Anda di halaman 1dari 15

REFRAT KULIT

VARICELLA ZOSTER

Disusun Oleh:
Andriani Rianti Siswanto
406147025
Dosen Pembimbing
dr. Hendrik Kunta Adjie, Sp. KK

KEPANITERAAN ILMU KULIT DAN KELAMIN


RUMAH SAKIT HUSADA
PERIODE 20 OKTOBER 2014 22 NOVEMBER 2014
UNIVERSITAS TARUMANAGARA
JAKARTA

BAB I
KASUS
I.

II.

IDENTITAS PASIEN
Nama

Nn. NP

Umur

22 tahun

Jenis Kelamin

Perempuan

Alamat

Mangga Dua Selatan, Jakarta Pusat

Status Pekerjaan

Perawat

Status Pernikahan

Belum menikah

Agama

Islam

ANAMNESIS
Auto anamnesa dari pasien pada tanggal 04 November 2014
Keluhan Utama

Timbul bintil-bintil kemerahan berisi air.

Keluhan Tambahan

Gatal pada bintil-bintil merah, disertai


demam dan mual sejak 3 hari yang lalu.

Riwayat Penyakit Sekarang :

Pasien datang dengan keluhan muncul


bintil-bintil kemerahan berisi air sejak 2
hari yang lalu. Awalnya bintil-bintil
muncul di bahu kemudian menyebar ke
dada, kedua tangan dan wajah. Lesi
dirasakan semakin lama semakin banyak.
Rasa gatal pada lesi membuat pasien
menggaruk,

sehingga

beberapa

lesi

pecah.
Pasien juga merasakan demam yang
tidak terlalu tinggi serta mual sejak 3
hari yang lalu.

Pasien adalah seorang perawat dan


mengaku tertular dari salah satu pasien
yang ia rawat.
Pasien tidak memiliki riwayat alergi,
asma, diabetes mellitus dan hipertensi.
Riwayat Penyakit Dahulu

III.

IV.

Sebelumnya belum pernah seperti ini

Riwayat Penyakit Keluarga :

Di keluarga tidak ada yang seperti ini

Riwayat Pengobatan

Belum diobati sebelumnya.

Keadaan Umum

Baik

Kesadaran

Compos mentis

Tensi

110/70 mmHg

Suhu

38,20C

Berat Badan

56 kg

Tinggi Badan

160 cm

Status Gizi

Normal (IMT = 21,8)

Distribusi

Generalisata

Lokasi

Regio dada bagian depan dan belakang,

STATUS GENERALIS

STATUS DERMATOLOGI

seluruh wajah, kedua lengan dan paha.


Eflorosensi Primer

Papul eritem dan vesikel berukuran


lentikuler dan jumlahnya multipel

Eflorosensi Sekunder

Krusta kekuningan (serum)

V.

RESUME
Seorang wanita berumur 22 tahun, dengan keluhan muncul bintil-bintil merah
berisi air di bahu sejak 2 hari lalu yang semakin lama semakin banyak dan
menyebar ke dada, kedua tangan dan wajah. Sebelumnya pasien mengalami
demam dan mual sejak 3 hari yang lalu. Pasien adalah seorang perawat, dan
mengaku tertular dari pasien yang ia rawat. Dulu ia belum pernah seperti ini
dan ia tidak punya riwayat alergi.
Status Dermatologis
Distribusi

Generalisata

Lokasi

Regio dada bagian depan dan belakang,


seluruh wajah, kedua lengan dan paha.

Eflorosensi

Papul eritem dan vesikel berukuran


lentikuler dan jumlahnya multiple.
Terdapat krusta kekuningan (serum) pada
beberapa lesi.

VI.

DIAGNOSIS
Diagnosis Kerja

Varicella zoster

Diagnosis Banding

Variola, Herpes Zoster

VII.

PENATALAKSANAAN
Non-Medikamentosa
- Tidak menggaruk lesi dan tidak memecahkan lenting yang muncul
- Menjaga kebersihan tubuh
- Istirahat dan makan makanan bergizi
Medikamentosa
- Antivirus

: Valacyclovir tab 3x1000mg/hari selama 5 hari

- Antibiotik

: Amoxicilin tab 3x500mg/hari selama 5 hari

- Anti pruritik : Homochorlcyclizine Hcl 3x10mg/hari jika gatal


- Topikal

: Salicyl talk dan gentamycin ointment

R/ Herclov 500mg No. XXX


S 3 dd II
R/ Amoxicilin 500mg No. XV
S 3 dd I
R/ Homoclomin 10mg No. XV
S 3 dd I
R/ Salisyl talk 2%
Menthol 1%
Tetra 2%
S u e (badan)

No. I

R/ Gentamycin oint tube I


S u e (yang pecah)
VIII.

PROGNOSIS
Ad Vitam

bonam

Ad Functionam

bonam

Ad Kosmetikum

bonam

Ad Sanationam

bonam

BAB II
TINJAUAN PUSTAKA
A. Defenisi
Infeksi akut primer oleh virus varisela-zoster yang menyerang kulit dan
mukosa. Pada gejala klinis terdapat gejala konstitusi, kelainan kulit polimorf,
lokasi utama pada bagian sentral tubuh.

B. Epidemiologi
Varicellaterjadidiseluruhdunia.Insidensiterjadinyavaricelladipengaruhi
olehiklimdandaerahyangtelahmendapatkanvaksinvaricellasebelumnya.Di
daerahyangberiklimsedangdantidakmendapatkanvaksinasivaricella,varicella
adalahendemik,denganprevalensiyangcenderungteraturdanberulangpada
musimsemidanmusimdingin.DiEropadanAmerikaUtaradierapravaksinasi,
90%varicellaterjadipadaanakanakdibawah10tahundankurangdari5%pada
individudiatasusia15tahun.
Penyakit ditularkan secara aerogen (airbone droplets), kontak langsung antara
lesi dengan kulit yang luka. Biasanya krusta tidak menularkan infeksi. Dapat
terjadipadasekitar87%diantarasaudarakandungyangtinggaldalamsaturumah
dan hampir 70% diantara pasien rentan di bangsal rumah sakit yang telah
dilaporkan.Lebihdari95%kasusvaricellayangklinisjelas,meskipunkadang
kadangexanthemamungkinsangatjarangdansementaraberlalutanpadiketahui
denganpasti.Pasienkhasmenularselama12haridanjarangpada34hari
sebelumexanthemmuncul,danuntuk45harisetelahnya,yaitusampaiketika
vesikelmenjadikering.Masainkubasivaricellaratarataadalahsekitar14atau
15hari,dengankisaranantara1023hari.

C. Etiologi
Penyebabnya adalah virus varisela-zoster yang merupakan salah satu dari
herpesvirus. Memiliki envelop dengan diameter 150-200nm. Infeksi primer dari
virus ini menyebabkan varisela, sedangkan reaktivasinya menyebabkan herpes
zoster.

D. Patogenesis
Infeksi primer dari VVZ ini pertama kali terjadi di daerah nasofaring. Virus
mengadakan replikasi dan dilepas ke darah sehingga terjadi viremia permulaan
yang sifatnya terbatas dan asimptomatik. Keadaan ini diikuti masuknya virus ke
dalam Reticulo Endothelial System (RES) yang kemudian mengadakan replikasi
kedua yang sifat viremia nya lebih luas dan simptomatik dengan penyebaran
virus ke kulit dan mukosa. Sebagian virus juga menjalar melalui serat-serat
sensoris ke satu atau lebih ganglion sensoris dan berdiam diri atau laten didalam
neuron. Selama antibodi yang beredar didalam darah masih tinggi, reaktivasi dari
virus yang laten ini dapat dinetralisir, tetapi pada saat tertentu dimana antibodi
tersebut turun dibawah titik kritis maka terjadilah reaktivasi dari virus sehingga
terjadi herpes zoster.

A.SelamainfeksiVaricellaZosterVirus(VZV)primer,virusmengeinfeksidaerahgangliasensorik.
B.VZVbertahanlamapadafaselatendalamgangliabagikelangsunganindividu.

E. Gejala Klinis
Masa inkubasi 14 hari (rata-rata 10-23 hari). Gejala klinis mulai dari gejala
prodromal, yaitu demam tidak terlalu tinggu, sakit kepala, diikuti dengan
munculnya erupsi kulit berupa papul eritomatosa yang dalam waktu beberapa jam
akan berubah menjadi vesikel. Bentuk vesikel khas seperti tetesan embun (tear
drops). Vesikel ini akan berubah menjadi pustul dan krusta dalam waktu 8-12
jam. Sementara proses ini berlangsung, timbul lagi vesikel-vesikel yang baru
sehingga menimbulkan gambaran polimorfi. Krusta akan lepas 1-3 minggu,
meninggalkan bekas merah muda. Lesi yang pecah karena digaruk dapat mejadi

jaringan parut. Pada kasus yang jarang dapat juga terjadi hemmoragic varicella
jika ada darah dalam pustul.

Vesikel dan Krusta

Gambaran Polimorfik

Hemorrhagic Varicella

Lesi pada mukosa mulut

Penyebarannya terutama di badan dan kemudian menyebar secara sentrifugal ke


wajah dan ekstremitas, serta dapat menyerang selaput lendir mata, mulut, dan
saluran napas bagian atas. Jika terdapat infeksi sekunder terdapat pembesara
kelenjar getah bening regional. Penyakit ini biasanya disertai dengan rasa gatal.
Komplikasi sering pada orang dewasa, berupa ensefalitis, pneumonia,
glomeronefritis, karditis, hepatitis, keratitis, konjungtivitis, otitis, arteritis dan
kelainan darah.

F. Diagnosis
Varicella biasanya dapat didiagnosis langsung berdasarkan penampilan dan
karakteristik dari ruam yang tampak, terlebih bila terdapat riwayat paparan
selama 2-3 minggu sebelumnya.

G. Pemeriksaan Penunjang
1. Tzancksmear
Preparat diambil dari discraping
dasar vesikel yang masih baru,
kemudian

diwarnai

dengan

pewarnaan yaitu hematoxylin-eosin,


Giemsas, Wrights, toluidine blue
ataupun

Papanicolaous.

menggunakan

Dengan

mikroskop

cahaya

akan dijumpai multinucleated giant cells. Pemeriksaan ini sensitifitasnya


sekitar 84%.Test ini tidak dapat membedakan antara virus varicella zoster
dengan herpes simpleks virus.
2. Directfluorescentassay(DFA)
Preparat diambil dari scraping dasar vesikel tetapi apabila sudah berbentuk
krusta pemeriksaan dengan DFA kurang sensitif. Hasil pemeriksaan cepat.
Membutuhkan mikroskop fluorescence. Test ini dapat menemukan antigen
virus varicella zoster. Pemeriksaan ini dapat membedakan antara VZV dengan
herpes simpleks virus.
3. Polymerase chain reaction (PCR)
Pemeriksaan dengan metode ini sangat cepat dan sangat sensitif. Dengan
metode ini dapat digunakan berbagai jenis preparat seperti scraping dasar
vesikel dan apabila sudah berbentuk krusta dapat juga digunakan sebagai
preparat, dan CSF. Sensitifitasnya berkisar 97 - 100%.Test ini dapat

menemukan nucleic acid dari virus varicella zoster.

4. Biopsi kulit
Hasil pemeriksaan histopatologis : tampak vesikel intraepidermal dengan
degenerasi sel epidermal dan acantholysis. Pada dermis bagian atas dijumpai
adanya lymphocytic infiltrate.

H. Diagnosis Banding
Variola
Variola merupakan penyakit virus yang
disertai keadaan umum yang buruk, dapat
menyebabkan

kematian,

eflorisensinya

bersifat monomorf terutama terdapat di


perifer tubuh. Masa inkubasi 2-3 minggu,
dengan gejala nyeri kepala, nyeri tulang,
sendi dan demam tinggi, menggigil, lemas dan muntah-muntah. Timbul
makula-makula erimatosa yang cepat menjadi papul-papul, terutama di
muka dan ekstremitas, termasuk telapak tangan dan telapak kaki.
Dalam waktu 5-10 hari timbul vesikel-vesikel yang kemudian menjadi
pustul-pustul dan pada saat ini suhu tubuh meningkat lagi. Pada kelainan
tersebut timbul umbilikasi. Kemudian akan timbul krusta-krusta, kadang
menyebabkan perdarahan yang disebabkan depresi hematopoetik dan
disebut black variola.

10

Herpes Zoster
Daerah yang paling sering terkena adalah
daerah torakal, walaupun daerah-daerah lain
tidak jarang. Frekuensi penyakit ini pada pria
dan wanita sama, sedangkan mengenai umur
lebih sering pada orang dewasa. Sebelum
timbul gejala kulit terdapat, gejala prodromal
baik sistemik (demam, pusing, malaise), maupun gejala prodromal local
(nyeri otot-tulang, gatal, pegal dan sebagainya). Setelah itu timbul eritema
yang dalam waktu singkat menjadi vesikel yang berkelompok dengan
dasar kulit yang eritematosa dan edema. Vesikel ini berisi cairan yang
jernih, kemudian menjadi keruh (berwarna abu-abu), dapat menjadi pustul
dan krusta.

I. Komplikasi
1. Infeksi sekunder pada kulit yang disebabkan oleh bakteri
Sering dijumpai infeksi pada kulit dan timbul pada anak-anak yang berkisar
antara 5 - 10%. Lesi pada kulit tersebut menjadi tempat masuk organisme
yang virulen dan apabila infeksi meluas dapat menimbulkan impetigo,
furunkel, cellulitis, dan erysepelas. Organisme infeksius yang sering menjadi
penyebabnya adalah streptococcus grup A dan staphylococcus aureus.
2. Scar
Timbulnya scar yang berhubungan dengan infeksi staphylococcus atau
streptococcus yang berasal dari garukan.
3. Pneumonia
Dapat timbul pada anak - anak yang lebih tua dan pada orang dewasa, yang
dapat menimbulkan keadaan fatal. Pada orang dewasa insiden varicella
11

pneumonia sekitar 1 : 400 kasus.

4. Neurologik
Acute postinfeksius cerebellar ataxia
Ataxia sering muncul tiba-tiba, selalu terjadi 2 - 3 minggu setelah
timbulnya varicella. Keadaan ini dapat menetap selama 2 bulan.
Manisfestasinya berupa tidak dapat mempertahankan posisi berdiri hingga
tidak mampu untuk berdiri dan tidak adanya koordinasi dan dysarthria.
Insiden berkisar 1 : 4000 kasus varicella.
Encephalitis
Gejala ini sering timbul selama terjadinya akut varicella yaitu beberapa hari
setelah timbulnya ruam. Lethargy, drowsiness dan confusion adalah gejala
yang sering dijumpai.
Beberapa anak mengalami seizure dan perkembangan encephalitis yang
cepat dapat menimbulkan koma yang dalam.
Merupakan komplikasi yg serius dimana angka kematian berkisar 5-20%.
Insiden berkisar 1,7 / 100.000 penderita.
5. Herpes zoster
Komplikasi yang lambat dari varicella yaitu timbulnya herpes zoster, timbul
beberapa bulan hingga tahun setelah terjadinya infeksi primer.
6. Reye syndrome
Ditandai dengan fatty liver dengan encephalophaty.Keadaan ini berhubungan
dengan penggunaan aspirin, tetapi setelah digunakan acetaminophen
(antipiretik) secara luas, kasus reye sindrom mulai jarang ditemukan.

12

J. Penatalaksanaan
Pada bayi atau anak dengan imunokompeten, varicella biasanya ringan dan
dapat sembuh sendiri. Gatal dapat diatasi dengan bedak salisil 1% atau lotion
kalamin dengan antipruritus dan atau antihistamin sedatif oral.
Bila vesikel sudah pecah atau sudah terbentuk krusta, dapat dioleskan salep
antibiotik untuk mencegah infeksi sekunder bakterial. Kadang diperlukan
antipiretik atau analgetik.
Pemberian antivirus dapat mengurangi lama sakit, keparahan dan waktu
penyembuhan akan lebih singkat. Pemberian antivirus sebaiknya dalam jangka
waktu kurang dari 48 - 72 jam setelah erupsi dikulit muncul. Golongan antivirus
yang dapat diberikan yaitu asiklovir, valasiklovir dan famasiklovir.
Dosis anti virus (oral) untuk pengobatan varicella dan herpes zoster :

2
Neonatus : Asiklovir 500 mg / m IV setiap 8 jam selama 10 hari.

Anak (2-12tahun): Asiklovir4x20mg/kgBB/hari/oral selama 5 hari.

Pubertas dan dewasa : - Asiklovir 5x800 mg / hari / oral selama 7 hari.


-

Valasiklovir 3x1 gr/hari/ oral selama 7 hari.

Famasiklovir 3x500 mg/hari/ oral selama 7


hari.

K. Pencegahan
Pemberian vaksin dapat mencegah penyakit varisela sampai dengan 80%.
Vaksin varisela berasal dari virus yang telah dilemahkan. Vaksin yang dapat
digunakan adalah Varivax dan Proquad. Varivax hanya berisi antigen varisela
yang diberikan untuk umur 12 bulan. Sedangkan proquad adalah kombinasi dari
vaksin MMR dan varisela yang diberikan untuk anak-anak berumur 12 bulan-12

13

tahun. Vaksin diberikan pada umur 12 bulan atau lebih dan diulang setelah 4-6
tahun.
Pemberiannya secara subkutan, 0,5 ml pada yang berusia 12 bulan-12 tahun,
biasanya bersamaan dengan MMR. Pada usia di atas 12 tahun juga diberikan 0,5
ml hanya vaksin varisela saja setelah 4 minggu diberikan dengan dosis yang
sama.
Vaksinasi juga dapat diberikan untuk orang yang baru terpajan dengan virus
secara langsung. Jika terpajannya 3-5 hari, perlindungan vaksin yang diberikan
masih dapat terjadi. Jika terpajannya sudah lebih dari 5 hari dapat diberikan
Varicella Zoster Immuno Globulin, tapi tidak lebih dari 10 hari.

L. Prognosis
Jika imunitas yang baik, penyakit ini dapat sembuh sendiri. Perawatan yang lebih
teliti dan higiene yang baik akan mengurangi timbulnya jaringan parut.

14

BAB III
DAFTAR PUSTAKA

1. Handoko RP. Penyakit Virus. Ilmu Penyakit Kulit dan Kelamin. Edisi Ke-6.
Jakarta: Fakultas Kedokteran Universitas Indonesia, 2011; 115-8.
2. Wolff K, Johnson RA, Suurmond D. Fitzpatricks color atlas and synopsis of
clinical dermatology. 6th ed. San Fransisco: McGraw Hill; 2009. 833-6.
3. Straus S, Oxman M, Schmader K. Varicella and Herpes Zoster. Wolff K,
Goldsmith LA, Katz SI, Gilchrest BA, Paller AS, Leffell DJ. Fitzpatricks
Dermatology In General Medicine. 7th Ed. McGraw-Hill: New York; 2008,
p.1885-95.

15