Anda di halaman 1dari 28

BAB I

PENDAHULUAN
1.1

Latar Belakang
Sepsis merupakan suatu kondisi kerusakan sistim imun akibat infeksi.Hal
ini merupakan masalah kesehatan dunia karena patogenesisnya yang sangat
kompleks dan pengobatannya yang sulit serta angka mortalitasnya yang tinggi
meskipun selalu terjadi perkembangan antibiotic yang baru.Sepsis terjadi di beberapa
Negara dengan angka kejadian yang tinggi, dan kejadiannnya yang terus
meningkat.Berdasarkan data Epidemiologi di Amerika Utara bahwa sepsis terjadi
pada 3 kasus dari 1000 populasi yang diartikan 75.000 penderita per tahun.(Guntur A
H,2007)
Angka mortalitas sepsis mencapai 30% dan bertambah pada usia tua 40%
dan penderita syok sepsis mencapai 50 %.Meskipun selalu terjadi perkembangan
antibiotic dan terapi perawatan intensif,sepsis menimbulkan angka kematian yang
tinggi dihampir semua ICU.Sindrom sepsis mulai dari Sistemic Inflammatory
Respond Syndrome (SIRS) sampai sepsis yang berat (Disfungsi organ yang akut) dan
syok sepsis (Sepsis yang berat ditambah dengan hipotensi yang tak membaik dengan
resusitasi cairan).(Kasper,2005)
Terapi utama meliputi resusitasi cauran untuk mengembalikan tekan
sirkulasi darah, terapi antibiotic, mengatasi sumber infeksi, pemberian vasopresor
untuk mencegah syok dan pengendalian kadar gula dalam darah.Sepsis akan
menyebabkan terjadinya syok, sehinggga berdampak pada kerusakan organ.Respon
sepsis dapat dipicu oleh trauma jaringan, ischemia-reperfusion injury, endokrin dan
eksokrin.(Guntur A H,2007)
Bakteri gram negative terdpat endotoksin yang disebut lipopolisakarida
(LPS) yang terletak pada lapisan terluar.Lapisan luar membrane bakteri gram
negative tersusun atas lipid bilayer, yaitu membrane sitoplasmic dalam dan luar yang
dipisahkan peptidoglikan. .(Guntur A H,2007)
Sepsis terdapat produksi mediator-mediator inflamasi atau sitokin.Makrofag
merupakan salah satu mediator seluler, makrofag memegang peranan penting dalam
pathogenesis syok sepsis.Penelitian terakhir menunjukkan bahwa LPS dapat
i

menurunkan kemampuan IFN-gamma atau LPS untuk memacu Inducible nitric oxide
synthase (Inos) pada kultur makrofag sehingga NO mengalami penurunan.
1.2

Rumusan Masalah
Berdasarkan latar belakang yang diuraikan diatas maka dikemukakan
rumusan masalah sebagai berikut :
1.
2.
3.
4.
5.
6.

Apa definisi dari Syok Septik?


Apa etiologi dari Syok Septik?
Bagaimana patogenesis dari Syok Septik?
Bagaimana manifestasi klinis dari Syok Septik?
Bagaimana patofisiologi dari Syok Septik?
Bagaimana Penatalaksanaan dari Syok Septik?

1.3

Tujuan

1.3.1

Tujuan Umum
Mengetahui penatalaksanaan dari syok sepsis.

1.3.2
1.
2.
3.
4.
5.
6.

Tujuan Khusus
Mengetahui definisi dari Syok Septik
Mengetahui etiologi dari Syok Septik
Mengetahui patogenesis dari Syok Septik
Mengetahui manifestasi klinis dari Syok Septik
Mengetahui patofisiologi dari Syok Septik
Mengetahui Penatalaksanaan dari Syok Septik

BAB II
TINJAUAN TEORI
2.1

Definisi
Syok adalah kondisi kritis akibat penurunan mendadak dalam aliran darah
yang melalui tubuh.(Kamus Keperawatan).
Syok adalah suatu keadaan serius yang terjadi jika sistem kardiovaskuler
(jantung dan pembuluh darah) tidak mampu mengalirkan darah ke seluruh tubuh
dalam jumlah yang memadai. Syok biasanya berhubungan dengan tekanan darah
rendah dan kematian sel maupun jaringan.(Nasroedin,2007)
Syok terjadi akibat berbagai keadaan yang menyebabkan berkurangnya
aliran darah, termasuk kelainan jantung (misalnya serangan jantung atau gagal
jantung), volume darah yang rendah (akibat perdarahan hebat atau dehidrasi) atau
perubahan pada pembuluh darah (misalnya karena reaksi alergi atau infeksi).
Sepsis adalah adanya SIRS (Systemic Infalammatory Respondense
syndrome) di tambah dengan adanya infeksi pada organ tertentu berdasarkan hasil
biakan positif di tempat tersebut. Definisi lain menyebutkan bahwa sepsis merupakan
respons systemic terhadap infeksi, adanya SIRS ditambah dengan infeksi yang di
buktikan (proven) atau dengan suspek infeksi secara klinis.
Berdasarkan Bone et al, SIRS adalah pasien yang memiliki dua atau lebih
criteria :

Suhu >38 C atau <36


Denyut Jantung >90x/menit
Laju Respirasi >20 kali/menit atau PaCO2 <32mmHg
Hitung Leukosit >12.000/mm3 atau >10 % sel imatur/band.
Penyabab respon sistemikdihipotesiskan sebagia infeksi local yang tidak
terkontrol,sehingga menyebabkan bakterimia atau toksemia (endotoksin/eksotoksin)
yang menstimulasi reaksi inflamasi di dalam pembuluh darah atau organ lain.
Sepsis secara klinis dibagi berdasarkan beratnya kondisi, yaitu sepsis,sepsis
berat, dan syok septic.Sepsis berat adalah infeksi dengan adanya bukti kegagalan
organ akibat hipoperfusi.Syok septic adalah sepsis berat dengan hipotensi yang
persisten setelah diberikan resusitasi cairan dan menyebabkan hipoperfusi
jaringan.Pada 10% -30 % kasus syok septic didapatkan bakterimia kultur positif
dengan mortalitas mencapai 40-150%.
i

Syok septik adalah Shock yang disebabkan infeksi yang menyebar luas yang
merupakan bentuk paling umum shock distributif.
2.2

Etiologi
Penyebab terbesar adalah bakteri gram negatif. Produk yang berperan
penting terhadap sepsis adalah lipopolisakarida (LPS), yang merupakan komponen
terluar dari bakteri gram negatif. LPS merupakan penyebab sepsis terbanyak, dapat
langsung mengaktifkan sistem imun seluler dan humoral, yang dapat menimbulkan
gejala septikemia. LPS tidak toksik, namun merangsang pengeluaran mediator
inflamasi yang bertanggung jawab terhadap sepsis. Bakteri gram positif, jamur, dan
virus, dapat juga menyebabkan sepsis dengan prosentase yang lebih sedikit.
Peptidoglikan yang merupakan komponen dinding sel dair semua kuman, dapat
menyebabkan agregasi trombosit. Eksotoksin dapat merusak integritas membran sel
imun secara langsung (Hermawan, 2007).

2.3

Patogenesis
Sepsis melibatkan berbagai mediator inflamasi termasuk berbagai sitokin.
Sitokin proinflamasi dan antiinflamasi terlibat dalam patogenesis sepsis. Termasuk
sitokin proinflamasi adalah TNF, IL-1, interferon (IFN-) yang membantu sel
menghancurkan mikroorganisme yang menginfeksi. Termasuk sitokin antiinflamasi
adalah interleukin 1 reseptor antagonis (IL-1ra), IL-4, IL-10, yang bertugas untuk
memodulasi, koordinasi atau represi terhadap respon yang berlebihan. Apabila terjadi
ketidakseimbangan

kerja

sitokin

proinflamasi

dengan

antiinflamasi,

maka

menimbulkan kerugian bagi tubuh.


Endotoksin dapat secara langsung dengan LPS dan bersama-sama
membentuk LPSab (Lipo Poli Sakarida antibodi). LPSab dalam serum penderita
kemudian dengan perantara reseptor CD14+ akan bereaksi dengan makrofag, dan
kemudian makrofag mengekspresikan imunomodulator. Hal ini terjadi apabila
mikroba yang menginfeksi adalah bakteri gram negatif yang mempunyai LPS pada
dindingnya.
Eksotoksin, virus dan parasit yang merupakan superantigen setelah difagosit
oleh monosit atau makrofag yang berperan sebagai Antigen Presenting Cell (APC),
kemudian ditampilkan dalam APC. Antigen ini membawa muatan polipeptida
spesifik yang berasal dari Major Histocompatibility Complex (MHC). Antigen yang
i

bermuatan pada peptida MHC kelas II akan berikatan dengan CD4+ (limfosit Th1
dan Th2) dengan perantaraan TCR (T cell receptor).
Limfosit T kemudian akan mengeluarkan substansi dari Th1 yang berfungsi
sebagai immunomodulator yaitu: IFN-, IL-2 dan M-CSF (Macrophage Colony
stimulating factor). Limfosit Th2 akan mengekspresikan IL-4, IL-5, IL-6, dan IL-10.
IFN- merangsang makrofag mengeluarkan IL-1 dan TNF-. IFN-, IL-1 dan
TNF- merupakan sitokin proinflamasi, pada sepsis terdapat peningkatan kadar IL1 dan TNF- dalam serum penderita. Sitokin IL-2 dan TNF- selain merupakan
reaksi sepsis, dapat merusakkan endotel pembuluh darah, yang mekanismenya
sampai saat ini belum jelas. IL-1 sebagai imunoregulator utama juga mempunyai
efek pada sel endotel, termasuk pembentukan prostaglandin E2 (PG-E2) dan
merangsang ekspresi intercellular adhesion molecule-1 (ICAM-1). Dengan adanya
ICAM-1 menyebabkan neutrofil yang telah tersensitisasi oleh granulocytemacrophage colony stimulating factor (GM-CSF) akan mudah mengadakan adhesi.
Interaksi neutrofil dengan endotel terdiri dari 3 langkah, yaitu:
a.

Bergulirnya neutrofil P dan E selektin yang dikeluarkan oleh endotel dan L-

b.

selektin neutrofil dala mengikat ligan respektif


Merupakan langkah yang sangat penting, adhesi dan aktivasi neutrofil yang
mengikat intergretin CD-11 atau CD-18, yang melekatkan neutrofil pada endotel

dengan molekul adhesi (ICAM) yang dihasilkan oleh endotel


c.
Transmigrasi neutrofil menembus dinding endotel.
Neutrofil yang beradhesi dengan endotel akan mengeluarkan lisozyme yang
melisiskan dinding endotel, akibatnya endotel terbuka. Neutrofil juga termasuk
radikal bebas yang mempengaruhi oksigenasi pada mitokondria dan siklus GMPs,
sehingga akibatnya endotel menjadi nekrosis, dan rusak. Kerusakan endotel tersebut
menyebabkan vascular leak, sehingga menyebabkan kerusakan organ multipel.
( Meisner M,2000)
Pendapat lain yang memperkuat pendapat tersebut bahwa kelainan organ
multipel disebabkan karena trombosis dan koagulasi dalam pembuluh darah kecil
sehingga terjadi syok septik yang berakhir dengan kematian.
Untuk

mencegah

terjadinya

sepsis

yang

berkelanjutan,

Th2

mengekspresikan IL-10 sebagai sitokin antiinflamasi yang akan menghambat


ekspresi IFN-, TNF- dan fungsi APC. IL-10 juga memperbaiki jaringan yang rusak
i

akibat peradangan. Apabila IL-10 meningkat lebih tinggi, maka kemungkinan


kejadian syok septik pada sepsis dapat dicegah.(Hermawan, 2007).
2.4

Patofisiologi Syok Septik


Endotoksin yang dilepaskan oleh mikroba akan menyebabkan proses
inflamasi yang melibatkan berbagai mediator inflamasi, yaitu sitokin, neutrofil,
komplemen, NO, dan berbagai mediator lain. Proses inflamasi pada sepsis
merupakan proses homeostasis dimana terjadi keseimbangan antara inflamasi dan
antiinflamasi. Bila proses inflamasi melebihi kemampuan homeostasis, maka terjadi
proses inflamasi yang maladaptif, sehingga terjadi berbagai proses inflamasi yang
destruktif, kemudian menimbulkan gangguan pada tingkat sesluler pada berbagai
organ.( Vienna,2000)
Terjadi disfungsi endotel, vasodilatasi akibat pengaruh NO yang
menyebabkan maldistribusi volume darah sehingga terjadi hipoperfusi jaringan dan
syok. Pengaruh mediator juga menyebabkan disfungsi miokard sehingga terjadi
penurunan curah jantung.
Lanjutan proses inflamasi menyebabkan gangguan fungsi berbagai organ
yang dikenal sebagai disfungsi/gagal organ multipel (MODS/MOF). Proses MOF
merupakan kerusakan pada tingkat seluler (termasuk difungsi endotel), gangguan
perfusi jaringan, iskemia reperfusi, dan mikrotrombus. Berbagai faktor lain yang
diperkirakan turut berperan adalah terdapatnya faktor humoral dalam sirkulasi
(myocardial depressant substance), malnutrisi kalori protein, translokasi toksin
bakteri, gangguan pada eritrosit, dan efek samping dari terapi yang diberikan (Chen
dan Pohan, 2007).

2.5

Gejala Klinis Sepsis


Tidak spesifik, biasanya didahului demam, menggigil, dan gejala konsitutif
seperti lemah, malaise, gelisah atau kebingungan. Tempat infeksi yang paling sering:
paru, tractus digestivus, tractus urinarius, kulit, jaringan lunak, dan saraf pusat.
Gejala sepsis akan menjadi lebih berat pada penderita usia lanjut, penderita diabetes,
kanker, gagal organ utama, dan pasien dengan granulositopenia.
Tanda-tanda MODS dengan terjadinya komplikasi:
Sindrom distress pernapasan pada dewasa
a. Koagulasi intravascular
a. Gagal ginjal akut
i

b.
c.
d.
e.
f.
2.6

Diagnosis

2.6.1

Riwayat

Perdarahan usus
Gagal hati
Disfungsi sistem saraf pusat
Gagal jantung
Kematian. (Hermawan, 2007).

Menentukan apakah infeksi berasal dari komunitas atau nosokomial, dan


apakah pasien immunocompromise. Beberapa tanda terjadinya sepsis meliputi:
a.

Demam atau tanda yang tidak terjelaskan disertai keganasan atau


instrumentasi

b.

Hipotensi, oliguria, atau anuria

c.

Takipnea atau hiperpnea, hipotermia tanpa penyebab yang jelas

d.

Perdarahan

2.6.2

PemeriksaanFisik
Pemeriksaan fisik diperlukan untuk mencari lokasi dan penyebab infeksi
dan inflamasi yang terjadi, misalnya pada dugaan infeksi pelvis, dilakukan
pemeriksaan rektum, pelvis, dan genital.

2.6.3

Laboratorium
Hitung darah lengkap, dengan hitung diferensial, urinalisis, gambaran
koagulasi, urea darah, nitrogen, kreatinin, elektrolit, uji fungsi hati, kadar asam
laktat, gas darah arteri, elektrokardiogram, dan rontgen dada. Biakan darah, sputum,
urin, dan tempat lain yang terinfeksi harus dilakukan.
Temuan awal lain: Leukositosis dengan shift kiri, trombositopenia,
hiperbilirubinemia, dan proteinuria. Dapat terjadi leukopenia. Adanya hiperventilasi
menimbulkan

alkalosis

respiratorik.

Penderita

diabetes

dapat

mengalami

hiperglikemia. Lipida serum meningkat.


Selanjutnya, trombositopenia memburuk disertai perpanjangan waktu
trombin, penurunan fibrinogen, dan keberadaan D-dimer yang menunjukkan DIC.
Azotemia dan hiperbilirubinemia lebih dominan. Aminotransferase meningkat. Bila
otot pernapasan lelah, terjadi akumulasi laktat serum. Asidosis metabolik terjadi
setelah

alkalosis

respiratorik.

Hiperglikemia

diabetik

dapat

menimbulkan

ketoasidosis yang memperburuk hipotensi.(Hermawan, 2007).

2.7

Penatalaksanaan
Tiga prioritas utama dalam penatalaksanaan sepsis yaitu:

2.7.1

Stabilisasi pasien langsung


Pasien dengan sepsis berat harus dimasukkan dalam ICU. Tanda vital pasien
harus dipantau. Pertahankan curah jantung dan ventilasi yang memadai dengan obat.
Pertimbangkan dialisis untuk membantu fungsi ginjal. Pertahankan tekanan darah
arteri pada pasien hipotensif dengan obat vasoaktif, misal dopamin, dobutamin, dan
norepinefrin.
Dalam 10 tahun terakhir telah banyak didapatkan perkembangan dalam
tatalaksana sepsis, yaitu dalam hal resusitasi cairan, terapi inotropik dan pemberian
antibiotika.

Namun

bahwa waktumemegang

dalam
peranan

penanganan
penting

dan

sepsis

terkini

krusial.Early

diketahui

Goal

Directed

Therapy(EGDT) merupakan penatalaksanaan pasien dengan sepsis berat dan syok


septik, yang bertujuan memperbaiki penghantaran oksigen ke jaringan, dalam jangka
waktu tertentu.
Telah diketahui bahwa perfusi jaringan yang buruk pada keadaan sepsis
berat dan syok septik menyebabkan terjadinya global tissue hypoxia dan berbagai
konsekuensi yang menyertainya, dan hal tersebut berhubungan dengan tingginya
angka mortalitas.EGDT mulai berkembang di tahun 2001 setelah penelitian Rivers
dkk menemukan bahwa penatalaksanaan yang agresif dalam jangka waktu 6 jam,
dengan tujuan mencapai target-target tertentu di unit gawat darurat pada pasien sepsis
berat dan syok septik ternyata berhasil mengurangi mortalitas hingga 16,5%
dibandingkan dengan kelompok yang mendapat terapi standar dengan mortalitas
mencapai 46,5%. EGDT kini telah banyak diterapkan di berbagai rumah sakit,
sebagai

bentuk

implementasi Surviving

Sepsis

Campaign.Namun,

dalam

pelaksanaannya, seringkali masih menemui kendala akibat kurang mendukungnya


sumber daya, sarana dan prasarana yang tersedia.Agar EGDT dapat dilakukan
dengan terorganisasi maka klinisi harus memiliki pemahaman tentang patofisiologi
sepsis, teori yang mendasari EGDT, serta memiliki keterampilan dan penguasaan
prosedur medis dan teknis yang akan dilakukan dalam penanganan pasien dengan
sepsis berat dan syok septik.Berikut ini akan dibahas mengenai teori yang mendasari
EGDT, prinsip EGDT, serta aplikasinya di rumah sakit.
i

Algoritme berbasis waktu ini dalam 1 jam pertama bertujuan untuk


mengembalikan dan mempertahankan denyut jantung ke nilai normal, mencapai
waktu pengisian kapiler < 2 detik, serta menormalkan tekanan darah. Dukungan
oksigenasi dan ventilasi diberikan sesuai dengan indikasi. Target-target berikutnya
diharapkan tercapai dalam waktu 6 jam di unit perawatan intensif.
1. Kerangka waktu: Nol sampai dengan 5 menit pertama
Dalam lima menit pertama, klinisi harus dapat mengidenfikasi pasien
dengan sepsis berat dan syok septik. Identifikasi dini sangat berhubungan dengan
menurunnya morbiditas dan mortalitas kasus sepsis berat dan syok septik. Dalam
waktu lima menit pertama ini pula secara simultan dilakukan manajeman jalan nafas
(airway) dan pernafasan (breathing), serta pemasangan akses intravena (circulation).
a) Identifikasi dini pasien dengan sepsis berat dan syok septik
Trias demam, takikardi, dan vasodilatasi umum ditemukan pada anak
dengan tanda-tanda infeksi. Syok septik harus menjadi pertimbangan diagnosis bila
trias di atas ditemukan, disertai dengan perubahan status mental yang bermanifestasi
sebagai iritabilitas, bingung, mengantuk, hingga penurunan kesadaran yang lebih
dalam.Sepsis berat dan syok septik diketahui berhubungan dengan hipoksia jaringan
yang luas. Hipoksia pada susunan saraf pusat akan menyebabkan gangguan berupa
penurunan kesadaran.
Selain itu, klinisi juga harus dapat mengidentifikasi tanda-tanda gangguan
perfusi jaringan yang disebabkan oleh disfungsi kardiovaskuler pada sepsis. Syok
septik dibedakan ke dalam 2 jenis, yaitu warm shock dan cold shock. Warm
shock ditandai dengan curah jantung yang tinggi, kulit yang hangat dan kering,
serta bounding pulse. Sedangkan cold shock ditandai oleh curah jantung yang rendah,
kulit lembab dan dingin, serta nadi yang lemah. Stadium awal syok septik dapat
dikenali dengan ditemukannya takikardia, bounding pulse, serta gangguan kesadaran.
Produksi urin kurang dari 1 mL/kgbb/jam. Pada stadium yang lebih lanjut, dapat
ditemukan waktu pemanjangan kapiler, dan pada stadium akhir ditandai dengan
hipotensi.
b) Mempertahankan jalan nafas dan pemberian terapi oksigen
Manajemen jalan nafas dan pernafasan dapat dilakukan dengan mengacu
padaPediatric Advanced Life Support (PALS), di antaranya dengan memposisikan
kepala, serta pemberian terapi oksigen.
i

c) Memasang akses intravaskular


Penelitian yang dilakukan oleh Kanter dkk (1986) mendapatkan bahwa
usaha pemasangan akses intravena perifer pada pasien dengan sakit kritis
memerlukan waktu rata-rata 4 menit 30 detik, tercepat 40 detik. American Heart
Association bersama

dengan American

Academy

of

Pediatrics dalam

PALS

merekomendasikan untuk situasi darurat, pemasangan akses intravena harus


terpasang dalam waktu 5 menit. Bila dalam jangka waktu tersebut belum berhasil,
maka dilakukan pemasangan akses intraoseus. Setelah terpasang akses intravena
segera diambil sampel darah untuk pemeriksaan penunjang.
2. Kerangka waktu: 5 sampai dengan 15 menit berikutnya
Pada segmen 5 menit hingga 15 menit berikut ini, dilakukan resusitasi
cairan hingga didapatkan perbaikan perfusi jaringan, dengan pemantauan terhadap
tanda-tandaoverload cairan.
Secara simultan pula dilakukan koreksi kelainan metabolik seperti
hipoglikemi/hiperglikemi, serta koreksi kelainan elektrolit yang mungkin ditemukan,
dan pemberian antibiotik empiris spektrum luas.
a. Resusitasi cairan pada sepsis berat dan syok septik
Volume cairan resusitasi
VOLUME DARAH EFEKTIF(Effective blood volume/flow)

70 75 cc/kgBB

60 65 cc/kgBB
Anak2 90 100 cc/kgBB
2. 15 % EBV/F hilang hypoxia (+) nadi meningkat
3. 25 % EBV/F hilang syok.
Jumlah Cairan :
Dewasa 50cc / Kgbb/ 24 Jam
Macam Cairan dihitung dari kebutuhan Na+ 3 5 meg / KgBB / 24 jam
Penelitian pendahuluan telah dilakukan pada hewan percobaan dengan
sepsis berat, didapatkan bahwa resusitasi cairan hingga 60 mL/kgbb ternyata berhasil
memperbaiki curah jantung, penghantaran oksigen serta stabilitas hemodinamik.Dari
penelitian Han dkk (2003) pada pasien dengan sepsis berat dan syok septik,
didapatkan pula bahwa kelompok non-survivor menerima volume cairan resusitasi
lebih sedikit (20 mL/kgbb) dan kecenderungan dilanjutkan dengan terapi inotropik.
Mengenai volume cairan resusitasi yang diberikan, Carcillo dkk (1991)
melaporkan penelitian mengenai resusitasi cairan pada pasien pediatrik dengan syok
septik yang diberikan dalam 1 jam pertama, pemberian cairan resusitasi secara cepat
i

dengan volume di atas 40 mL/kgbb (rata-rata 69 + 19 mL/kgbb) berhubungan


denganoutcome (survival) yang lebih baik. Pemberian cairan secara cepat juga tidak
berhubungan dengan kejadian Acute Respiratory Distress Syndrome (ARDS).
Rekomendasi dari Surviving Sepsis Campaign 2008 yaitu resusitasi cairan
inisial diawali dengan pemberian cairan kristaloid bolus 20 mL/kgbb selama 5-10
menit, dititrasi dengan pemantauan klinis terhadap curah jantung, dalam hal ini
meliputi denyut jantung, produksi urin, waktu pengisian kapiler, dan derajat
kesadaran. Biasanya defisit cairan cukup besar sehingga awal resusitasi memerlukan
volume

cairan

40-60

mL/kgbbPemantauan

mL/kgbb,1 namun

terhadap

dapat

mencapai

tanda-tanda overload cairan

hingga
yaitu

200

dengan

memperhatikan adanya onset baru usaha nafas pasien, ditemukannya rales pada
pemeriksaan fisis paru, atau bertambahnya berat badan lebih dari 10%. Untuk
mengatasinya diberikan diuretik. Tindakan lain untuk mengatasi overloadcairan yaitu
dengan dialisis peritoneal bila didapatkan oliguria, atau continuous renal replacement
therapy (CRRT) bila diperlukan.
Untuk pemeriksaan secara bed-site, dari penelitian Pamba dan Maitland
(2004) didapatkan bahwa pemanjangan waktu pengisian kapiler > 3 detik merupakan
faktor prognostik perlunya resusitasi cairan, sehingga cukup prediktif digunakan
sebagai alat untuk menilai adekuatnya terapi cairan yang diberikan pada pasien
dengan sepsis berat dan syok septik.
Jenis cairan resusitasi
Pemilihan jenis cairan pada resusitasi sepsis berat dan syok septik bersifat
liberal. Secara umum, cairan isotonis cukup efektif, aman, dan efektif dibandingkan
dengan

koloid,

sehingga

disarankan

sebagai

cairan

lini

pertama

pada

resusitasi. Penelitian di India yang dilakukan oleh Upadhyay (2005) mendapatkan


tidak adanya perbedaanoutcome pasien syok septik yang diresusitasi dengan cairan
kristaloid dibandingkan dengan koloid. Namun hal yang berlawanan didapatkan dari
penelitian Schierhout dan Roberts, bahwa resusitasi dengan cairan koloid dapat
menyebabkan efek samping berupa gangguan hemostasis. Pada saat ini penelitian
klinis banyak dilakukan untuk mengetahui kegunaan penggunaan cairan hipertonis
dalam resusitasi sepsis berat dan syok septik.
b. Koreksi hipoglikemia
i

Hipoglikemia dapat menyertai suatu sepsis dan menimbulkan gangguan


kesadaran. Keadaan ini dapat dikoreksi dengan pemberian Dextrose-10% pada cairan
rumatan dengan kecepatan 8 mg/kg/menit pada neonatus, 5 mg/kgbb/menit pada
anak, dan 2 mg/kgbb/menit pada remaja. Bila disertai dengan kegagalan fungsi hati,
penderita mungkin membutuhkan kecepatan infus glukosa yang lebih tinggi, dapat
mencapai 16 mg/kgbb/menit. Hiperglikemia dapat pula menyertai keadaan sepsis,
yang didefinisikan sebagai kadar glukosa sewaktu > 140 mg/dL. Penatalaksanaan
hiperglikemia dapat dengan menggunakan cairan Dextrose-5% dan dapat
dikombinasikan dengan terapi insulin.Direkomendasikan untuk mempertahankan
kadar glukosa > 80 dan <150 mg/dL. Insulin reguler yang digunakan dalam bentuk
bolus atau infus kontinu. Dosis yang diberikan yaitu 0,025 U/kgbb/kali atau 0,025
0,1 U/kgbb/jam (2,5 U/kgbb dalam 50 mL Albumin 4% dengan kecepatan 0,5 2
mL/jam); selanjutnya 1 U/10 gram dextrose.
c. Koreksi hipokalsemia
Kadar konsentrasi kalsium berbeda sesuai dengan usia, berkisar 8,5 10,5
mg/dL untuk kalsium total dan 4,0 5,0 g/dL ion kalsium dalam darah.
Hipokalsemia dapat menyebabkan gangguan kontraktilitas dan irama jantung, selain
juga menyebabkan hipotensi serta kelainan neuromuskuler lainnya. Koreksi
hipokalsemia dapat diberikan peroral atau intravena. Pasien dengan hipokalsemia
simptomatik dapat diberikan bolus kalsium glukonas 100-200 mg/kgbb dalam waktu
10-20 menit. Infus kontinu kalsium glukonas sebagai alternatif diberikan dengan
dosis awal 10-30 mg/kgbb/jam, selanjutnya dititrasi sesuai dengan hasil pengukuran
serum kalsium selanjutnya.
d. Pemberian terapi antibiotik
Terapi antibiotik merupakan terapi utama dalam sepsis (gambar 5), dengan
penggunaan antibiotik empiris berspektrum luas di awal terapi. Berbagai penelitian
menunjukkan bahwa pemberian antibiotik cepat dan sesuai berhasil menurunkan
morbiditas dan mortalitas pasien dengan sepsis.Namun harus dipertimbangkan juga
bahwa penggunaan antibiotik spektrum luas dapat menyebabkan peningkatan
resistensi mikroorganisme.
Pemberian antibiotik tidak ditunda, dan faktor waktu memegang peranan
penting. Dari penelitian Houck dkk, pemberian antibiotika dalam 4 jam pertama
berhubungan dengan menurunnya mortalitas hingga 6,8% sejak pasien datang ke
i

rumah sakit, dan menurunkan mortalitas hingga 11,6% dalam 30 hari perawatan,
selain itu juga membantu mengurangi lama perawatan di rumah sakit hingga 42%.
Dalam SSC 2008, direkomendasikan pemberian antibiotik dalam 1 jam pertama
setelah dilakukan pengambilan kultur. Durasi terapi antibiotik yang dianjurkan yaitu
7-10 hari, dan kemudian disesuaikan dengan hasil kultur. Namun pada pasien dengan
neutropenia, durasi terapi antibiotik dapat diperpanjang hingga 14 hari. Keputusan
untuk menghentikan pemberian antibiotik bergantung pada penilaian klinis. Terapi
kombinasi antimikroba dilaporkan lebih baik dibandingkan dengan monoterapi,
sebagaimana dilaporkan dari penelitian Micek dkk. Terapi awal antibiotik sangat
kritis bagi pasien dengan sepsis, seperti halnya pasien dewasa.
3. Kerangka waktu: 15 menit sampai 60 menit berikutnya
Dalam waktu 15 menit pertama, ditentukan apakah suatu syok septik
responsif atau refrakter terhadap terapi cairan. Syok dinyatakan refrakter terhadap
cairan bila belum menunjukkan perbaikan hemodinamika setelah mendapat terapi
cairan hingga 40 mL/kgbb. Langkah selanjutnya pada pasien dengan syok septik
yang refrakter terhadap terapi cairan yaitu dengan secara simultan melakukan
pemasangan akses vena sentral, memulai terapi inotropik dan vasopresor serta
melakukan pemantauan tekanan arterial.
Namun berbeda dengan populasi dewasa, pemasangan akses vena sentral
pada anak menjadi suatu isu karena kesulitan dalam pelaksanaannya. Pemasangan
vena sentral pada pasien pediatrik tidak familier, dalam prosedur pemasangannya
yang cukup sulit sehingga melampaui kerangka waktu (time-frame) yang diharapkan
pada EGDT khususnya di unit emergensi. Penatalaksanaan dalam kerangka waktu 15
menit hingga 60 menit berikutnya dijelaskan sebagai berikut:
a. Memulai pemberian inotropik dan vasopresor
Hipotensi yang menetap meskipun telah dilakukan resusitasi cairan optimal
merupakan ciri dari syok septik, yang terjadi akibat gangguan kontraktilitas
miokardium selain juga terdapat gangguan pada resistensi vaskuler sistemik. Akibat
gangguan di atas, maka diperlukan pemberian vasopresor dan terapi inotropik untuk
memperbaiki tekanan darah serta mempertahankan penghantaran oksigen ke
jaringan.Dalam penatalaksanaan sepsis, harus dilakukan usaha secepat mungkin
untuk mengembalikan hemodinamika. Oleh karena itu, vasopresor diberikan segera
setelah resusitasi cairan optimal diberikan. Pemberian vasoaktif direkomendasikan
i

bila syok tidak teratasi dengan resusitasi cairan sampai dengan 40 mL/kgbb. Jenis
obat yang digunakan yaitu katekolamin dan derivat sintetisnya, meliputi dopamin,
dobutamin, epinefrin, norepinefrin.
Dopamin disarankan sebagai pilihan terapi pertama untuk pasien pediatrik
dengan hipotensi yang refrakter terhadap resusitasi cairan, atau pada keadaan cold
shock.Dopamin dan norepinefrin diketahui berfungsi meningkatkan tekanan darah
dan curah jantung. Dopamin lebih poten dibandingkan norepinefrin, dan lebih sering
menyebabkan takikardia. Pada dosis rendah, dopamin menyebabkan vasodilatasi
sirkulasi renal dan mesenterika. Pada dosis 2-10 mikrogram/kgbb/menit, dopamin
memiliki efek inotropik positif dan kronotropik positif, sedangkan pada dosis yang
lebih tinggi menyebabkan vasokonstriksi perifer. Penelitian Levy dkk menemukan
bahwa populasi pasien syok septik yang resisten dengan terapi dopamin
meningkatkan risiko mortalitas. Bila syok refrakter terhadap terapi dopamin, maka
diberikan epinefrin. Epinefrin diberikan dengan dosis 0.05- 0.3 mcg/kgbb/menit.
Pada keadaan warm shock, diberikan titrasi norepinefrin. Norepinefrin pada
dosis 1-20 mikrogram/menit baik untuk meningkatkan MAP, resistensi vaskuler
sistemik, penghantaran oksigen jaringan. Dobutamin dapat digunakan sebagai agen
inotropik pada pasien dengan curah jantung yang rendah, diberikan dengan dosis
2,520 mikrogram/kgbb/menit.
b. Mempertahankan jalan nafas
Dilakukan penilaian terhadap usaha nafas pasien dan komplians paru.
Keputusan untuk melakukan intubasi bergantung pada penilaian klinis usaha nafas
pasien,

adanya

hipoventilasi,

atau

akibat

penurunan

kesadaran. Intubasi

dipertimbangkan pada pasien dengan syok refrakter disertai dengan tanda gagal
nafas, penurunan kesadaran, serta untuk pemantauan hemodinamik invasif. Selain
itu, ventilasi mekanik juga dapat membantu mekanika sirkulasi. Diketahui bahwa
sekitar 40% curah jantung diperlukan untuk mendukung fungsi pernafasan, sehingga
ventilasi mekanik berguna untuk menurunkan beban kerja paru-paru. tekanan
intratorakal juga berperan menurunkan afterload ventrikel kiri, sehingga dapat
membantu pasien dengan curah jantung rendah dan resistensi vaskuler perifer yang
tinggi.
Disarankan penggunaan ketamin dan atropin sebagai agen sedasi-intubasi
pada pasien dengan syok septik. Ketamin bekerja dengan cara menghambat
transkripsifactor-kappa B dan mengurangi produksi Interleukin-6 di sistemik, namun
i

mempertahankan fungsi adrenal, sehingga mempertahankan stabilitas fungsi


kardiovaskuler. Ketamin untuk fungsi sedasi diberikan dengan dosis 1-2 mg/kgbb
i.v. Ketamin juga dapat berfungsi sebagai infus analgesia dan atau sedasi untuk
mempertahankan stabilitas fungsi kardiovaskuler pada saat dilakukan pemasangan
ventilasi mekanik.
Pada pasien dengan gagal nafas dan memerlukan ventilator, prinsip lungprotective therapy perlu diterapkan sebagaimana pada pasien dewasa. Pasien
dengan Acute

Lung

Injury/Acute

Respiratory

Distress

Syndrome ditargetkan

mendapat volume tidal 6 mL/kgbb dan plateau pressure < cm H2Ohypercapnia


meminimalkan plateau

pressure dan

volume

tidal.Positive

End

Expiratory

Pressure (PEEP) juga diterapkan untuk mencegah kolaps alveolar di akhir ekspirasi.
Posisi prone pada

suatu

penelitian

multisenter

didapatkan

berguna

untuk

memperbaiki hipoksemia.
4. Kerangka waktu: 6 jam berikutnya di Unit Perawatan Intensif
Bila ditemukan keadaan syok yang resisten dengan terapi katekolamin,
maka

penatalaksanaan

selanjutnya

yaitu

dengan

pemberian

hidrokortison.

Hidrokortison diberikan pula pada pasien yang diduga atau terbukti disertai dengan
insufisiensi adrenal. Pasien berisiko mengalami insufisiensi adrenal yaitu pasien
dengan syok septik, sebelumnya menerima terapi steroid untuk penyakit kronis, dan
anak dengan abnormalitas adrenal atau hipofisis. Bila jelas faktor risikonya, maka
disarankan pemberian hidrokortison secara intermiten atau infus kontinu dengan
dosis mulai 1-2 mg/kgbb/hari, dititrasi hingga 50 mg/kgbb/hari.
Keadaan insufisiensi adrenal ini dinyatakan bila kadar kortisol basal < 18
g/dL kadar puncak ACTH-stimulated cortisol < 18 g/dL. Pemberian hidrokortison
jangka panjang (6 mg/kgbb/hari selama 7 hari) telah dilaporkan pada pasien dewasa,
namun pada pasien masih menjadi kontroversi. Penelitian berupa pemberian
hidrokortison intermiten dengan dosis 3 mg/kgbb/hari selama 7 hari pada bayi
dengan syok septik resisten katekolamin didapatkan bahwa kebutuhan pemberian
terapi dopamin dapat dikurangi, namun tidak memperbaiki angka mortalitas.
Penelitian multisenter di Eropa oleh CORTICUS (Corticosteroid Therapy of Septic
Shock) pada 499 pasien dengan syok septik, membandingkan kelompok yang
diberikan terapi hidrokortison dosis rendah dan kelompok dengan plasebo selama 5

hari. Dari penelitian ini didapatkan tidak ada perbedaan mortalitas di antara kedua
kelompok.
Penggunaan steroid juga berpotensi terhadap kejadian kandidiasis
diseminata.Kortikosteroid dapat bermanfaat pada stadium awal dari sepsis. Sebagai
alternatif bila tidak tersedia hidrokortison maka dapat diberikan metilprednisolon 30
mg/kgbb/dosis

intravena

atau

deksametason

mg/kgbb/dosis

intravena.

Pemberiannya dapat diulang 4 jam kemudian, namun bila tidak memberikan respon
maka pemberiannya dihentikan. Namun demikian, masih diperlukan penelitian lebih
lanjut mengenai efikasi terapi kortikosteroid pada sepsis di populasi pediatrik.
Pasien dengan syok resisten katekolamin dapat memberikan tampilan klinis
curah

jantung

rendah/resistensi

vaskuler

sistemik

tinggi,

curah

jantung

tinggi/resistensi vaskuler sistemik rendah, atau curah jantung rendah dengan


resistensi vaskuler sistemik rendah. Oleh karena itu, pemantauan hemodinamik dapat
dilakukan dengan pemasangan kateter vena sentral, serta monitoring kontinu tekanan
arterial. Dilakukan pemantauan CVP dengan target mencapai MAP-CVP dan
ScvO2 > 70%. Untuk mempertahankan saturasi tersebut juga dilakukan dengan
mempertahankan kadar Hb > 10 g/dL. Saturasi vena sentral (ScvO 2) akan
memberikan informasi keseimbangan antara kebutuhan dan pemenuhan oksigenasi di
jaringan, yang dilaporkan berhasil mengurangi mortalitas hingga 40% dibandingkan
pada pasien yang tidak dilakukan pemantauan ScvO 2. Flow ScvO2 juga bergunauntuk
memperkirakan aliran darah dari otak. Nilai > 40 mL/kgbb/menit berhubungan
denganoutcome neurologis yang lebih baik dan juga survival pasien.
Dengan pemasangan vena sentral, dapat dilakukan pemantauan terhadap
keberhasilan penatalaksanaan syok, khususnya pada keadaan syok yang refrakter,
yaitu karena titrasi cairan, inotropik, dan vasopresor ataupun vasodilator dilakukan
dengan memerhatikan parameter-parameter di atas.
a. Cold shock dengan tekanan darah normal
Pada keadaan cold shock, dilakukan titrasi cairan dan pemberian epinefrin,
untuk mencapai ScvO2 > 70%, dengan mempertahankan kadar hemoglobin > 10
g/dL. Bila kadar ScvO2 masih di bawah 70%, kemungkinan didapatkan syok
dengan Cardiac Index yang rendah, tekanan darah normal, dengan resistensi vaskuler
sistemik yang tinggi. Hal ini serupa dengan anak yang mengalami syok kardiogenik,
yang dalam penatalaksanaannya bertujuan untuk mengurangi afterload untuk
i

memperbaiki aliran darah dengan berkurangnya afterload ventrikel, sehingga akan


dapat meningkatkan pengosongan ventrikel. Oleh karena itu, nitroprusside atau
nitrogliserin menjadi vasodilator lini pertama pada syok resisten epinefrin dengan
tekanan

darah

normal.

Vasodilator

diberikan

dengan

sebelumnya

dilakukan loading cairan terlebih dahulu.Nitrogliserin pada dosis 10-60 g/menit


dapat membantu menurunkan afterload.5Vasodilator yang termasuk di dalamnya
yaitu Milrinone, yang pemberiannya dipertimbangkan bila masih didapatkan curah
jantung yang rendah. Milrinone (Primacor) diberikan dengan dosis 50 mcg/kg i.v.
bolus selama 15 menit, dilanjutkan dengan infus kontinu 0,5 0,75 mcg/kgbb/menit
dan dititrasi hingga tercapai efek yang diinginkan.
b. Cold shock dengan tekanan darah rendah
Pada keadaan ini didapatkan syok dengan Cardiac Index yang rendah,
tekanan darah yang rendah, serta resistensi vaskuler perifer yangrendah pula. Untuk
penatalaksanaan selanjutnya yaitu dilakukan titrasi cairan dan epinefrin untuk
meningkatkan tekanan darah diastolik dan meningkatkan resistensi vaskuler perifer.
Bila tekanan darah yang adekuat sudah tercapai, maka untuk memperbaiki Cardiac
Index dan mencapai ScvO2 > 70% dapat diberikan dobutamin, selain itu kadar Hb
juga dipertahankan > 10 g/dL. Bila pasien masih hipotensi, pertimbangkan
pemberian norepinefrin. Bila ScvO2 masih di bawah 70%, pertimbangkan dobutamin,
milrinone, enoximoneatau levosimendan. Levosimendan bekerja dengan cara
meningkatkan sensitivitas kalsium dari aparatus kontraktil miokardium, juga
berfungsi seperti halnya type III PDE inhibitor-activity lain. Enoximone juga
merupakan type III PDE inhibitor yang lebih selektif dan menjaga cadangan c-AMP
yang diproduksi -1 aktivator reseptor sel miokardium, sehingga dapat memperbaiki
performa jantung dengan lebih sedikit efek hipotensi.
c. Warm shock dengan tekanan darah rendah
Pada keadaan ini didapatkan syok dengan Cardiax Index tinggi, dan
resistensi perifer yang rendah. Maka penatalaksanaan selanjutnya yaitu dengan
pemberian titrasi cairan dan norepinefrin, untuk mempertahankan ScvO 2 > 70%. Bila
masih didapatkan hipotensi, pertimbangkan vasopresin, terlipresin, atau angiotensin
untuk memperbaiki tekanan darah; namun perlu diperhatikan pula bahwa obat-obat
vasokonstriktor di atas dapat menyebabkan berkurangnya curah jantung, sehingga
dalam penggunaan obat tersebut direkomendasikan dengan pemantauan curah
jantung dan ScvO2. Bila ScvO2 masih di bawah 70% pertimbangkan untuk pemberian
i

epinefrin dosis rendah. Vasopresin (Vasopressin, Pitressin) diberikan dalam infus


kontinu mulai dari 0.5 mili-unit/kgbb/jam, dosis dinaikkan tiap 30 menit sesuai
kebutuhan hingga maksimal 10 mili-unit/kgbb/jam (0.01 U/kgbb/jam).
d. Syok resisten katekolamin yang persisten
Bila pasien masih belum responsif dengan terapi yang diberikan di atas,
maka dikatakan sebagai syok resisten katekolamin yang persisten. Untuk itu perlu
disingkirkan dan diperbaiki berbagai keadaan yang berkontribusi terhadap syok
refrakter terapi cairan dan katekolamin, di antaranya yaitu adanya efusi perikardial,
pneumotoraks,

peningkatan

tekanan

intraabdomen

lebih

dari

12

mmHg.

Pertimbangkan pula kemungkinan adanya perdarahan, keadaan imunosupresi,


ketidaksesuaian kontrol pengendalian infeksi (misalnya jenis dan dosis antibiotik
yang diberikan belum memadai). Pada saat ini, dipertimbangkan untuk memandu
titrasi cairan, inotropik, vasopresor, vasodilator dan terapi hormonal dengan
pemasangan akses arteri pulmonalis, PICCO (pulse cardiac output), atauFemoral
Arterial Thermodilution (FATD) Cathether, dan atau ultrasonografi doppler untuk
memantau curah jantung. Kateter arteri pulmonalis dapat mengukur tekanan
penutupan arteri pulmonaris sehingga dapat mengidentifikasi disfungsi ventrikel kiri,
serta dapat digunakan untuk menentukan kontribusi relatif fungsi ventrikel kanan dan
kiri. PICCO berguna untuk memperkirakan volume akhir diastolik keseluruhan ruang
jantung serta mengukur cairan paru ekstravaskuler, sehingga dapat membantu
penilaian apakah preload sudah adekuat atau belum. Monitoring non-invasif seperti
penggunaan pulse oxymetri, saturasi oksigen vena per-kutan, dan lainnya masih
dalam tahap evaluasi. Tujuan terapi pada saat ini yaitu mencapai dan
mempertahankan Cardiac Index 3.3 6 L/menit/m2.
Extracorporeal membrane oxygenation (ECMO) merupakan salah satu
alternatif terapi yang perlu dipertimbangkan, telah dilakukan secara terbatas pada
syok yang refrakter dan atau keadaan gagal nafas yang tidak bisa ditangani dengan
terapi konvensional. ECMO telah dilakukan pada pasien dengan syok septik, namun
pengaruhnya sendiri masih belum jelas. Penelitian yang menganalisis 12 pasien
sepsis dengan ECMO, 8 orang di antaranya bertahan hidup dan pada follow
uprentang 4 bulan hingga 4 tahun, didapatkan bahwa rata-rata setelah 1 tahun mereka
dapat menjalani kehidupan dengan normal.
e. Monitoring hemodinamik dan pencapaian target-target terapeutik

Tujuan akhir resusitasi syok septik yaitu tercapainya normalisasi denyut


jantung, waktu pengisian kapiler < 2 detik, ekstremitas yang hangat, produksi urin
yang cukup (> 1mL/kgbb/jam), skala kesadaran yang normal, serta kadar glukosa
dan kalsium yang normal. Tujuan akhir lainnya yang juga digunakan pada populasi
dewasa yaitu berkurangnya kadar laktat serum serta defisit basa, ScvO 2 >70% atau
SvO2 > 65%, CVP 8-12 mmHg atau dengan metode lainnya untuk menilai fungsi
pengisian jantung, yaitu mencapai dan mempertahankan Cardiac Index 3,3 6
L/menit/m2. Target pencapaian ScvO2 > 70%, didukung pula dengan transfusi PRC
bila hematokrit kurang dari 30%, maupun dengan pemberian inotropik. Untuk
pemberian transfusi, sebuah penelitian multisenter terandomisasi mendapatkan
bahwa batas ambang transfusi Hb 7 g/dL dibandingkan dengan ambang batas Hb 9,5
g/dL, ternyata memberikan outcome yang sama. Namun, dalam rangka memperbaiki
penghantaran oksigen ke jaringan, Hb dipertahankan di atas 10 g/dL.
Target-target di atas diharapkan tercapai dalam 6 jam sejak pasien masuk
unit gawat darurat maupun pada tempat perawatan intensif, ternyata berhasil
menurunkan morbiditas dan mortalitas akibat sepsis, sepsis berat, dan syok septik.
Implementasi EGDT di Rumah Sakit
EGDT merepresentasikan penatalaksanaan kegawatdaruratan yang terbukti
memperbaiki prognosis pasien dengan sepsis berat dan syok septik. Namun
pelaksanaannya kadang masih belum sesuai dengan protokol yang ada, dengan latar
belakang bervariasi. Pada saat ini, berbagai kendala yang ditemukan dalam
implementasi EGDT yaitu kurangnya pemahaman tentang patofisiologi sepsis, teori
yang mendasari EGDT, serta kurangnya keterampilan maupun penguasaan prosedur
medis dan teknis yang dilakukan dalam penanganan pasien dengan sepsis berat dan
syok septik. Selain itu, model rumah sakit, sarana serta prasarana yang ada juga
berperan terhadap keberhasilan implementasi EGDT. Agar implementasinya
konsisten dan terorganisir, diperlukan suatu model protokol yang disesuaikan dengan
sumber daya manusia, sarana dan prasarana penunjang di rumah sakit tersebut.
Implementasinya di rumah sakit dikatakan dapat mereduksi biaya-biaya hingga
23,4%. Efektivitas biaya ini dapat tercapai bila EGDT dilakukan mulai di unit gawat
darurat atau ruang perawatan intensif dengan respon tim yang cepat.
Untuk implementasi EGDT secara optimal, maka diperlukan dukungan
mutlak institusi dalam hal penyediaan sarana dan prasarana. Klinisi juga diharapkan
i

meningkatkan keterampilan dalam prosedur tindakan yang diperlukan dalam


implementasi EGDT.
2.7.2

Darah harus cepat dibersihkan dari mikroorganisme


Perlu segera perawatan empirik dengan antimikrobial, yang jika diberikan
secara dini dapat menurunkan perkembangan syok dan angka mortalitas. Setelah
sampel didapatkan dari pasien, diperlukan regimen antimikrobial dengan spektrum
aktivitas luas. Bila telah ditemukan penyebab pasti, maka antimikrobial diganti
sesuai dengan agen penyebab sepsis tersebut (Hermawan, 2007).
Sebelum ada hasil kultur darah, diberikan kombinasi antibiotik yang kuat,
misalnya antara golongan penisilin/penicillinaseresistant penicillin dengan
gentamisin.

2.7.3
1)

2)

Pemberian antibiotik
Golongan penicillin
Procain penicillin 50.000 IU/kgBB/hari im, dibagi dua dosis
Ampicillin 4-6 x 1 gram/hari iv selama 7-10 hari
Golongan penicillinaseresistant penicillin
Kloksasilin (Cloxacillin Orbenin) 41 gram/hari iv selama 7-10 hari sering
dikombinasikan dengan ampisilin), dalam hal ini masing-masing dosis obat
diturunkan setengahnya, atau menggunakan preparat kombinasi yang sudah ada

(Ampiclox 4 x 1 gram/hari iv).


Metisilin 4-6 x 1 gram/hari iv selama 7-14 hari.
3) Gentamycin
Garamycin, 5 mg/kgBB/hari dibagi tiga dosis im selama 7 hari, hati-hati
terhadap efek nefrotoksiknya.

BAB III
TINJAUAN KASUS
3.1

Contoh Kasus
Seorang laki-laki usia 73 tahun,BB : 60 kg masuk Instalasi Gawat Darurat
Rumah Sakit Cipto Mangunkusumo dirujuk dari rumah sakit (RS) swasta dengan
syok septik akibat bronkopneumonia. Pasien sempat dirawat di ruang rawat
intermediate selama 3 hari. Keluhan utama saat masuk RS swasta adalah pasien
lemas dan tidak nafsu makan sejak seminggu sebelumnya. Keluhan lain adalah mual
tapi tidak muntah, intake makanan hanya separuh biasanya. Demam, batuk ada, tidak
berdahak. Kadang-kadang merasa sesak.Tidur dengan posisi setengah duduk.
Pasien mempunyai riwayat diabetes mellitus sejak 10 tahun, berobat teratur.
Riwayat penyakit jantung koroner pasca pemasangan Stent Percutaneous Coronary
Interventasi (PCI) tahun 2007 dan 2010. Aktivitas sehari-hari sudah terbatas.
Hasil pemeriksaan penunjang yang dilakukan di RS swasta adalah
pemeriksaan darah perifer kadar Hb 17,9 g/dL Ht 52%, Leukosit 24.800/uL,
Trombosit 314.000/uL, Ureum/kreatinin 176 mg/dL/2,5 mg/dL, creatinine clearance
test hitung 16,9 ml/menit GDS 189 mg/dL, SGOT/SGPT 3328 U/L/1913 U/L, asam
urat 15,9 mg/dL, Na/K/Cl 133/4,7/97 mmol/L, PT 14,9 (11,7)/aPTT 171 (31,9),
Fibrinogen/D-dimer 353,5/300, AGD: pH 7,4, PaCO2 :26,2, PO2 : 146 ,HCO-3 :
16,1 BE/-7,6 Sat O2/99%, CKMB: 92 Troponin T <100. Hasil pemeriksaan toraks
adalah kardiomegali dengan infiltrat dikedua lapang paru, sedangkan pemeriksaan
echokardiografi tampak disfungsi ventrikel kiri, hipertensi pulmonal, global
hipokinetik, hasil pemeriksaan urinalisa albuminuria (3+), bilirubin (+), eritrosit
penuh, granula kasar (+), bakteri (+), yeast (+).
TTV : Tekanandarah 80/50 mmHg ,RR : 28x/mnit ,Nadi : 110x/mnit, Suhu :
40 C.Klienterlihatcianosis,GCS 3-3-3,CRT 3

3.2

Penatalaksanaan

3.2.1

Di UGD
Pada kasus di atas masalah yang ditegakkan adalah septik syok yang
disebabkan oleh pneumonia (HAP) dan ISK pada pasien dengan komorbitas gagal
i

jantung kronik dan diabetes mellitus yang oleh sebab sepsis menjadi acute
decompensated Heart Failure (ADHF) (edema paru) disertai penurunan fungsi ginjal
(AKI F atau AKIN stage 2) yang kini dikenal sebagai suatu sindrom kardiorenal.
Sementara tata laksana syok septik berdasarkan Surviving Sepsis Campaign adalah
menjalankan 3 pilar sepsis yakni resusitasi (Protocol Rivers), antibiotik yang adekuat
dan source control
Implementasi EGDT dalamtatalaksana sepsis beratdansyok septic
padakasusdiatas :
Implementasi EGDT di unit gawatdaruratdan unit perawatan intensif dalam
tatalaksana sepsis bera dan syok septic diajukan dalamalurberikut: Dalam waktu lima
menit pertama ini pula secara simultan dilakukan manajeman A-B-C
a) Airway (JalanNafas)
Membukajalannafaspasienbaikmenggunakanmetodelangsung

Tounge

Blade method maupunmetodetaklangsung / Up Sliding method.Denganmenggunakan


Endotracheal Tube (ETT), Nasopharingeal Airway, LMA, ataupun tekhnik bedah
sesuai kondisi klien.
b) Breathing (Nafas)
PemberianHantaranOksigendanKonsumsiOksigenHantarandankonsumsioksi
genbisadiperolehdariarteripulmonal.
HantaranOksigen (ml/menit) cardiac output (L/menit) x konsetrrasi
hemoglobin (g/dL) x 1,34 (konsentrasi hemoglobin).
Terdapat kekurangan pada consensus menggunakan hantaranoksigen atau
konsumsioksigen sebagai indicator untuk pedomanpemberian terapicairan pada
sepsis.Penurunan saturasi oksigen darah vena campuran (SvO2) dapat merefleksikan
reduksi dalam cardiac output dan hantaran oksigen. JikaSvO2

kurangdari 50%

sangat memungkinkan telah terjadi penurunan perfusi.


Menambah cardiac output atau pemberian packet red blood cells (PRC)
sangatdiperlukanuntukmeningkatkanhantaranoksigen.Namun,sepsis,memperlihatkan
i

peningkatan SvO2.Hal initerjadi karena peningkatan aliran darah kejaringan yang


aktifsecara non-metabolik.Pada kenyataanya,jika aliran darah ini ke jaringan lebih
besar dari aliran darah ke jaringan yang aktif, maka SvO2 akan lebih tinggi dari
kadar normalnya.
c) Circulation (Sirkulasi)
1. Resusitasicairandenganperhitungan :
Kaji output urin ,tekananarteri rata-rata atau MAP dan denyut jantung
dipilih sebagai pegangan untuk terapicairan.
Diketahui : TD 80/50mmHg MAP (S2D) /3
(80 100) /3
60 mmHg (kategotiSyok)
Kebutuhancairan
Volume DarahEfektif(Effective Blood Volume/Flow)
a. 70 75 cc/kgBB
b. 60 65 cc/kgBB
25 % EBV/F hilangsyok.
RL Na+ 131 meq/L------ 1 fles = 65 meq
Penyelesaian :
a) JumlahkehilangancairanSyok 25% dari EBV/F
Kebutuhancairankliendengan BB = 60 x 70
= 4200 cc

Darahhilang 25% =

25
100

x 4200 = 1050cc

b) Cairan yang dimasukan


KebutuhanNatriumdengan BB 60 kg :
Na = 3 x 60 = 180 sampai5 x 60 = 300 Keb. Natriumpx = 180
300 meg/24 jam
RL = 4 flash = 4 x 65 = 4200 cc
4200 x 15
24 x 60

6300
1440

Faktortetesan : Otsuka :

2.
a.
b.
c.

Cairanresusitasiterus di evaluasihinggakondisiklienstabil.Jikabelumstabil .
Pemantauanklinisterhadapcurahjantungdalamhalinimeliputi :
denyutjantung
produksiurin
waktupengisiankapiler (CRT)

= 44 tpm

d.
3.
a.
b.
c.
d.
e.
4.

derajatkesadaran
Pemantauanterhadaptanda-tanda overload :
memperhatikanadanya onset baruhepatomegali
bertambahnyausahanafaspasien
ditemukannyaralespadapemeriksaanfisisparu
bertambahnyaberatbadanlebihdari 10%.
Untukmengatasinyadapatditerapkanpenatalaksanaan ADHF.
Secarasingkattatalaksana ADHF padafungsiginjal yang tergangguadalah:

a. Diuretik sebagai terapi utama (88%).


b. Antagonis mineralokortikoid (spironolakton).
c. Hormon natriuretik: nesiritide (memberikan efek vasodilatasi).
d. Vasodilator: mengurangi bendungan & memperbaiki CI
e. Inotropik: kontroversi, hanya pada keadaan hipotensi dapat digunakan
f. Akuaretik/antagonis reseptor V26.
g. Antagonis reseptor adenosine A1: vasokonstriksi arteriol aferen sehingga renal blood
flow berkurang.
h. Ultrafiltrasi: mengatur balans cairan.
i. Levosimen dan yang cara kerjanya dengan terikat troponin C jantung sehingga
stabilisasi ikatan dengan kalsium yang dapat memperbaiki kontraktilitas miokard.
Terapifarmakologis :
Terapi yang diberikanadalah furosemide 20mg/jam, dobutamin 10
ug/kg/mnt, norepinefrin 1 ug/kg/mnt, amiodaron 300 mg/6jam, insulin (lantus 1x14
U danactrapid 3x6 U), ascardia, enoxiparine 1x0,4 mg danmeropenem 1x1 g.
3.2.2

Di ICU
PemeriksaanfisikpadasaatmasukIntensive Care Unit (ICU);
pasientampaksesak, posisisetengahduduk. Kesadaranapatis, tekanandarah
106/58

mmHg,

frekwensinadi

0,8ug/kg/menitdandobutamin

100
10

Pernapasanspontandengansungkupmuka
30x/menit.Saturasi

x/menit

(dengantopangan

ug/kg/menitmelalui
O2

96-100%.Suhuafebris,

l/menit,

noradrenalin

vena

perifer).

frekwensinapas

ekstremitasdingindan

pitting

20-

edema

padatungkai.Pemeriksaan dada: bunyi jantung I-II normal, suara tambahan


sulitdinilai, terdapat ronkikasar di kedua lapang paru. Pemeriksaan abdomen dalam
batas normal
Diagnosis masuk ICU adalahseptiksyokakibat pneumonia (Hospital
AqcuiredPneumia/HAP) dan infeksi saluran kemih(ISK), dengan gagal jantungdan
i

edema paruserta AKI F atau AKIN stage 2 g cardiorenal syndrome. Pengelolaan


pasien ini adalah segera dilakukan resusitasicairan, pemberiananti biotic empiric
untuk mengatasi infeksi serta pengelolaan gagal jantung dan edema paru.
Pemeriksaan USG (pre scanning) vena cava inferior dilakukan untuk
melihatin dekskolapsibilitas, sekaligus dilakukan pemasangan kateter vena sentral
dan kateter hemodialisis serta arteriline untuk pemantauan hemodinamik, terutama
untuk menilaidelivery oksigen (DO2), curahjantung (cardiac output = CO)
danisisekuncup (stroke volume = SV) sertata hananvaskuler sistemik (systemic
vascular Resistance = SVR).
Pemantauan hemodinamik dengan menggunakan alatVigileo, dihitung SVR
ternyata rendah (sesuaisyokseptik) serta dilakukan fluid challenge test menggunakan
stroke volume sebagai target.
Dilakukan loading kristaloid tiap 200ml untuk menilai kenaikan SV.Oleh
karena pasien tampak bertambah sesak napas karena overload cairan, dan meskipun
pasien sudah mendapatkan terapidiuretik (furosemide sampaidosis 20mg/jam), tetapi
urin 3 jam pertama di ICU hanya 50ml, maka diputuskan untuk melakukan Renal
Replacement Therapy (RRT), yaitu CVVHDF direncanakan dengan: resepfluid
removal: 50ml/jam, replacement: 1000ml/jam, dialisat: 1000ml/jamContinous RRT
dimulai sejak hari pertama selama 48 jam. Cairan yang dikeluarkanlebihdari 4000ml
dalam 48 jam.Sehingga dari balans +1150ml di hari pertama (belum termasuk balans
pasien selama di RS swasta sebelumnya) menjadi +250ml di hari ketiga.Dengan
produksi urin di hariketiga> 1ml/kg/jam. Dengan CRRT ketergantungan akan dosis
norepinefrin (NE) tampak sangat jauh berkurang. Sebelumnya MAP dipertahankan
diatas 70mmHg dengan dosis NE 0,8-1ug/kg/menit tetapi setelah program CRRT
dosis NE adalah 0,1ug/kg/menit untuk mempertahankan MAP yang sama. Parameter
hemodinamik seperti CO, CI dan SV tampak membaik walaupun pada hari ke VII,
VIII, IX terlihat sedikit menurun kembali.
Selama RRT, tetap diberikan cairan kristaloid rumatan 20ml/jam dan
albumin 20% 100ml sebagai volume ekspander dan untuk menarik cairan di jaringan
yang edema. Antibiotik empirik tetap diberikan dengan terapi dosis. Adanya HAP
dan ISK dengan kemungkinan kuman multiresistens maka digunakan terapi
antibiotik meropenem 3x1 g dan amikasin 1x1 g.
i

Infeksi yang menyebabkan syok pada pasien ini diduga pneumonia yang
didapatkan dari RS swasta dan juga infeksi saluran kemih yang dibuktikan dengan
hasil urinalis ditemukan bakteri dan jamur. Pada hari kesembilan, keluar hasil kultur
sputum yakni candida albicans sehingga pemberian anti fungal.

BAB IV
PENUTUP
4.1

Kesimpulan
Sindrom kardiorenal terjadi pada pasien yang mengalamai sepsis berat dan
syok septik. Patogenesis terjadinya CRS dipengaruhi oleh berbagai faktor yang
mempengaruhi baik fungsi jantung dan atau ginjal, termasuk keadaan syok yang
dihubungkan dengan hipoperfusi ginjal, vasodilatasi pembuluh darah sistemik
maupun intrarenal, reaksi inflamasi jaringan, disfungsi endotel dan terjadinya
gangguan permeabilitas vaskular.
Pada kasus sepsis berat dan syok sepsis keberhasilan terapi terletak pada
penatalaksanaan yang adekwat dan implementasi dari 3 pilar sepsis yakni resusitasi
cairan sedini mungkin dapat mencapai target hemodinamik, pemberian antibiotik
yang tepat dan adekwat serta source control yang baik.

4.2

Saran
Syok dapat mengancam nyawa seseorang,jika tidak diobati, biasanya
berakibat fatal. Jika diobati, hasilnya tergantung kepada penyebabnya, jarak antara
timbulnya syok sampai dilakukannya pengobatan serta jenis pengobatan yang
diberikan. Kemungkinan terjadinya kematian pada syok karena serangan jantung atau
syok septik pada penderita usia lanjut sangat tinggi.
Mencegah syok lebih mudah daripada mencoba mengobatinya. Pengobatan
yang tepat terhadap penyebabnya bisa mengurangi resiko terjadinya syok.

Daftar Isi
BAB I

PENDAHULUAN

1.1Latar Belakang.............................................................................................................. 1
1.2Rumusan Masalah.......................................................................................................... 2
1.3Tujuan........................................................................................................................ 2
1.3.1Tujuan Umum............................................................................................................. 2
1.3Tujuan Khusus.............................................................................................................. 2
BAB II 3
TINJAUAN TEORI

2.1Definisi....................................................................................................................... 3
2.2Etiologi....................................................................................................................... 4
2.3Patogenesis.................................................................................................................. 4
2.4Patofisiologi Syok Septik................................................................................................. 6
2.5Gejala Klinis Sepsis........................................................................................................ 6
2.6Diagnosis..................................................................................................................... 7
2.6.1Riwayat.................................................................................................................... 7
2.6.2PemeriksaanFisik........................................................................................................ 7
2.6.3Laboratorium.............................................................................................................. 7
2.7Penatalaksanaan............................................................................................................ 8
2.7.1Stabilisasi pasien langsung............................................................................................. 8
2.7.2Darah harus cepat dibersihkan dari mikroorganisme............................................................20
2.7.3Pemberian antibiotik................................................................................................... 20
BAB III 22
TINJAUAN KASUS

22

3.1Contoh Kasus............................................................................................................. 22
3.2Penatalaksanaan.......................................................................................................... 22
3.2.1Di UGD.................................................................................................................. 22
3.2.Di ICU..................................................................................................................... 25
BAB IV 28
PENUTUP

28

4.1

Kesimpulan

4.2

Saran 28

28