Anda di halaman 1dari 7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER
2

Mengenai Saya

Lainnya BlogBerikut

Rabu,30Januari2013

MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

mahsus.al.azmi@gmail.com

Klik Yang Anda Cari di Bawah


2013(4)

EtikaParista
Hidupinitidaklah
mudah,banyakhal
terkadangyang
sulitditerimadan
sulitdipahami,oleh
karenaitubelajar
adalahproses
tanpaakhir.
Lihatprofil
lengkapku

Facebook
EtichaRistaNugroho

BuatLencanaAnda

2.1.AyamBroiler

November2013

Broileradalahayamayammudajantanataubetinayangumumnyadipanenpadaumur56minggu
dengan tujuan sebagai penghasil daging. Sehubungan dengan waktu panen yang relatif singkat maka jenis

Januari2013

ayaminimempersyaratkanpertumbuhanyangcepat,dadalebaryagndisertaitimbunandagingyangbaik,dan
warnabulunyangdisenangi,biasanyawarnaputih.
Ayambroilertelahbanyakdipeliharaolehpeternakdidaerahperkotaandanpedesaanbaiksebagai
usahapokokatausambilan,terutamadijawa.Penyebaranayambroilercukupluaskarenaproduksidagingnya
dapatditerimaolehseluruhlapisanmasyarakatdanharganyayangrelatifmurahbiladibandingkandegngan
dagingmerah.Disampingitu,pemeliharaantidakmemerlukanlahanyangrelatifluas.
Ayam broiler merupakan hasil teknologi yaitu persilangan antara ayam Cornish dengan Plymouth
Rock. Yang mana memiliki karakteristik ekonomis, pertumbuhan yang cepat sebagai penghasil daging,

MAKALAH
PENERAPAN
KESRAWANDI
RPH
MANAJEMENAYAM
BROILERFASE
STARTERDAN
FASEGROWE...
2012(14)

konversi pakan rendah, dipanen cepat karena pertumbuhannya yang cepat, dan sebagai penghasil daging
denganseratlunak(Murtidjo,1987).MenurutNorthe(1984)pertambahanberatbadanyangidealadalah400
grampermingguuntukjantandanuntukbetina300gramperminggu.
Menurut Suprijatna et al. (2005) Ayam broiler adalah ayam yang mempunyai sifat tenang, bentuk
tubuh besar, pertumbuhan cepat, bulu merapat ke tubuh, kulit putih dan produksi telur rendah. Dijelaskan
lebih lanjut oleh Siregar et al. (1980) bahwa ayam Broiler dalam klasifikasi ekonomi memiliki sifatsifat
antaralain:ukuranbadanbesar,penuhdagingyangberlemak,temperamentenang,pertumbuhanbadancepat
sertaefisiensipenggunaanransumtinggi.
Untukmendapatkanbobotbadanyangsesuaidenganyangdikehendakipadawaktuyangtepat,maka
perlu diperhatikan pakan yang tepat. Kandungan energi pakan yang tepat dengan kebutuhan ayam dapat
mempengaruhikonsumsipakannya,danayamjantanmemerlukanenergyyanglebihbanyakdaripadabetina,
sehingga ayam jantan mengkonsumsi pakan lebih banyak, (Anggorodi, 1985). Halhal yang terus
diperhatikandalampemeliharaanayambroilerantaralainperkandangan,pemilihanbibit,manajemenpakan,
sanitasidankesehatan,recordingdanpemasaran.Banyakkendalayangakanmunculapabilakebutuhanayam
tidakterpenuhi,antaralainpenyakityangdapatmenimbulkankematian,danbilaayamdipanenlebihdari8
minggu akan menimbulkan kerugian karena pemberian pakan sudah tidak efisien dibandingkan
kenaikkan/penambahanberatbadan,sehinggaakanmenambahbiayaproduksi(Anonimus,1994)
Daghir(1998)membagitigatipefasepemeliharaanayambroileryaitufasestarterumur0sampai3
minggu,fasegrower3sampai6minggudanfasefinisher6mingguhinggadipasarkan.
Ayam broiler ini baru populer di Indonesia sejak tahun 1980an dimana pemegang kekuasaan
mencanangkan panggalakan konsumsi daging ruminansia yang pada saat itu semakin sulit keberadaannya.
Hingga kini ayam broiler telah dikenal masyarakat Indonesia dengan berbagai kelebihannya. Hanya 56
minggu sudah bisa dipanen. Dengan waktu pemeliharaan yang relatif singkat dan menguntungkan, maka
banyakpeternakbarusertapeternakmusimanyangbermunculandiberbagaiwilayahIndonesia.
BanyakstrainayampedagingyangdipeliharadiIndonesia.Strainmerupakansekelompokayamyang
dihasilkanolehperusahaanpembibitanmelaluiprosespemuliabiakanuntuktujuanekonomistertentu.Contoh
strain ayam pedaging antara lain CP 707, Starbro, Hybro (Suprijatna et al.,
2005).

http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

1/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

2.2.PemeliharaanStarter
1.Persiapankandangdanperlengkapannya
Sebelumanakayamtibamakakandangharussudahsiap.Persiapankandangdocuntukayambroiler
tidak berbeda dengan doc utuk ayam petelur. Begitu pula perlengkapan kandangnya, sampai mencapai
pertumbuhanbuluyangsempurna.Penempatantempatmakanatauminumjugasama.
Saatiniberbagaiperlengkapankandang(tempatmakan/minum)buatanpabrik,dariyangsederhana
sampaiyangotomatismulaibanyakdiperjualbelikan
1.Ransumstarter(03minggu)
Ransumyaitucampurandariberbagaibahanpakanyangdiberikanselama24jam.Bahanpakanyang
biasa digunakan untuk ransum ayam broiler yaitu jagung kuning, dedak halus, bungkil kedelai, bungkil
kelapa,tepungikan,minyakkelapa,kulitkerang,dantepungtulang.
Penyusunanansumayambroiler,didasarkanpadakandunganenergidanprotein.Untukayambroiler,
padaumur03minggu,ransumyangdigunakanharusmengandungprotein23%danenergimetabolis3.200
kkal/kg(NRC/2984).Namunmenururtbeberapapenelitianbisajugadigunakanransumdenganprotein22%
danenergimetabolis3000kkal/kgsampaiayamtersebutdipanen.Kandunganlainyangharusdiperhatikan
yaituseratkasar7%,lemak8%,kalsium1%,danphosphoryangtersediasekitar0,45%.
Untukitujikaakanmenyusunransumperludiketahuikandunganzatzatmakananyangterkandungdi
dalam bahan pakan yang akan digunakan. Kandungan zat makanan dapat diketahui melalui analisa
laboratoriumdapatdilihatpadatabel1.
Tabel1.Kandunganzatzatmakanandanenergimetabolispakan
No

Bahanpakan

Protein(%)

Lemak(%)

Seratkasar
(%)

Energimetabolis
(kkal/kg)

Jagungkuning

8,6

3,9

2,0

3.370

Dedakhalus

12,0

13,0

12,0

1.630

Bungkilkedelai

45,0

0,9

6,0

2.240

Bungkilkelapa

21,0

1,8

15,0

1.540

Bungkilkacang
tanah

42,0

1,9

17,0

2.200

Tepungikan

61,0

4,0

1,0

2.830

Berdasarkanhasilanalisakandunganzatzatpadabahanpakandankebutuhanransumuntukayam
maka dapat disusun ransum yang diperlukan. Contoh ransum ayam broiler untuk fase starter dapat dilihat
padatabel2.
Tabel2.Susunanransumayambroilerfasestarter
No

Bahanpakan

Jumlah

Protein

lemak

Seratkasar

EM
2.022,00

Jagung

60,00

5,16

2,34

1,20

Dedakhalus

3,00

0,36

0,39

0,36

Bungkil
kedelai

20,50

9,23

0,18

1,23

Bungkil
kelapa

1,50

0,32

0,02

0,23

Tepungikan

13,00

7,90

0,52

0,13

Minyak
kelapa

1,50

PremixA
Jumlah

48,90
459,20
23,10
370,50
129,00

0,50

100,00

22,97

3,45

3,15

3.052,70

Untukmemudahkanperhitungan,ransumdisusunperseratuskilogram.Ransumpadatabel2dihitung
dengan menggunakan energi metabolis 3000 kkal/kg dengan protein 23%. Kandungan protein ransum ini
cukuptinggi,agarbisamendukungpertumbuhanayam.Masapertumbuhanayambroileryangpalingcepat
yaitusejakmenetassampaiumur34minggu.
2.Pencegahanpenyakit
Untukmenghasilkanayambroileryangsehat,selainmemperhatikankebersihanlingkunganjugaperlu
melakukan vaksinasi maupun pemberian obatobatan dan vitamin. Vaksinasi dilakukan untuk mencegah
penyakit unggas menular yang tidak bisa diobati misalnya ND/tetelo, dan gumboro. Jenis vaksin ND ini
banyak tersedia di poultry shop dengan merk dagang dan cara penggunaan yang berbeda. Contoh vaksin
gumboro yaitu Medivac GumboroA, yang diberikan sekitar 12 hari. Pemberian jenis vaksin yang berbeda
tidak dilakukan pada waktu yang bersamaan karena dikhawatirkan ayam tidak tahan. Contoh program
pencegahanpenyakitdalampemeliharaanayambroilerdapatdilihatpadatabel3.
Dosispemakaiandanpetunjukpenggunaannyabiasanyatercantumdalamkemasanvaksinyangakan
digunakan. Vaksinasi sebaiknya dilakukan pada sore hari agar ayam lebih mudah ditangkap (bila vaksin
http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

2/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

melaluisuntikan).Disampingitu,vaksintidakakanterkenasinarmatahariyangdapatmematikanvaksin.
Jika vaksin diberikan melalui air minum, maka ayam harus dipuasakan dulu sekitar 23 jam sebelummya
supayaairminumyangtelahdiberilarutanvaksincepathabis,sehinggavaksintidakmatiatauterbuang.
Programpencegahanpenyakitataupenggunaanobatobatan/vitamin,untuktiappeternakberbeda
bedatergantungkepadajenispenyakityangseringtimbuldipeternakantersebut.Seranganpenyakitinidapat
meningkatkanangkakematian.Angkakematiansekitar5%darimulaipemeliharaanDOCsampaidipasarkan,
masihdianggapcukupberhasil.
Tabel3.Programpencegahanpenyakitdalampemeliharaanayambroiler
Umur
(hari)
12
16
35
68
911
12
1215
1617
1819
2223
2427
2823

Namavaksin/obat
Hidrostress
VaksinND
Sindoflox
Vitastress
Theraphy
MedivacGumboroA
Hidrostress
Theraphy
Hidrostress
Theraphy
Hidrostress
Dinabro

Teknikpelaksanaan

5g/10literairminum
Tetesmata
1ml/2literairminum
1g/1literairminum
1g/2literairminum
Melaluiairminum
5g/10literairminum
1g/2literairminum
5g/10literairminum
1g/2literairminum
5g/2literairminum
5g/10literairminum

tujuan
Mengurangistress
MencegahpenyalitND
MencegahCRD
Mengurangistress
Mencegahcoccidiocis
Mencegahgumboro
Mengurangistres
Mencegahcoccidiocis
Mengurangistres
Mencegahcoccidiocis
Mengurangistres
Merangsangpertumbuhan

2.3.PemeliharaanGrower/Finisher
1.Kandang
a.sistemlitter
Anak ayam yang bulunya telah tumbuh sempurna (selesai fase starter) biasanya dipindahkan ke
kandangfinisher.Dalampemeliharaanbroilerbiasanyakandanguntukpemeliharaanfinisherjugadigunakan
untukbrooder.
Bagunan kandang yang digunakan yaitu kandang yang kedua sisi dindingnya terbuka sebagai ventilasi.
Pemeliharaan ayam broiler biasanya menggunakan sistem litter. Sistem litter yaitu kandang yang lantainya
ditutup dengan bahan organik yang partikelnya berukuran kecil. Sistem litter banyak dipakai karena
pemeliharaannya mudah dan murah. Sementara pemeliharaan dalam sistem cage biayanya lebih mahal dan
pemeliharaannya relatif lebih sulit. Bahan litter yang digunakan harus memenuhi syaratsyarat sebagai
berikut.
Ringan.
Mempunyaipartikelyangsedang.
Dayaserapyangtinggi.
Cepatmenjadikering.
Lunak.
Mempunyainilaikonduksipanasyangrendah.
Tidakmenghisapairdariudara.
Murahdanmudahdidapat.
Dapatdigunakanuntukpupuk.
Dalam keadaan terpaksa litter bekas yang pernah dipakai bisa digunakan lagi. Namun, perlu
diperhatikan bahwa litter tersebut harus kering dan bukan bekas pemeliharaan ayam yang pernah terkena
penyakitmenularsupayatidakterjadipenularanpenyakitkepadaayamyangakandipelihara.
Hallainjugaperludiperhatikanyaitupopulasiayamdalamkandangsebaiknyatidakterlalupadat.
Jikaterlalupadatmakaakanmempengaruhiperformaayam,misalnyasebagaiberikut.
Konsumsi ransum menurun akibat beberapa hal misalnya. Temperatur kandang meningkat,
ransumbanyakyangtumpahdankesempatanmakanyangberkurang.
Pertumbuhanmenurun.
Efisiensipenggunaanransummenurun.
Kematianbertambah.
Kanibalismebertambah.
http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

3/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

Banyakterjadibreastblister(bagianyangmengerasdibagiandada).
Pertumbuhanbuluberkurang.
Banyakpatahtulangpadasaatprocessing(condemnation).
Kandangsistemlitterdenganpopulasiterlalupadatbiasanyasanagntbaudankondisilitterbasah.Bau
initimbulkarenaadanyagasamonia(NH3)yangdihasilkanolehmikroorganismedalamprosespembusukan
kotoran.Jikakadaramoniadalamkandangsudahmencapai50ppmmakaberatbadanayamyangdipelihara
akan berkuarang sekitar 8% pada umur 7 minggu. Kondisi litter yang basah bisa menimbulkan berbagai
macampenyakit(snot,penyakitcacing,dansebagainya).
Kadaramoniadalamkandangakancepat,meningkatjikapHlittermencapai8,sedangkanjikapH<7
makaamoniayangterbentukakanlebihsedikit.Untukmengurangibaudalamkandanginidapatdilakukan
dengancarasebagaiberikut.
Mengurangikepadatanayamdalamkandang.Kepadatanbiasanya1012ekor/m2,untukdataran
rendahbiasanya810ekor/m2.
Dengan mencampurkan superphosphat 1,09 kg/m2 pada litter atau dengan menyemprotkan
posphoricacid1,9liter/m2.
Kandangsistemlitterbisadibuatbertingkat(dua/tigalantai).Namun,dengankandangbertingkat,
lebihbanyaktenagakerjayangdigunakanapalagikalaupemberianmakan/minumdilakukansecaramanual.
Didaerahdaerahdekatpantai,kandangyangdigunakanbiasanyamenggunakansistempanggung
denganalasdaribilahbilahbumbuataukayu.Halinidimaksudkanagardidalamkandangtidakterlalupanas
karenaadaudarayangbisamasukdaribawahkandang.
b.Sistemcage
selain pemeliharaan dalam sistem litter, ayam broiler dapat pula dipelihara dalam sistem cage.
Peternakjarangyangmenggunakansisteminikarenabiayanyacukupmahal.
Kelebihanpemeliharaandengansistemcageyaitusebagaiberikut.
Lebihbanyakayamyangbisadipeliharakarenakandangbisaditingkatkan.
Penangkapanayamlebihmudahpadasaatakandipasarkandanresikobruises(memar)dapatdikurangi.
Biayalittertidakada.
Penyakitcoccidiocisdapatdikurangi.
Pembersihankandanglebihmudah.
Kerugianpemeliharaandengansistemcageyaitusebagaiberikut.
Banyakyangmengalamibreastblister(lepuhdada).
Tulangdadabanyakyangbengkok.
Banyaktrim(garisgarismerah)padakulitsetelahprocessing.
Tulangsayapbiasanyarapuh,sehinggabanyakterjadikerusakanpadasaatapkir.
Seringterjadiinfeksipadafoliclebulu.
2.PerlengkapanKandang
Pemeliharaan broiler umumnya menggunakan sistem litter, tetapi di daerahdaerah tertentu
menggunakansistemslatt.Tempatmakanandanminumanmerupakanperlengkapanyangharusadadidalam
kandang.Bentuktempatmakandanminuminiagaksedikitberbedabiladibandingkandengantempatmakan
atauminumanakayam.
Sebelumkitamemberimakandanminum,tedapatmakanandanminumharusdalamkeadaanbersi.
Jikadalamtempatadasisasisamakananyangsudahtengik/busukmakaakanmenurunkannafsumakanayam
danmenjadisumberpenyakit.
Untukmenjagaagarayamtetapsehatmakatempatmakan/minumharusmudahdibersihkan,tidak
mudah tumpah, mudah di isi, dan ayam mudah makan/minum dari tempat tersebut. Tempat di buat oleh
pabrikdengandesignsederhanasampaiotomatis.Bahanbahanyangdigunakansebagianbesardibuatdari
plastiksehinggamudahdibersihkan.
Tempat makan/minum yang di gunakan petani ternak, umumnya berbentuk bulat (hanging
feeder/materrer) di gantung di langitlangit kandang dengan kawat/tali. Dalam menyediakan tempat
makan/minum harus disesuaikan dengan jumlah ayam yang ada dan telah diperhitungkan setiap ekor ayam
mempunyaikesempatanyangsamadalammengambilmakan/minum.Jikatempatmakankurang,makaayam
akanberebutmengambilmakam/minumsehinggabanyaktercecerbahkantumpah.
Untukmengontrolcukupnyapersediaantempatmakandapatdilakukandenganmelihatsesaatsetelah
ayamdiberimakan,apakahsemuanyabisamakanbersamaanatautidak.Jikaadasebagianayamyangtidak
mempunyaipeluangmakanpadasaatyangbersamaan,makatempatmakanperluditambah.Berbedadengan
tempatairminum,karenaayambiasanyatidakminumbersamaantetapibergiliran.
Tempatmakan/minumyangberbentuktroughsudahjarangdigunakandalamkandangsistemlitter
karena ransum mudah tercemari oleh kotoran. Ransum yang tercemari biasanya dibuang sehingga menjadi
tidakefisien.Perusahaanbesarbiasanyamenggunakantempatmakan/minumotomatis.
http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

4/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

3.RansumFaseFinisher
Padaperiodefinisher(umur36minggu),kondisipertumbuhanayambroilermulaimenurun.Untuk
itu,proteindalamransumditurunkanmenjadi20%(NRC,1994),sedangkanenergiransum,yangdigunakan
30003200 kkal/kg. Bahanbahan penyusun ransum untuk starter tidak berbeda dengan bahan penyusun
ransum untuk finisher. Bentuk fisik ransum yang biasa diberikan pada ayam broiler bisa berbentuk pellet,
mash,ataucrumble.Ransumayambroilerbanyakdijualdenganmerkdagangyangberbedabeda,tergantung
pabrikyangmengeluarkan.
Penggantianransumstarterdenganransumfinishersebaiknyatidakdilakukansekaligus,tetapisecara
bertahap.Padaharipertamamulamuladeberiransumstarter75%ditambahransumfinisher25%,padahari
berikutnyadiberiransumfinisher75%danpadahariberikutnyabarudiberikanransumfinisherseluruhnya.
Jika tahapan ini tidak dilakukan maka nafsu makan ayam menurun untuk beberapa hari dan dikhawatirkan
akanmenghambatpertumbuhan.
Kadangkadangparapeternaktidakmembeliransumyangsudahjadi,tetapimembelikonsentratdan
mencampurnyadenganbahanpakanyangmerekamilikimisalnyajagung.Konsentratadalahcampuranbahan
pakan yang mengandung gizi tinggi untuk dicampur dengan bahan pakan lain sehingga tercapai kebutuhan
untukternakyangakandiberimakansesuaidengantujuanproduksinya.

Tabel4.SusunanRansumBroilerFinisher
No

1
2
3
4
5
6

Bahan
Pakan
Jagung
kuning
Bungkil
kedelai
Dedak
halus
Tepung
ikan
Bungkil
kelapa
Minyak
kelapa

PK

LK

SK

CA

EM

(%)

(%)

(%)

(%)

(%)

(kkal/kg)

60,0

5,16

2,34

1,20

0,01

0,06

2.022,00

15,0

6,75

0,13

0,90

0,04

0,04

336,00

5,5

0,66

0,71

0,66

0,01

0,01

89,65

11,0

6,71

0,44

0,31

0,60

0,30

311,30

5,0

1,05

0,09

0,75

0,01

0,01

84,70

2,0

2,00

172,00

Jumlah

grit

1,0

0,38

0,20

premix

0,5

Jumlah

100,0

20,33

5,71

3,62

1,05

0,62

3.015,65

2.4.KonsumsiRansum
Ayammengkonsumsiransumuntukmemenuuhikebutuhanenerginya,sebelumkebutuhanenerginya
terpenuhi ayam akan terus makan. Jika ayam diberi ransum dengan kandungan energi yang rendah maka
ayam akan makanlebih banyak. Sebaliknya, jika disediakan ransum dengan kandungan energi tinggi maka
ayam akan makan lebih sedikit, karena kebutuhan energinya cepat terpenuhi. Sumber energi utama dalam
ransumbiasanyamenggunakanjagungkuning.
Temperatur lingkungan berpengaruh terhadap konsumsi ransum. Jika temperatur lingkungan
meningkat dari keadaan normal maka ayam akan lebih banyakminum dan sedikit makan. Sebaliknya jika
temperatur lingkungan menurun maka konsumsi ransum meningkat. Temperatur lingkungan yang optimal
untukpemeliharaanbroileryaitusekitar1821C.
Faktor lain yang dapat mempengaruhi konsumsi ransum yaitu bentuk fisik ransum. Bentuk fisik
ransum yang biasa diberikan kepada ayam broiler adalah mash, crumble, dan pellet. Bentuk pellet lebih
bnayakdimakankarenaunggasumunyalebihmenyukairansumbentukbutiran.
Dari hasil penelitian, pemeliharaan ayam broiler tanpa pemisahan jenis kelamin, dengan waktu
pemeliharaan selama 5 minggu, yang diberi ransum dengan energi metabolis 3000 kkal/kg dan protein
ransum 22%, ransum yang dihabiskan sekitar 2,5 kg/ekor, bobot badan yang dihasilkan berkisar 1,21,3
kg/ekor.
2.5.KonsumsiMinum
Airminumharusselalutersediasetiapsaatuntukbroilerdengankualitasairminumyangbaikdan
bebasdariSalmonella,E.Collidanbakteriapatogenlainnya.Kekuranganpersediaanairminum,baikdalam
jumlah,penyebaransertajumlahtempatminumdankonsumsinyadapatmempengaruhiprosespertumbuhan
http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

5/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

Padasaatayamdatang,berikanlarutangula1%palinglama23jampertamasertaberikanantibiotikpada
harike1hinggake3disaatpagihari(palinglama56jam)danberikanvitaminpadasaatsorehari.
Airharusselalubersihdansegardandilakukantestsecarateraturterhadapkandunganzatkimiadan
komposisibakteriologi(6bulansekali).Untukmenjagaairdalamkondisinormal,gunakan35ppmchlorine
untukmengurangimasalahSalmonella,E.Collidanbakteriapatogenlainnya.
Ketinggiantempatairminumuntukbroiler
Tempat air minum harus selalu dicek ketinggiannya setiap hari. Pada umur 18 hari diatur
ketinggiannya bibir tempat air minum sejajar dengan punggung ayam. Kandang yang menggunakan nipple
harus disesuaikan ketinggiannya secara sentral menggunakan kerekan (handwind) sehingga ayam dapat
minumdenganmengangkatkepala3445terhadapnipple.
Levelairminum
Ketinggianairminumsebaiknya0,6cmdibawahtutuptempatminumsampaidengan710haridan
harusadaairdidasartempatminumdenganketinggian0,6cmsejakharike10danselanjutnya.Pengeluaran
airdarinippleminimal80mlpermenitdengantekanan3040cmwatercolumn.
Kualitasairminum
Kualitasairsangatpentingkarenaayamminum22,5kalidarijumlahpakanyangdikonsumsinya.
Lakukan analisa kualitas air minum dua kali setahun untuk memastikan bahwa air minum tersebut masih
layakdikonsumsiditinjaudarikandunganmineral,bahanorganicdanbakteri.
Pada temperature normal, konsumsi air minum ayam adalah 1,6 2,0 kali dari konsumsi pakan.
Faktor ini sebaiknya digunakan sebagai pedoman sehingga penyimpangan konsumsi air yang berkaitan
dengankualitaspakan,temperatureataukesehatanayamdapatsegeradiketahuidandiperbaiki.
Konsumsiair/100ekor/hari
(padasuhu21oC)
Umur(minggu)liter
1.5865
2.102115
3.149167
4.192216
5.232261
6.274308
7.309347
8.342385
2.6.KonversiRansum
Efisiensi ransum yang diberikan kepada ayam bisa dilihat dari angka konversi ransum. Konversi
ransum didenifisikan sebagai banyaknya ransum yang dihabiskan untuk menghasilkan setiap kilogram
pertambahan bobot badan. Angka konversi ransum yang rendah (kecil) berarti banyaknya ransum yang
digunakanuntukmenghasilkansatukilogramdagingsemakinsedikit,begitupulasebaliknya.
Pada minggu pertama, angka konversu ransum ayam broiler ini rendah. Pada mingguminggu
berikutnyaakanmeningkatsesuaidengankecepatanpertumbuhannya.
Tabel 5 memperlihatkan bahwa jantan lebih efisien dalam mengubah ransum menjadi daging
dibandingkan betina. Hal ini karena pertumbuhan jantan lebih cepat dibandingkan betina. Pada umur 6
minggu, konfersi ransum pada jantan maupun betina diatas angka dua. Jika konversi ransum jauh di atas
angkaduamakakurangmenguntungkan.Olehkarenaituayambroilerdipasarkanmaksimalumur6minggu.
Tabel5.Konversiransumayambroilerselama6minggu
Umur(Minggu)

Jantan

Betina

JantanDanBetina

0,80

0,80

0,80

1,20

1,22

1,21

1,37

1,41

1,39

1,70

1,78

1,74

1,98

2,08

2.03

2,29

2,35

2.32

DiposkanolehEtikaParistajam18.39

Reaksi:

bagus (0)

menarik (0)

+2 Rekomendasikan ini di Google

keren (0)

http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

6/7

9/27/2015

EtikaBlog:MANAJEMENAYAMBROILERFASESTARTERDANFASEGROWER

4komentar:
arifwulungalittihad 9Juni201301.26
mbakcantik...qngopyyabuatngerjaintugaskuliahku...heee
Balas

AliYahya 30Juni201323.10
SIP..ijinngopitabelnyaya..,
tambahsiplagikaloditambahidapus..
Balas

RoniFirmansyah 11April201407.17
Mbakizinsedownloadyabagusnihlebihbagusdapusyadisertakan,.,.
biarlebihjelas
thanks
Balas

riafauziah 6Mei201518.28
ijincopyyambak:D
makasih
Balas

MasukkankomentarAnda...

Berikomentarsebagai:

Publikasikan

mahsusalazmi(Google)

Keluar

Beritahusaya

Pratinjau

PostingLebihBaru

Beranda

PostingLama

Langganan:PoskanKomentar(Atom)

Pribadi.TemplateAwesomeInc..Gambartemplateolehjusant.DiberdayakanolehBlogger.

http://etikafarista.blogspot.co.id/2013/01/manajemenayambroilerfasestarterdan_30.html

7/7