Anda di halaman 1dari 2

Gambar 1 Tampilan sumber informasi taksonomi virus MERS dari ebi.ac.

uk
Informasi yang diperoleh oleh ebi.ac.uk antara lain tentang taksonomi dan struktur
MERS-CoV fusion core. Berdasarkan data taksonomi, virus MERS memiliki nama ilmiah
Middle East respiratory syndrome coronavirus. Nama lain dari virus MERS adalah MERS
coronavirus, atau MERS-CoV. Urutan taksonomi virusnya adalah sebagai berikut:

Gambar 2 Struktur protein fusion core dari virus MERS

Sekuen protein:
>tr|A0A0C5D643|A0A0C5D643_9BETC Middle East respiratory syndrome coronavirus isolate UAE-62014 ORF4b protein (Fragment) OS=Middle East respiratory syndrome coronavirus PE=4 SV=1
MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRPEDLSVIVQPTHYVRVT
FSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNLTDEDLARDFSPIALFLRN
VRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAIPTIKDWLLVQGFSLYHSGLP
LHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLAVDVVSIRSSNQGNKQIVHSYPI

Selain diperoleh taksonomi dan struktur serta sekuens protein, diperoleh juga penelitian
tentang respon transkripsional dari virus MERS pada monyet. Tidak adanya model penyakit yang
kuat menghambat evaluasi penanggulangan untuk Middle East Respiratory Syndrome
Coronavirus (Mers-CoV). Model monyet yang diinfeksi oleh Mers-CoV menghasilkan penyakit
ringan sampai sedang dan telah digunakan untuk menggambarkan patogenesis virus ini. Selain
itu, model tersebut digunakan untuk untuk evaluasi terapi. Ketidakmampuan untuk menghasilkan
penyakit seragam dengan replikasi virus substansial mempersulit analisis dalam studi
penanggulangan. Dalam upaya untuk mengidentifikasi model penyakit yang lebih kuat, DPP4
urutan berbagai primata non-manusia sejenis. Pemodelan interaksi antara domain mengikat
reseptor dari Mers-COV dan DPP4 reseptor serumpun yang diprediksi "baik cocok" dengan
konservasi lengkap semua residu kritis. Untuk menentukan kelayakan marmoset sebagai model
penyakit Mers-CoV, marmoset umum diinokulasi dengan Mers-CoV melalui gabungan
intratrakeal, intranasal, lisan dan penglihatan. Marmoset menunjukkan tanda-tanda sedang sakit
parah dengan gejala serius untuk pneumonia berat. Ini adalah deskripsi pertama dari model
penyakit sedang sampai berat, dengan berpotensi mematikan dari Mers-COV dan dengan
demikian akan memiliki pemanfaatan untuk vaksin dan evaluasi efektivitas penanggulangan lain
selain studi patogenesis lanjut. Secara keseluruhan desain: sampel jaringan paru-paru yang
terisolasi dan sequencing pada 3, 4 dan 6 hari pasca inokulasi. Akhirnya, dua hewan di-eutanasia
selama studi karena keparahan penyakit.