Anda di halaman 1dari 31

BABI

PENDAHULUAN
Bronkiektasis adalah suatu penyakit yang ditandai dengan adanya dilatasi
(ektasis) dan distorsi bronkus local ( ukuran diameter jalan nafas > 2 mm) yang
bersifatpatologisdanberjalankronik,persistenatauirreversible.Kelainanbronkus
tersebut disebabkan oleh perubahan yang terjadi pada bronkus berupa destruksi
elemenelemen elastik, otototot polos bronkus, tulang rawan dan pembuluh
pembuluhdarah.Dindingbronkusmelemahakibatperadangankronikyangmengenai
mukosasertalapisanotot.Bahanbahanpurulenperadangankronikyangmengenai
mukosasertalapisanotot.Bahanbahanpurulenterkumpulpadadaerahyangmelebar
inidanmengakibatkaninfeksiyangmenetappadasegmenataulobusyangterserang.
(1,2,3)

A. DEFINISI
Bronkiektasis adalah penyakit paru yangditandai oleh dilatasi bronkus
yangbersifatpatologisdanberlangsungkronik.Dilatasitersebutmenyebabkan
berkurangnyaaliranudaraparuparu.(4)
B. EPIDEMIOLOGI
AngkakejadianyangsebernanyadariBronkiektasistidakdiketahuipasti.
Di Negaranegara Barat, insiden Bronkiektasis diperkirakan sebanyak 1,3%
diantara populasi. Insidens Bronkiektasis cenderung menurun dengan adanya

kemajuanpengobatanantibiotik.Akantetapiperludiingatbahwainsideninijuga
dipengaruhiolehkebiasaanmerokok,polusiudaradankelainankongenital.(1)
Bronkiektasismerupakanpenyebabutamakematianpadanegaranegara
yangkurangberkembang.Terutamapadanegarayangsaranamedisdanterapi
antibiotikterbatas.SedangkandinegaranegaramajusepertiAS,Bronkiektasis
mengalami penurunan seiring dengan kemajuan pengobatan. Bronkiektasis
umumnyaterjadipadapendetitadenganumurratarata39tahun,terbanyakpada
usia 6080 tahun. Sebab kematian yang terbanyak pada Bronkiektasis adalah
karena gagal napas. Lebih sering terjadi pada perempuan daripada lakilaki.
Prevalensi Bronkiektasis lebih tinggi pada penduduk dengan golongan
sosioekonomiyangrendah.(1,3)
DiIndonesiabelumadalaporantentangangkaangkayangpastimengenai
panyakit ini. Penyakit ini dapat diderita mulai sejak anak, bahkan dapat
merupakankelainankongenital.(1)
C. ANATOMIDANFISIOLOGI

Gambar1.Anatomisalurannapas(dikutipdarikepustakaan5)

Bronkusmerupakanpercabangandaritrachea.Terdiridaribronkusdextra
danbronchussinistra:Bronkusdextra,mempunyaibentukyanglebihbesar,lebih
pendekdanletaknyalebihvertikaldaripadabronkussinistra.Halinidisebabkan
olehdesakandariarcusaortaepadaujungcaudaltracheakearahkanan,sehingga
bendabendaasingmudahmasukkedalambronkusdextra.Panjangnyakirakira
2,5cmdanmasukkedalamhiluspulmonissetinggivertebrathoracalisVI.Vena
Azygos melengkung di sebelah cranialnya. Ateria pulmonalis pada mulanya
beradadisebelahinferior,kemudianberadadisebelahventralnya.Membentuk
tigacabang(bronkussekunder),masingmasingmenujukelobussuperior,lobus
medius,danlobusinferior.Bronkussekunderyangmenujukekelobussuperior
letaknyadisebelahcraniala.pulmonalisdandisebutbronkuseparterialis.Cabang
bronkusyangmenujukelobusmediusdanlobusinferiorberadadisebelahcaudal

a.pulmonalisdisebutbronkushyparterialis.Selanjutnyabronkussekundertersebut
mempercabangkanbronkustertieryangmenujukesegmenpulmo.(3)
Bronkussinistra,mempunyaidiameteryanglebihkecil,tetapibentuknya
lebihpanjangdaripadabronkusdextra.Beradadisebelahcaudalarcusaortae,
menyilangdisebelahventraloesophagus,ductusthoracicus,danaortathoracalis.
Pada mulanya berada di sebelah superior arteri pulmonalis, lalu di sebelah
dorsalnyadanakhirnyaberadadisebelahinferiornyasebelumbronkusbercabang
menujukelobussuperiordanlobusinferior,disebutletakbronkushyparterialis.
Pada tepi lateral batas trachea dan bronkus terdapat lymphonodus
tracheobronchialis superior dan pada bifurcatio trachea (di sebelah caudal)
terdapat lymphonodus tracheobronchialis inferior. Bronkus memperoleh
vascularisasi dari a.thyroidea inferior. Innervasinya berasal dari N.vagus, n.
Recurrens,dantruncussympathicus..(3)
DarigambarIdapatkitalihatbahwacabangutamabronkuskanandankiri
akan bercabangmenjadibronkuslobarisdanbronkussegmentalis.Percabangan
iniberjalanterusmenerusmenjadibronkusyangukurannyasemakinkecilsampai
akhirnyamenjadibronkiolusterminalis,yaitubronkiolusyangtidakmengandung
alveoli. Bronkiolus terminalis mempunyai diameter kurang lebih 1 mm.
Bronkiolus tidak diperkuat oleh kartilago tetapi dikelilingi oleh otot polos
sehinggaukurannyadapatberubah.Seluruhsaluranudarasampaipadatingkatini
disebut saluran penghantar udara karena fungsinya menghantarkan udara ke

tempatpertukarangasterjadi.Setelahbronkiolusterdapatasinusyangmerupakan
unit fungsional dari paru. Asinus terdiri atas bronkiolus respiratorius, duktus
alveolaris dan sakkus alveolaristerminalis. Asinusataukadangdisebutlobulus
primermemilikidiameter 0,5sampai1cm.Terdapatsekitar23percabangan
mulaidaritrakeasampaisakkus alveolaristerminalis.Alveolusdipisahkandari
alveolusdidekatnyaolehseptum.Lubangpadadindinginidinamakanporipori
Kohnyangmemungkinkankomunikasiantarasakkus.Alveolushanyaselapissel
saja, namun jika seluruh alveolus yang berjumlah sekitar 300 juta itu
dibentangkanakanseluassatulapangantenis.(3)
Alveolus pada hakikatnya merupakan gelembung yang dikelilingi oleh
kapilerkapiler darah. Batas antara cairan dengan gas akan membentuk suatu
teganganpermukaanyangcenderungmencegahekspansipadasaatinspirasidan
cenderung kolaps saat ekspirasi. Di sinilah letak peranan surfaktan sebagai
lipoproteinyangmengurangiteganganpermukaandanmengurangiresistensisaat
inspirasisekaligusmencegahkolapssaatekspirasi.Pembentukansurfaktanoleh
sel pembatas alveolus dipengaruhi oleh kematangan selsel alveolus, enzim
biosintetikutamanyaalfaantitripsin,kecepatanregenerasi,ventilasiyangadekuat
serta perfusi ke dinding alveolus. Defisiensi surfaktan, enzim biosintesis serta
mekanismeinflamasiyangberjungpadapelepasanprodukyangmempengaruhi
elastisitasparumenjadidasarpatogenesisemphysema,danpenyakitlainnya.(3)

Fisiologi
Strukturdanfungsisalurannapasnormaladalah(1,5)
1. Selepitelpermukaan
Sel epitel permukaan pada saluran intrapulmoner pada dasarnya
dibentukolehduatipesel,yaituselsiliadanselsekretori.Selsekretoridibagi
menjadisubtipeberdasarkanpenampakanmikroskopik(misalnyaSelclara,
gobletdanserous ).Selain musin,sel sekretorijuga melepaskanbeberapa
molekulantikmikroba(sebagaicontaohdefensin,lisosim,danIgA),molekul
immunomodulator(sekretoglobindansitokin)danmolekulpelindung(protein
trefoildanheregulin),semuanyainitergabungdalammukus.(1,5)
2. Kelenjarsubmukosa
Pada saluran napas besar (diameter lumen >2mm), kelenjar
submukosa berkontribusi pada sekresi musin (gambar 2). Kelenjar
dihubungandenganlumensalurannapasolehduktussiliasuperfisialyang
mendorongsekresikeluardanduktuskolektusnonsiliaprofundus.Kelenjar
sumukosaberlokasidiantaraototpolosdankartilago.Selmukousmembentuk
60%volumekelenjar.Selserousyangberlokasididistal,membentuk40%
volume kelenjar, mensekresi proyeoglikan dan protein antimikroba. Pada
keadaan patologi, volume kenjar submukosa dapat meningkat melebihi
volumenormal.(1,5)
3. Lapisanmukosa(lapisanlendir)

Lendir melapisi seluruh saluran napas, dimana kandungan


terbanyaknya adalah cairan, dengan kerakteristik fisik solid. Kandungan
normal mukus adalah 97% air dan 3 % solid (musin, protein nonmusin,
garam,lemakdanseldebris).(1,5)

(Gambar2.Mukusklirenspadasalurannapasyangnormal(dikutipdarikepustakaan6).

Mekanismeklirenssalurannapas
Pertama,mukusdidorongkeproksimalsalurannapasolehgerakansilia,
yangakanmembersihkanpartikelpartikelinhalasi,patogendanmenghilangkan
bahanbahankimiayangmungkindapatmerusakparu.Musinpolimeriksecara
terusmenerus disintesis dan disekresikan untuk melapisi lapisan mukosa.
Kecepatannormalsilia12sampai15x/detik,menghasilkankecepatan1mm/menit
untuk membersihkan lapisan mukosa. Kecepatan mucociliary clearance
meningkatdalamkeadaanhidrasitinggi.Dankecepatangerakansiliameningkat
oleh aktivitas purinergik, adrenergik, kolinergik dan reseptor agonis adenosin,
sertabahaniritankimia.Mekanismekedua,adalahdenganmengeluarkanmukus
dengan refleks batuk. Ini mungkin dapat membantu menjelaskan mengapa
penyakit paru yang disebabkan oleh kerusakan fungsi silia tidak terlalu berat

dibandingkan dengan yang disebabkan dehidrasi, yang menghalangi kedua


mekanisme klirens saluran napas. Meskipun batuk berkontribusi dalam
membersikan mukus pada penyakit dengan peningkatan produksi mukus atau
gangguanfungsisilia,inidapatmenyulitkangejala.5

D. ETIOLOGI
PenyakityangdihubungkandenganterjadinyaBronkiektasisadalah:(6,7)
1. Infeksi : organisme yang terlibat mencakup Klebsiella spesies,
Staphylococcus aureus, Mycobacterium tuberculosis, Mycoplasma
pneumonia, Nontuberculosis mycobacterium, mycobacterium avium,
intracellulare complex, measles, pertusis, influenza, respiratory syncyatial
virus,herpessimplexvirus,dantipetipetertenrudariadenovirus.
2. Obstruksibronchial,bisaakibattumorendobronkial,broncholithiasis,stenosis
bronkusakibatinfeksi,danaspirasibendaasing.
3. CysticFibrosis
4. Primaryciliarydyskinesia
5. Allergicbronchopulmonaryspergillosis
6. Keadaanimunodefisiensi.
7. Kelainananatomikongenital
8. Bronkiektasisakibatakibattertariknyadindingbronkuspadafibrosisparu
E. KLASIFIKASI
BerdasarkankelainananatomisBronkiektasis,dibagi3variasi:(1,8,9,10)
1.
Bronkiektasis tabung (tubular, silindris, fusiformis), merupakan
BronkiektasisyangpalingringandanseringditemukanpadaBronkiektasis
yangmenyertaibronhitiskronik.

2. Bronkiektasis Kantong (saccular) merupakan bentuk Bronkiektasis yang


klasik, ditandai dengan adanya dilatasi dan penyempitan bronkus yang
bersifat irregular. Bentuk ini kadang kadang berbentuk kista (cystic
Bronkiektasis).
3. Bronkiektasis varicose merupakan bentuk diantara bentuk tabung dan
kantung. Istilah ini digunakan karena perubahan bentuk bronkus
menyerupaivarisespembuluhvena.

(Gambar3.BermacammacamtipeBronkiektasis(dikutipdarikepustakaan3)

KlasifikasiBerdasarkanBeratRingannyaPenyakit
Tingkatan beratnya penyakit bervariasi mulai dari yang ringan sampai
berat.Brewismembagitingkatberatnyabronkiektasimenjadiringansedangdan
berat.1

1. BronkiektasiRingan.
Ciriklinis:batukbatukdansputumwarnahijauhanyaterjadisesudahdemam
(adainfeksisekunder),produksisputumterjadidengan adanyaperubahan
posisitubuh,biasanyaadahemoptisissangatringanpasientampaksehatdan
fungsiparunormal.1
2. BronkiektasiSedang.
Ciriklinis:batukbatukproduktifterjaditiapsaat,sputumtimbulsetiapsaat
(umumnyawarnahijaudanjarangmukoid,sertabaukmulutbusuk),sering
adahemoptisis,pasienumumnyatampaksehatdanfungsiparunormal,jarang
terjadijaritabuh.Padapemeriksaanfisisparuseringditemukanronkibasah
kasarpadadaerahparuyangterkena,gambaranfotodadabolehdikatakan
masihnormal.1
3. BronkiektasiBerat.
Ciriklinis:batukbatukproduktifdengansputumbanyakberwarnakotordan
berbau.Seringditemukanadanyapeneumoniadenganhemoptisisdannyeri
pleura.Seringditemukanjaritabuh.Bilaadaobstruksisalurannapasakan
dapat ditemukan adanya dispnea, sianosis atau tanda kegagalan paru.
Umumnyapasienmempunyaikeadaaanumumkurangbaik.Seringditemukan
infeksipiogenikpadakulit,infeksimatadansebagainya.Pasienmudahtimbul
pneumonia,septikemia,absesmetastasis,kadangkadangterjadiamiloidosis.
Padapemeriksaanfisisdapatditemukanronkibasahkasarpadadaerahyang
terkena. Pada gambaran foto dada ditemukan kelainan: 1) penambahan

10

bronchovascularmarking,2) multiplecystscontainingfluidlevels (honey


combappearance).1

Gambar4.PerbedaangambaranparuparunormaldenganparuparupengidapBronkiektasis

(dikutipdarikepustakaan11)

F. PATOGENESIS
Patogenesis Bronkiektasis tergantung dari factor penyebabnya. Apabila
Bronkiektasis timbul kongenital, patogenesisnya tidak diketahui, diduga erat
hubungannyadenganfaktorgenetiksertafaktorpertumbuhandanperkembangan
fetus dalam kandungan. Pada Bronkiektasis didapat patogenesisnya diduga
melalui beberapa mekanisme. Ada beberapa faktor yang diduga ikut berperan
antaralain:1,3
1. Faktorobstruksibronkus.
2. Faktorinfeksipadabronkusatauparu.
3. Faktor adanya beberapa penyakit tertentu seperti fibrosis paru, astmatic
pulmonaryeosinophilia,
4. faktorinstrinsikdalambronkusatauparu.

11

Gambar5.GambaranbronkuspadaBronkiektasis(dikutipdarikepustakaan12)

G. GAMBARANKLINIS/MANIFESTASIKLINIS
12

GejaladantandaklinisyangtimbulpadapasienBronkiektasistergantung
pada luas dan beratnya penyakit, lokasi kelainannya dan ada atau tidaknya
komplikasi lanjut. Ciri khas penyakit ini adalah adanya batuk kronik disertai
produksi sputum, adanya hemoptisis dan peneumonia berulang. Bronkiektasis
yangmengenaibronkuspadalobusatasseringdanmemberikangejala.(1,3,9)
1. Batuk.
Batuk pada Bronkiektasis mempunyai ciri antara lain batuk produktif
berlangsung kronik dan frekuens mirip seperti pada bronkitis kronik
(bronkitislike symptoms), jumlah sputum bervariasi, umumnya jumlahnya
banyakpadapagiharisesudahadaperubahanposisitidurataubangundari
tidur.Kalautidakadainfeksisekundersputumnyamukoid,sedangkanapabila
terjadiinfeksisekundersputumnyapurulen,terjadimemberikanbaumulut
yangtidaksedap(fetoraxore).Padakasusyangsudahberat,misalnyapada
sacculartypeBronkiektasis,sputumjumlahnyabanyaksekali,purulendan
apabila ditampung beberapa lama, tampak terpisah menjadi 3 lapisan: 1)
Lapisanteratasagakkeruh,terdiriatasmukus,2)lapisantengahjernih,terdiri
atassaliva(ludah),3)lapisanterbawahkeruh,terdiriatasnanahdanjaringan
nekrosisdaribronkusyangrusak(cellulardebris).(1,3)
2. Hemoptisis
Hemoptisisatauhemoptoeterjadikirakirapada50%kasusBronkiektasis.
Kelainaniniterjadiakibatnekrosisataudestruksimukosabronkusmengenai

13

pembuluh darah (pecah) dan timbul perdarahan. Perdarahan yang terjadi


bervariasi,mulaidariyangpalingringan(streaksofblood)sampaiperdarahan
yang cukup banyak (masif) yaitu apabila nekrosis yang mengenai mukosa
amathebatatauterjadinekrosisyangmengenaicabangarteribronkialis.(1,9)
Pada dry Bronkiektasis (Bronkiektasis kering), hemoptisis justru
merupakan gejala satusatunya, karena Bronkiektasis jenis ini letaknya di
lobusatasparu,drainasenyabaik,sputumtidakpernahmenumpukdankurang
menimbulkan refleks batuk. Dapat diambil pelajaran, bahwa apabila
ditemukan kasus hemoptisis hebat tanpa adanya gejalagejala batuk
sebelumnya atau tanpa kelainan fisis yang jelas hendaknya diingat dry
Bronkiektasisini.(1)
3. SesakNapas(Dispnea)
Padasebagianbesarpasien(50%kasus)ditemukankeluhansesaknapas.
Timbuldanberatnyasesaknapastergantungpadaseberapaluasnyabronkitis
kronisyangterjadisertaseberapajauhtimbulnyakolapsparudandestruksi
jaringan paru yang terjadi sebagai akibat infeksi berulang (ISPA), yang
biasanyamenimbulkanfibrosisparudanempisemayangmenimbulkansesak
napastadi.Kadangkadangditemukanpulasuaramengi(wheezing),akibat
adanyaobstruksibronkus.(1,3)
4. DemamBerulang

14

Bronkiektasis merupakan penyakit yang berjalan kronik, sering


mengalamiinfeksiberulangpadabronkusmaupunpadaparu,sehinggasering
timbuldemam(demamberulang).(1,3)
H. DIAGNOSIS
1. Anamnesis(1,3)
Pasien dengan bronkhiektasis biasanya mengalami batukbatuk dengan
sputum yang banyak terutama pada pagi hari serta setelah tiduran dan
berbaring. Jadi hal yang perlu datanyakan adalah berapa lama mengalami
batuk?Bercampurdengandahak/darah?Faktoryangmeperberatatauyang
memperinganpenyakit?Disertaisesaknapasatautidak?Danlainsebagainya.
2. PemeriksaanFisik(1,3)
a. Inspeksi.
Adanya batuk darah sering dijumpai pada sekitar 50% dari pasien
dengan bronkhiektasis. Batuk darah pada pasien dengan bronkhiektasis
biasanyabersifatmasifkarenaseringmelibatkanpecahnyapembuluhdarah
arteri yang meregang pada dinding bronkhus dan melemahnya dinding
bronkhus akibat stimulus batuk lama dapat menyebabkan batuk darah
masif.ClubbingFingerdidapatkanpada3050%kasus.
b. Palpasi
Padapalpasi,stremfremitusbiasanyamelemah.
c. Perkusi
Padaperkusi,didapatkansuarasonorsampaihipersonor.
d. Auskultasi.

15

Seringdidapatkanadanyabunyinapasronkhidanwheezingsesuaitingkat
keparahan.
3. PemeriksaanPenunjang
a. PemeriksaanLaboratorium(1,3)
1) Pemeriksaan darah tepi. Biasanya ditemukan dalam batas normal.
Kadang ditemukan adanya leukositosis yang menunjukkan adanya
supurasiaktifdananemiayangmenunjukkanadanyainfeksimenahun.
2) Pemeriksaanurine.Ditemukandalambatasnormal,kadangditemukan
adanyaproteinuriayangbermaknadandisebabkanolehamiloidosis.
Namun imunoglobulin serum biasanya dalam batas normal kadang
bisameningkatataumenurun.
b. PemeriksaanSputum
Pemeriksaansputummeliputivolumedanwarnasputumsertaselseldan
bakteri yang ada dalam sputum. Bila terdapat infeksi maka volume
sputum akan meningkat dan menjadi purulen serta mengandung lebih
banyakleukositdanbakteri.Biakkansputumdapatmenghasilkanflora
normal dari nasofaring seperti Streptokokus pneumoniae, Hemofilus
influenza, Staphylococcus aureus, Kleibsiela, Aerobacter, Amoeba
proteus,danPseudomonasaeroginosa.Apabiladitemukansputumberbau
busukberartimenunjukkanadanyainfeksikumananaerob.(1,3)
c. Spirometri
Pada spirometri sering menunjukkan keterbatasan aliran udara, dengan
rasiopenurunanvolumeekspirasipaksadalamsatudetik(FEV1) untuk

16

memaksa volume kapasitas paksa (FVC), FVC normal atau sedikit


berkurang dan FEV1 menurun. Penurunan FVC menunjukkan bahwa
saluran udara tertutup oleh lendir, dimana saluran napas kolaps saat
ekspirasi paksa atau adanya pneumonitis pada paru. Merokok dapat
memperburuk fungsi paru dan mempercepat kerusakan.
Hyperresponsiveness saluran napas dapat ditunjukkan, dimana 40 %
pasien memiliki 15 % atau peningkatan yang lebih besar pada FEV1
setelah pemberian agonis betaadrenergik, dan 30 sampai 69 % pasien
yangtidakmemilikiterlihatpenurunanFEV 1 memiliki20%penurunan
FEV1setelahpemberianhistaminataumethacholine.(1,2)
d. Pemeriksaanradiologis(1,12)
1) Rontgenthoraks
Bronkiektasis adalah suatu keadaan dimana terjadi dilatasi dari
cabangcabang bronchus/ bronchioles, dapat ditemukan gambaran
sepertidibawahini:(13)
a. Ringshadow
Terdapat bayangan seperti cincin dengan berbagai ukuran
(dapat mencapai diameter 1 cm). Dengan jumlah satu atau lebih
bayangan cincin sehingga membentuk gambaran honeycomb
appearance atau bounches of grapes Bayangan cincin tersebut
menunjukkankelainanyangterjadipadabronkus.BilaBronkiektasis
ini terdapat bersamasama dengan bronchopneumonia maka akan
tampakbercakbercakinfiltratepadalapanganbawahlapanganparu

17

paruataulapangantengahparuparudengangambarabhoneycomb
(sarangtawon);inikitasebutinfectedBronkiektasis.(8,13,14)

Gambar6.Tampakmultipleringshadowyangbanyakmengandungairfluidleveldidaerahlobusbawah
padapasiencysticBronkiektasis(dikutipdarikepustakaan8)

b. Tramline shadow dapat terlihat pada bagian perifer paruparu.


Bayanganiniterdiriatasduagarispararelyangputihdantebal
yangdipisahkanolehdaerahberwarnahitam.gambaransepertiini
sebenaryna normal diemukan pada daerah parahilus. Tramlite
shadow yang sebenarnya lebih tebal dan bukan pada daerah
parahilus(8,14)

18

Gambar7.Bronkiektasis:tampakbayangantramlineyangberadadekatbayanganjantung(dikutipdarikepustakaan8)

Gambar8.Tampakdilatasidaridindingbronkuspadakeduaparu.terutamapadaparukanan.Padalobuskananbawahterdapat
penebalandinding(dikutipdarikepstakaan9)

19

Gambar9.Penebalandindingbronkusyangmembenukpolatubularpadapasienbronkiekasis
(dikutipdarikepustakaan2)

2) Bronkografi
Merupakanpemeriksaanfotodenganpengisianmediakontras
DIONOSIL ke dalam sistem saluran bronkus pada berbagai posisi
(AP,Lateral,Oblik).Pemeriksaaniniselaindapatmenentukanadanya
Bronkiektasis, juga dapat menentukan bentukbentuk Bronkiektasis
yangdibedakandalambentuksilindris(tubulus,fusiformis),sakuler
(kistik)danvarikosis.(1,3,14)

20

Gambar10.GambarBronkografi;kiniteknikyangkunonamunelegandapatmenunjukkanBronkiektasis
silindrisyangdisertaidilatasibronkuslobusbawah(dikutipdarikepustakaan8)

3) CTScanthorax
CTScandenganresolusitinggimenjadipemeriksaanpenunjang
terbaik untuk mendiagnosis Bronkiektasis, mengklarifikasi temuan
dari foto thorax dan melihat letak kelainan jalan napas yang tidak
dapat terlihat pada foto polos thorax. CTScan resolusi tinggi
mempunyaisensitivitassebesar97%danspesifisitassebesar93%.CT
Scan resolusi tinggi akan memperlihatkan dilatasi bronkus dan
penebalan dinding bronkus. Modalitas ini juga mampu mengetahui
lobusmanayangterkena,terutamapentinguntukmenentukanapakah
diperlukanpembedahan.(8,14,15)
CTScan, terutama resolusi tinggi dapat menghasilkan gambar
yang menunjukan dilatasi saluran napas dengan ketebalan dengan
ketebalan1,01,55mm.Sebagaikonsekuensinya,saatinipemeriksaan
ini adalah teknik standar atau untuk mengkonfirmasi diagnosis
Bronkiektasis.(8,14,15)
21

Gambar 11. Pada CT resolusi tinggi menunjukan dilatasi saluran napas pada kedua lobus dan
lingula. Pada potongan melintang, dilatasi saluran napas menunjukan ringlike appearance.
(dikutip dari kepustakaan 15)

I.

DIAGNOSISBANDING
1. Emfisemabullosa
Merupakan emfisema vesikuler setempat dengan ukuran 12cm..
gambaranradiologikberupasuatukantongradiolusendiperiferlapangan
paru,terutamabagianapeksdanbagianbasalparudimanajaringanparu
normal sekitarnya akan terkompresi sehingga menimbulkan keluhan
sesasknapas.(14)

22

Gambar13.Emfisemabulaterdapatbercakanpadakeduaparudariprosesspesifikdenganbayanganbuladikeduaparu
atas(dikutipdarikepustakaan14)

2. CYSTICFIBROSIS(16)
Merupakanpenyakitherediteryangbiasanyadijumpaipadausiamuda.
Terjadi abnormalitas pada paru dimana kelenjar tertentu menghasilkan
secret abnormal. Fibrosis kistik dapat menyebabkan pembesaran pada
lobusatasdibandingpadalobusbawah.
PerubahanCXRterjadiperubahan:
a. Penebalandaridindingbronchus;dilatasidaribronchus
b. Pengembanganparuyangberlebihan
c. Terjadikolapspadaparusecaralokalisir
d. Penumpukan mucus di daerah yang mengalami dilatasi bronchus :
fingerlikeopacities.

23

Gambar14.Pengembanganparusertaperluasandensitasdanpenebalandindingbronchus.

J.

KOMPLIKASI
Korpulmonalkronik(KPK).Komplikasiiniseringterjadipadapasien
Bronkiektasisyangberatdanlanjutataumengenaibeberapabagianparu.Pada
kasusinibilaterjadianastomosiscabangcabangarteridanvenapulmonalis
pada dindingbronkus,akan terjadi arteriovenous shunt,terj,adi gangguan

K.

oksigenasidarahtimbulsianosissentral,selanjutnyaterjadihipoksemia.1
PENATALAKSANAKAN(1,2)
1. PengelolaanUmum
PengelolaaniniditujukanterhadapsemuapasienBronkiektasis,meliputi:
a. Menciptakanlingkunganyangbaikdantepatbagipasien
24

Contohnyamembuatruanganhangat,udararuangankering,mencegah
ataumenghentikanmerokok,mencegahataumenghindaridebu,asap
dansebagainya.
b. Memperbaikidrainasesekretbronkus
Melakukandrainaseporturaltindakaninimerupakancarayangpaling
efektif untuk mengurangi gejala, tetapi harus terjadi secara terus
menerus. Pasien diletakkan dengan posisi tubuh sedemikaian rupa
sehingga dapat dicapaidrainase sputumsecara maksimal.Tiapkali
melakukandrainaseposturaldikerjakanselama1020menitsamapi
sputum tidak keluar lagi dan tiap hari dikerjakan 2 sampai 4 kali.
Prinsip drainase postural ini adalah usaha mengeluarkan sputum
denganbantuangravitasi.Untukkeperluantersebut,posisitubuhsaat
dilakukan drainase postural harus disesuaikan dengan letak
Bronkiektasisnya. Tujuannya adalah untuk menggerakkan sputum
denganpertolongangayagravitasiagarmenujukehilusparubahkan
mengalir sampai tenggorokan sehingga mudah dibatukkan keluar.
Apabiladenganmengaturposisitubuhpasiensepertitersebutdiatas
belum diperoleh drainase sputum secara maksimal dapat dibantu
dengan tindakan memberikan ketukan dengan jari pada punggung
pasien(tabotage).
2. Pengelolaankhusus
a. Kemoterapi
25

KemoterapipadaBronkiektasisdapatdigunakan:1).Secarakontinyu
untuk mengontrol infeksi bronkus (ISPA), 2). Untuk pengobatan
eksaserbasi infeksi akut pada bronkus/paru, atau 3). Keduanya.
Kemoterapi disini mengunakan obat antibiotik tertentu. Pemilihan
antibiotik mana yang harus dipakai sebaiknya berdasarkan hasil uji
sensitivitas kuman terhadap antibiotik. Antibiotik hanya diberikan
kalaudiperlukansaja,yaituapabilaterdapateksaserbasiinfeksiakut.
Antibiotikdiberikanselama710hari,terapitunggalataukombinasi
beberapaantibiotik,samapaikumanpenyebabinfeksiterbasmiatau
sampai terjadi konversi warna sputum yang semula berwarna
kuning/hijau menjadi mukoid (putih jernih). Selanjutnya ada dosis
pemeliharaan. Ada yang berpendapat bahwa kemoterapi dengan
antibiotik ini apabila berhasil akan dapat mengurangi gejala batuk,
jumlahsputumdangejalalainnyaterutamapadasaatadaeksaserbasi
akut,tetapikeadaaninihanyabersifatsementara.(3)
b. Drainasesekretdenganbronkoskop
Cara ini penting dikerjakan terutama pada permulaan perawatan
pasien. Keperluannya antara lain adalah untuk 1). Menentukan
darimana asal sekret, 2). Mengidentifikasi lokali stenosis atau
obstruksibronkus,dan3).Menghilangkanobstruksibronkusdengan

26

sustion drainage daerah obstruksi tadi (misalnya pada pengobatan


atelektasisparu).
c. Pengobatansimtomatik
Pengobatan ini hanya diberikan jika timbul gejala yang mungkin
mengangguataumembahayakanpasien.
1) Pengobatanobstruksibronkus
Apabiladitemukantandaobstruksibronkusyangdiketahuidari
hasil uji faal paru (% VEP 1 < 70%) dapat diberikan obat
bronkodilator. Sebaiknya sewaktu dilakukan uji faal paru dan
diketahuiadanyatandaobstruksisalurannapassekaligusdilakukan
tes terhadap obat bronkodilator. Apabila hasil tes bronkodilator
positif,pasienperludiberikanobatbronkodilatortersebut.
2) Pengobatanhipoksia
Padapasienyangmengalamihipoksia(terutamapadawaktu
terjadinyaeksaserbasiakut)perludiberikanoksigen.Apabilapada
pasien telah terdapat komplikasi bronkitis kronik, pemberian
oksigen harus hatihati, harus dengan aliran rendah (cukup 1
liter/menit).
3)

Pengobatanhemoptisis
Apabila perdarahan cukup banyak (masif), mungkin
merupakanperdarahanarterialyangmemerlukantidakanoperatif

27

segerauntukmenghentikanperdarahannya,dansementaraharus
diberikantransfusidarahuntukmenggantikandarahyanghilang.(3)
Hemoptisis yang mengancam kehidupan (lebih dari 600 ml
darah per hari) dapat terjadi pada pasien dengan Bronkiektasis.
Setelahjalannapastelahdilindungidenganpasienberbaringdisisi
tempat perdarahan yang dicurigai atau dengan intubasi
endotrakeal, bronkoskopi atau CT dari thoraks diyakinkan
membantu menentukan lobus atau sisi yang mengalami
perdarahan. Jika intervensi radiologi tersedia, aortography dan
kanulasi dari arteri bronkial untuk memgambarkan lokasi
ekstravasasidarahatauneovaskularisasisehinggaembolisasiyang
dapatditunjukan.Pembedahanmungkinmasihdiperlukanuntuk
direseksidaerahyangdicurigaimengalamiperdarahan.
4) Pengobatandemam
Pada pasien dengan eksaserbasi akut sering terdapat
demam,terlebihjikaterjadiseptikemia.Padakeadaaniniselain
perlu diberikan antibiotik yang sesuai, dosis cukup, perlu
ditambahkanabatantipiretiklainnya.
5) Pembedahan
Peran pembedahan untuk Bronkiektasis telah menurun
tetapitidakmenghilang.Tujuandarioperasipengangkatantumor
28

termasukmenghilangkantumorobstruktifatauresidudaribenda
asing, pengangkatan segmen atau lobus yang paling rusak dan
didugaberkontribusiterhadapeksaserbasiakut,sekretyangsangat
kental, impaksi lendir. Pengambilan daerah yang memiliki
perdarahanabnormalyangtidakterkontrol,danpengambilandari
parurusakyangdicurigaimenyembunyikanorganismesepertiM.
MDRTB atau avium M. complex. Tiga pusat bedah telah
menggambarkan pengalaman mereka dengan operasi tersebut
selama dekade terakhir, dengan ratarata tindak lanjut empat
sampaienamtahun.Merekatelahmencatatperbaikandalamgejala
dilebihdari90%pasien,denganmortalitasperioperatifkurang
dari3%.(1)
Indikasi pembedahan berupa pasien Bronkiektasis yang
terbatas dan resektabel yang tidak berespon terhadap tindakan
konservatifyangadekuat,danpasienBronkiektasisyangterbatas
tetapi seringmengalamiinfeksi berulang atauhemoptisis masif.
Kontraindikasi pembedahan berupa pasien Bronkiektasis dengan
PPOK,pasienBronkiektasisberatdanpasiendengankomplikasi
korpulmonumkronikdekompensata.(3)
L. PROGNOSIS

29

Prognosis pasien Bronkiektasis tergantung pada beratringannya serta


luasnyapenyakitwaktupasienberobatpertamakali.Pemilihanpengobatan
secara tepat (konservatif atau pembedahan) dapat memperbaiki prognosis
penyakit. Pada kasus yang berat dan tidak diobati, prognosisnya buruk,
survivalnya tidak akan lebih dari 515 tahun. Kematian pasien tersebut
biasanyakarenapneumonia,empiema,payahjantungkanan,hemoptisisdan
lainlain.Padakasuskasustanpakomplikasibronkitiskronikberatdandifus
biasanyadisabilitasnyaringan.(1,14)
M. PENCEGAHAN
Timbulnya Bronkiektasis sebenarnya dapat dicegah kecuali pada bentuk
kongenital.BeberapausahauntukmencegahBronkiektasisantaralain:(1,14)
1. Pengobatan dengan antibiotika dan terapi suportif lainnya secara tepat
tehadapsemuabentukpneumonia
2. Tindakanvaksinasipertusis,influenzadanpneumoniapadaanak.

DAFTARPUSTAKA
1. RahmatullahP.2009.Bronkiektasis,BukuAjarIlmuPenyakitDalamJilidIII
EdisiKelima.EditorAruWSudoyo.BalaiPenerbitFKUI.Jakarta.
2. EmmonsEE.Bronkiektasiss.www.medscape.com.Lastupdate2015diakses
padatanggal15Juni2015
3. PriceS.A,WilsonL.M.Patofisiologi(KonsepKlinisProsesProsesPenyakit)
edisi6volume2.Penerbitbukukedokteran:EGC.Jakarta.2006.736792
30

4. Gleadle,J.AtaGlanceAnamnesisdanPemeriksaanFisik.Erlangga.Jakarta.
2005.
5. Sherwood,L.2012.FisiologimanusiadariselkesistemEdisi6.EitorNella
Yesdelita.Jakarta.EGC
6. Gazali,rusdy.radiologidiagnostic.2008.pustakacendikiapress;Jakarta
7. CantinJ,BankierAA,EisenbergRL.Bronkiektasis.AmericanJournalof
Roentgenelogy.2009.193w158w171
8. Howlett D, Ayers B to Hand on guide to imaging. 2004. Backwell
Publishing.Malde
9. Sutton,david.2003.Diseaseoftheairway,textbookofradiologyand
maging.volume 1.seven edition.London. British library and cataloging
data.
10. Planner, Andrew dkk.2007.Bronkiektasis, AZ chest radiologi. Newyork.
cambridgeuniversitypress.
11. OstensenH.2006.TheWHOManualofDiagnosticImaging.PublishedBy
theWHOinCollaborationwiththeInternationalsocietyofRadiology
12. Alfaraby,M.Artikelkedokteran.Bronkiektasis.www.artikelkedokteran.com
13. AdnanM,AsriyaniS.RadiologiSistemRespirasi.BagianradiologiFakultas
KedokteranUniversitasHasanuddin.Makassar.
14. Rasad,Sjahriar.2005.RadiologiDiagnostikEdisiII.Jakarta:FKUI
15. Brant,eWilliam.2007.Airwaydisease,fundamentalofdiagnosticradiology,
3rdEdition.lipincoWilliamsandwilkin.California
16. Lisle D.A, 2001. Imaging for Student, Arnold A member of the Hodder

HeadlineGroup.London

31