEBAL
PENANGANAN

GANAN
Aspal

Pemeliharaan

Pemeliharaan rutin

P01

bedang

Holdinq(rutia)

P02

Penanganan

SBST

P11

Permukaan

SBST + lgysllinq

Pelapisan tambah

HRSL atau ACL

aspal satu lapis

HRSL atau ACL

Pelapisan tambah

PROGRAM

(cm)
Agregat

Periodik

P12

Periodik

P2',t

Periodik

P22

J=)

Periodik

HRSL atau ACL

P23

>5

Periodik

HRS+AT1]I,

P31

6+<7

Pcriodik

HRS+Agg.Base

P41

aspal banyak lapis

Rekonstruksi dgn

15

Periodik

AEresat Base
Pelapisan tarnbah

HRS+ATBL

p32

7+8

aspal banvak laoi

HRS+ATB+AEs.Base

P33

>8

Rekonstuksi dp;n

HnS+Agg.Base

p42

t5

Betterment

AEregat Base

HRS+ATB+Aee.Base

Pelebaran Laiur

dari

P51

<4,s0
<4,50
Ghr.6.Sc.

SUi\IBITR: RDS-Bina Marga

Bettcrment
Bettefinent

meniadi

I
o,t
I
I ,4,s

::tn'u I ;'

15

Betterment

p52

t5

Betterment

P53

15

Betterment

P54

15

Bettemrent

Sealing untuk ialan

HRS+Ag1.Base

P61

15

Befferment

vang belum

HRS+ATB+Ass.Base

P62

15

Betterment

I
B^KA 2 : PERANoANqANPER-KERASANJAL-AN

240'1otl6g4u&6Jx424|l
I{riteria Pelebaran

LHR PD
THN.DASAR

NUR

LEBAR
PERMUKAAN
DlPERI(ERAS,PA

TTAHUN KE-s)

(m)

<3,000
3.000+<8.000
8.000+<20,000
>20.000

4,50
6,00
7,00
2x7.00

LHR
PERTENGAFIA

<2.250
2.250+9.000

9.000+<15.000
>15.000

LEBAR
BAHU
(m)
1,00
1,50
2,00

200

l.ebar oraktis Pelebaran Pada Over la

LEBARPRAKTIS
PELEBARAN (m)

LEBAR TOTAL

P<0
0<P<0,3

0
0

Px

0,3<P<0,5

0,5

Px*0,50

Pd

O\IBRLAY(m)

2A

>5

30

Tabel6.3a.KriteriaTebaloverlayPraktisuntuktancanganBettetment

D
T"b"l .**"-

2 cm,tebal

TE,BAL

*,kto U*"t R"'it^"'


TEBAL
ATB (crn)

0
0
4,0

t-5,0

3
3

r^t^-r t^ minimum 3 cm'

4
4
4
4

0
0

t+T-6,0

T
T
T

4,A

r-6,0

TE,ORITIS,

TEBAL
HRS/HRSL

t oerkuatanlcm)

(cm)

t<3,0
3,0<t<6,0
6,0<t

3+T

t+T

0
4,0

TEBAL ATBL(cm)

Tebal minimum 2 cm,tebal rata-rata minimum 3 cm

Tabel 6.3d. Kriteria Tebal Ovetlay Praktis untuk rancangan


Periodic Maintenance pada kon disi AI)T>8.000 untuk Paruh waktu U R.

i). Pada futl-depth asphatt ouerlaltdibeiakukan tebal praktis sesuai Tabel


(strenghening)
6.3a,b,c dani; rriok rnengalokasikan tebal untuk pefkuatan
dan pembentukan(shaping)-lihat sub-bab 4'4'

B
C

KASUS

KASUS

HRS icm)

TE,BAL

t+T-3

<5

kondisi ADT<8.000 pada Paruh

TEBAL

Tabel 6.3c. Kriteria Tebal Oveday Praktis untuk rancangan


Periodicc Maintenance
nce pada kondisi ADT<8.000 untuk Paruh waktu
tu UR.

B
C

. Kriteria Tebal Overlay

t petkuatan(cm)

t<6,0
6,0<t<9,0
9,0<t<10,0
10,0<t

TEBAT I-APiS PADA PELEB4tu\N(g|*


AGG.BASE
ATB

t berkuatan{cm)
t<5,0
5,0<t<8,0
8,0<t<9,0
9,0<t

TEBALTEORITIS,

TEBAL

d). Tebal Lapis Pondasi Atas pada Pelebaran

TEBAL
TEORITIS.

KASUS

Px

Cnrrt^n. P- = lebar cksisting'P6=Lebar Perkerasan

KASUS

Tabel 6.3b. Kriteria Tebal Oveday Praktis untuk rancangan Betterment


pada kondisi ADT>8.000 pada Paruh waktu UR.

Tebal minimum 2 cm,tcbal t^t^-tat^ minimum 3 cm

LE,BARTEORITIS
PELEBARAN,P(m)

IEBAR LAJUR(m)

241

Sistem Perancangan Perkerasan Jalan

TEBAL
ATBL.(cm)

T
t+T-5$
T
T

A
B
C

TEBAL
TEORITIS,

TEBAL
AC/ACL

t oerkuatan(crn)

(cm)

t<4,0
4,0<t<7,0
7,0<t

4+T
t+T

0
0

4r0

TEBAL ATBL(cm)

t+T-4
Tebal minimum 2 cm,tebal rat^-t^t^ minimum 3 cm.

242 rOu6t&Ur16J

trAtAil

BqKq 2 : PER,ANoANqAN

ruailg Iill sengala dilffinng*ail diffdiafian mlal(

PEe.KERA.SANJAL-4N

UIIIN

EAtrTAR PUSTAKA

frecll

l.
2.
-)-

4.
5.

AASHO,Interim Guide for Design of Pavement Structures,


AASHTO,I972
AASHTO,Guide
for Design of Pavement Structures,
AASHTO,1986.
ASPHALT INSTITUTE,Construction Specifi cations for Asphalt
Concrete lsphal t Inst itute Specifi cation Series No. l .
ASPHALT INSTITUTE,Mix Design Methodslsphalt Institute
Manual Series No.2, 1995.
CEMENT&CONCRETE ASSOCIATION OF AUSTRALIA,
Thickness Design for Concrete Road Pavements,Technical Note,
1982.

6.
7.
8.

DEPARTEMEN KIMPRASWIL, Perencanaan Perkerasan Jalan


Beton Semen (PdT-14-2003), BSN 2003.
DIREKTORAT JENDERAL BINA MARGA, Konstruksi
Pondasi Jalan, Badan Penerbit Pekerjaan Umum, 1997.
DIREKTORAT JENDERAL BINA MARGA, Manual
Pemeriksaan Bahan Jalan, 01/MN/BM/1976, Bina Marga
1976.

9.

10.

DIREKTORAT JENDERAL BINA MARGA, Materials for


Asphalt Pavements, Post Graduate Program on Highway
Engineeting, ITB, 197 6.
DIREKTORAT JENDERAL BINA MARGA, Pedoman
Penentuan Tebal Perkerasan Interblock, 1988.

l. DIREKTORAT JENDERAL BINA MARGA, Petunjuk

t2.

13.

Teknis
Perencanaan dan Penyusunan Program Jalan Kabupaten, No.
7 7 lKPTSlDbl L990. Bina Program Jalan,l99}.
DIREKTORAT JENDERAL BINA MARGA, Petunjuk Teknik
Survai dan Perencanaan Teknik Jalan Kabupaten, No.
7 7 lKPTSlDbl 1990. B ina Program Jalan,l99Z.
DIREKTORAT JENDERAL BINA MARGA, Report on the

Road Design and Design Review Module, Bina Marga


1994.

14. DIREKTORAT JENDERAL BINA

MARGA,Standard
Construction
Highway
Specification for
1 97 6.
Umum,
P
e
keri
aan
P
enerb
it
197
2,8
adan
No.O 1 /ST/BMI
15. DJOKO LINTLTNG SOEDARSONO, Konstruksi Jalan Raya,
Badan Penerbit Pekerjaan Umum 1993.
t6. E.J.YODER - M.W.WITCZAK, Principles of Pavement Design,
John Wiley and Sons 1nc.,1975.
t7. ELWYN E.SEELYE, Design,-/ohn Wiley and Sons 1nc.,1960.
18. HANDI SAMUEL, Petikan Prosedur Aspal Puslitbang Jalan.
19. MARK FINTEL, Handbook of Concrete Engineerrng,Van
Nostrand Reinhold Company,l9T 4.
20. MOHAMAD ANAS ALY, Teknolngi Perkerasan Jalan Beton
Semen 2004,Yayasan Pengembang Teknologi dan Manaiemen,
2004
21. M.W.WITCZAK, Pavement Design Seminars, 1979
22. SILVIA SUKIRMAN, Perkerasan Lentur, NOVA 1993.
23. SNI-1732-1989-F,Petunjuk Perencanaan Tebal Perkerasan
Lentur Jalan Raya dengan Metode Analisa Komponen,Badan
Penerbit PU,1987.
24. SONY SULAKSONO W., Rekayasa Jalan, Departenten
TeknikSipil ITB 2001.
25. S.P.CHANDOLA, A Textbook of Transportations Engineering
S.Chand Company Ltd.200l.
26. TRL-UK., Overseas Road Note 31, Overseas Development
Administration,I993.
27. TRL-UK., Road Note 29, Her Majesty's Stationery Olfice, 1970.
28. TRL-UK., Road Note 31, Her Mojesty's Stationery Office,
t977.
29. TRRL-UK., Soil Mechanics for Road Engineers, Her Maiesty's
Stationery Offce,1974.
30. TRL-UK., Towards Safer Roads in Developing Countries,
Overseas Development Adminis tration, 1.991.
31. UU.No.14l1992,Tentang Lalu Lintas & Angkutan Jalan..
32. ZAMHARI KA., Metoda Perencanaan Campuran Aspal Panas
berdasarkan Spesifikas i b aru, Ker t a s Ke ri a,1997 .

DAtrTAR
.

LADflPIRADS

[AiIPIRAN- A

UMUM
( Lampiran

A-l

s/d A 4)

I,AIIPIBAI{. B

PERKERASAN LENTUR
(LampiranBls/dB12)
( Sumber: SNI -1732-1989-F )
TAIA IANA PERINIAI{AAN IIBAI, PMIfiRA$AIT I,IilTUN
IAI,AN NAYA D]I{GAN ANAI,ISA UNIODI I(OIIPONIN

LAIIPIRAI{.0

PERKERASAN KAKU
(LampiranCls/dCl5)
( Sumber: Pd T-14-2003)
PIRINOAI{AAI{ PIRIfiRASAil IATAI{

2U
245

B]IOil

$HIIDI{

ry
I,AIIPINAN A,2

=,
4
rl
4,

-*t
t)
lrl
a

-*t
t)

rr
F

=
=,

-a)

iri
far
t-2
t)
I

r<

I,AITIPIRAI{

4,3

I,AUPIMI{ A.3
I,UAS

I,AITIPIRAN A OIIUIO

PINAITPAilG IUI,ANOAN

IAIiIPIAAI{

zil

4,4

251

LltilprnAl{ B-r

P]I{H{IUN{ B]R[T I[I{I$ AOMfiAI dAN IBSORPSI


R
CBR
t00

10

90
80
70

60
50
40

30

20

l0
9

AGREGAT HATUS

6
5

4
4
3

GRAFIK KORETASI

:r*.DDr
HIIPIBII{ A(UU]N

MilPMAN B OINruNA$AI{ I,]NIUR)

I,AI{PIRAN

262

2i3

8,2

UIIPIRIIIB,3

0rheffiri(rqr.grl

roltffit:n{lo9*'h9l}

lt

lP,:

'y

P: l,llt

DDT

P:t,l6l
lP,:

19,

lP,r

l,l
trt.ll

ODT
l0

I
LER

10.000

;1

r*'1

ml
FR

'il1

FR

,l

,*l
t

0!r

,I

r0!

il

Nonqrrn
Nomogram

SUMBERT SNl.

I,AIUPINAN B (PIRIfiRASAN TDNIUR)

SU]{8ER : Sll! 1732.1989f

{732-1989't

utrtPIRlI{

(Ptmx[a$[t tmuuD

zil

zffi

mlPnNF4

mlPnil{&5

ITP

iil

:]

i:i;
I

DOT

ODI

TER

rI0!

m{

*l

o:rqrffir,usr.qrr

']

I.l
:ll
iil:l
l*r:l
]
,]

h.sru I

SUil8E[: Slll 173249{$f

mlPmN B(Ptn[xm$ilEilnm)

uilumil B0[m]m$ilEilruD

j]

zffi
I,AIIPIRAI{

257

8,6

I.AIIHMI{ B-7

6:

rcaffi:l(rorr.tqf

Pst.l6l
P1: l,t
Q: I,t.l,0

TER

*l

0!00r
IER

,*l
t0l

;1

F8

*l

ot1

-J

,i

T.l
ro.l

'oo

,J

${

,J

FR

I]

:i
!.

,i
ott

:l
.

llmogran

llmogHn

6.

5.

SUttBER : Slll.{ 732.{ 989.F


SUIIIBER r Sll! I

I.AilPIMil

B OINrcNA$II{

I]MUD

7324989f

el

mxtHnat{ B (PtnrcB[$ril mmuD

25E

uilPml{}E
ITP

DDT

TER

3
:1

-l

,l

Mlpl[|il BOIMMI$II{IfiMID

mlPmN [ (P[Rxlna$r{nmm)

260

I,AIIPIAAI{

UilHNAI{ B4O
X

O
rr)

.+

P: t,li t

=
=
'31n2
-;d:

+
rr)

lll

=!!: a

(,

-^rco^
i:5+ol;1
.ooC*-

O
ol

l,

C
=i

n a
ta

a)

r-

c.
P-

-a
E

t/)

0Jr

nl
,11

ill

\c
C
o .:i_

-EtJ
4,
4)

F
r!

o
,

-o

!
d

!d^
=+-

icu

Zi'-r.

..:

o:^

i.:

C\C\O\DoO

'.'':
3tO=1

l:

r-f

- ^l-N

P-

o
d

rr)

.-c-

i6^r''cc

.:u!

a'd

---rttttl
rt=ooo:'-,,

=
IG

r ^

5 t- r7, ry ci !
=O=o.a.^

a,=)
dFC

4 c.o-, ,.,

fiDU

---trD:C,oX{r-t
r rof,

+
o
d C

=,
4

)1)l
'/- dl

z
a)

d
d

-4
(5

)t

tr

-ud
)
-.9

r./=f(\++

.{
C

gl

l= t=?
a -l-.!-r,rrll-i
.LN6l:)J.aC\)

FR

&

ci

2
I

ii

-?^='
L

Ct\

"o
+

O\

olco@coc
t ,o"o.l-el
I I I I
"+ -t ra @ o]
tr)tal*-

O
.E

| I

,i1 .a i\ I -r

,= ll?
=
Y'ryoo+-DcC+O"i.lN
\r-tcl.lC

O
d
d
!

co

rr)6\j-La\cco_
--o\rro"aCl-U
I I I I I
r,q)<-Or2Oq.)
\O:j-.oN+d

I ^

\c
o O
+
6
!

lPl: I
19.:

S$

\t

261

t^ r'. o;,oX
r^ rSlcotr--i
o
-,

tr)

x
0rhffi:ilrolr'rorrl

B4I

nLn6a\l^^,
t
al tc) -, a) vt\
SrnC I I I I r
-l-O.nCO.^+N

La)

r.EE

tr

-ee,

'-fo5n

EI

<(

Nmogran 9,

Ln Ln .i .^
I ^ ro ca c..l 'i'l ^, m
:ro
I I I r |
-' rn-c^-(\

O
$
O
N

c^!!!(!
t:=

-riH
a,

sn^

cd

d
.U

E
d

(J
4

SUMBER : SNl.t 732-{989-F

Z rl!

F
:trtr7=

..U/'r\

4-Yac
^".".

;O ZZ
F
U

mlPml{ B,l2

262

Hfiptmilc.l

LAIiIPIRAN

Tesansan

C-2

,?lljiHil"ara)

2rt4

perkerasan T^rna
Bahu Beton
Tanpa Erar
dan Faktor Erosiuntuk
(laniutan)

LAMPIRAN

C-3

26i

Tegangan Ekivalan (Setara) dan Faktor Erosi untuk Perkerasan Tartlxt B;rlrtl Ilttlott

#3

zffi

IIIIPTRAN C.4

Tegangan Ekivalan

a) dan Faktor Erosi untuk Perkerasan

Bahu Beton

lffrtPnali

[,5

2b7

Tegangan Ekivalan (Setara) dan Faktor Erosi untuk Perkerasan Dengan Bahu Betort

Tegangan Ekivalan (Setara) dan Faktor Erosi untuk Perkerasan Dengan Bahu Beton

I,AIIPIRAil C.7

NOMOGRAM REPETISI BEBAN IJIN (FAKTOR }'ATIK)UNTUK


DGN/TANPA BAHU BETON

r"
1,,

F"
F50
t

^t
r- l-cs
:lol
=t
et

-[
P [-ro
ol
=l

JI
EI

:tF":s
?

tt
3t

TT

t l-ro

1l
OL
pl
ol

L,'

Sr

df

tt'
fA

0.1a

TL
PL

r*f

'so

L,
f

L,t

i
L*
INAI,ISA TAIII( IIAN BIBAI{ NIPITISI

Derdasarlian nASI0 TIGAI{GAN

unluh DTilGAil/TANPA

BAHU BTTON

ITIIPIRII{ O OMruIASTI{ [A[U)

Uil

I,AIIPINAil

.[.8

270

I,AITIPIRAI{

[,9

ilOItIOfiRAII

NOMOGRAM REPETISI BEBAN IJIN (FAKTOR EROSI) TANPA


BAHU BETON

RIPIINI

271

BTBAI{ UN ([AI(TON INOSD DINOAN BATU


BTTOI{

.100000000r,
65

65

60

60
2

2.0

50

r0 000 000

E
5
o
a

30

25

3J

:oi!

12
3.r

r!

r00 000

3.0
20

a
G

t0

-o

aa

ao

o
IL

It

z
Y

uI

o.

J
a!
at

&
a
t

c
0

!na

t.E

L1

tr

l!
.o

'll

?
t

000 000

UI

!t

L2

2
J
1

l'

.e
o

?3

LO

2.6

fl
(5

r0

fi

t3

?.1

zJ

5S

10

:l:

l.t

E,

t.6

o.
c,

15

.o

,ANALISA EROSI DAN JUMI-AH RE,PETISI


BEBAN IJIN,BERDASARKAN FAKTOR EROSI
DENGA}I KONDISI TANPA BAHU BETON

LAIrtPmil{

t 0DA[xRASil{ [A[U)

AI{AI,I$S MOSI DAI{ IUIII,AII NIpIINI


BIBAN UIN BTRDASANIGil TAI(IOR TROSI
UilTUI( IOilDISI DTilGAN BAIIU BITOil

I,AITIPIRAI{

(PIRruNA$AI{ IGIIU)

toto
E

a
E

27:t

272

uilPnil (,il

I,AI{PINAI{ C,Il)

FAKTOR KONVERSI TAPIS PERKERASAN I,AMA untuK PERENCANAAN


TAPIS TAMBAHAN MENGGUNAKAN PERKERASAN BETON ASPAT

IIIBUI{GAN IBN DAN I(

C'

.a

ct?

ct

Gl
!

,F3

EE
.ln

-u 2u

ii
(U

E3

Fat

: trd

t
\

H }ri
E U?

{!

:z

s2
t4 4
<,-r
G
Llle
2a
.:o <V
;<
o

E
=

6A
Q

Gr
=orD

(yo) olleU Eurreag

I,IUPIRAI{

#E

=zp
\
\

gEE

At-1

Gr

Eluro#lrC

OENruRASAil

IMru)

I.lilpnlil t (Dmrmrri[ I{inn

milHmil

274
0,12

raupmN

ESTIMASI TEBAT PETAT BETON,LALIN DATAM KOTA, TANPA

ESTIITIA$I TIBAL PEI,AI

BIION,I,AI,Iil DAI,AII I(OIA, OilYAIil

frUil

frUII

io
E
E

ls

Ec

lH

fiE*

nI

H$fr

f,+E

Iq{

HE
tf,l.I

Ii$

h$H

f,Er

triI

fitr

8#fr
E,jt 9

f, E'q

il

"'I

l'[!

Esf;
^JIE
FIEsdH

flH$

-rl
tll I

{uH

E7
HS

=tE

-lH

E
Ei

3f;f
ZHH

frr#
trl ll tt

;fl8

EErl{ r!

t1
H1

EdmU

'E

-F

nLrI r!l-

I,AIIPIRAN O ( PMrcNASAT
I,AIIPIRAI{ C ( PMITNASAN IIAIru )

l*t{
I TE

+*E

ln{-e
11f,il S.r- E*56 1''Ht- 1

r:li

IGIil )

F{E

r,atprnari
ESITITIA$I

IIBAI,

PEI,AT BTIOI{,I,AI,IN LUAN

I(OIA,

IIilH

[2.11

277

frAT

ilIIIPIRAN O.I5
ISTIMASI TEBAT PELAT BETON,IAIIN IUAR KOTA, DENOAN frA.TI

"= .$
.EH

"'

.T

i
ld

T{

H
j

,I

#E

]I

lIrd

|ft

t}

tr
tr
E

i{

lE
lo

l=

l{

;t
f,

ts

H
{l

ooH
rJ

n r*.lpa#*-6*;

EITH

{E
H9

E
ta

,tE .i
H

ff

EEg
ElnE

r!

iH

H+tr

E
*ll

"",!F
*.EH

u r{
rl

tl

N
\,|

II

.'h

1d{

ll

-!
L

E+t
EF

fl

tr

'f

.:
-

\
h

t' I

Il|

r{

Til
HE

il

E.E

lr

tl

Hg

tlxH
*

t \

l\

ra

"" #H
E EEo

I,AIUPINAI{

( P[R[[RASAI{ IGIU )

E
H

E
H

tc

irl

F{

.1
EI&t
E

rIr

F.

H
E

d
rc
u
E

a
Ii

J'6 nU
rlr l+

.I,$$

tf'

oou

E
O'n+-tr
ot*rlpc.o$am(u)

ri

t t.l d

HH

=
#+{ H
l#H

i
1

J
B

o
rn

I,AIIIPIRAN O ( PMIMRASAN

IMIU )

dt
FI