Anda di halaman 1dari 10

MEKANISMEKERJAKORTIKOSTEROID

Kortikosteroidmemilikiefekspesifikdannonspesifikyangterkaitdenganmekanisme
yangberbedadariaksi,termasukantiinflamasi,imunosupresif,antiproliferatif,danefek
vasokonstriksi.Sebagianbesaraksidarikortikosteroidtersebutdimediasiollehreseptor
intraselulleryangdisebutreseptorglukokortikoid.Reseptordariglukokortikoidaisoform
terletakdisitosol,mengikatglukokortikoid,translokasikewilayahDNAnukliryang
dikenal sebagai elemen responsive kortikosteroid, dimana mampu merangsang dan
menghambattranskripsiyangberdekatan,sehinggamengaturprosesinflamasi.Reseptor
glukokortikoif Pisoform tidak mengikat glukokortikoid ,tetapi mampu mengikat
antiglucocrtikoid/senyawaantiprogestinRU486untukmengaturkerjagen2glukortikoid
reseptorBdapatmenipiskanaktifasiperpindahanmediasiligangenhormonsensitifoleh
isoformdamengkinmenjadipenandapentingdariketidakpekaansteroid
Efekantiinflamasi
Kortikosteroiddidugamemberikanefekantiinflamasikuatdengancaramenghambat
pelepasan fosfolipase A2, enzim yang bertanggung jawab untuk pembentukan
prostaglandins, leukotriene, dan turunan lainnya dari jalur asam arakidonat.
Kortikosteroidjugamenghambatfaktortranskripsi,sepertiaktifatorproteinIdanfaktor
nuklirk,yangterlibatdalamaktifasigenproinflamasi.Genyangdiketahuidiregulasi
olehkortikosteroiddanmembawaperandalamresolusiinflamasitermasuklipocortindan
protein p11/mengikat calpactin ,baik yang terlibat dalam pelepasan asam arakidonat.
Lipocortin I menghambat fosfolipase A2, mengurangi pelepasan asam dari asam
arakidonat, kortikosteroid juga mengurangi dari pelepasan interleuikin1 (IL1 )
pentingnyasitokinproinflamasi, darikeratinosit. Mekanismelainnya untukefekanti
inflamasi kortikosteroid meliputi penghambatan fagositosis dan stabilisasi membran
lisosomselfagosit.
Efekimunosupresif
Efektivitaskortikosteroid,sebagian,jugakarenasifatimunosupresifnya.Kortikosteroid

menekanproduksidanefekdarifaktorhumoralyangterlibatdalamresponinflamasi,
menghambatmigrasileukositkesitusperadangan,danmengganggufungsiselendotel,
granulosit,selmast,danfibroblas.1012Beberapapenelitiantelahmenunjukkanbahwa
kortikosteroid dapat menyebabkan penipisan sel mast pada kulit. Percobaan juga
menunjukkan bahwa topical kortikosteroid menyebabkan penghambatan lokal
kemotaksis neutrofil in vitro, dan menurunkan jumlah sel Langerhans Ia + in vivo.
Kortikosteroid mengurangi eosinofilia pada pasien dengan asma. Mereka juga
mengurangi proliferasi selT dan menginduksi apoptosis selT, sebagian dari
penghambatanselTyangmerupakanfaktorpertumbuhanselIL2.Selainitu,beberapa
sitokinsecaralangsungdipengaruhiolehkortikosteroid,termasukIL1,tumornecrosis
factor,granulositmakrofagcolonystimulatingfactor,danIL8.Efekinijugamungkin
akibatdariaksisteroidpadaselselantigen.
EFEKantiproliferatif
EfekantiproliferatifkortikosteroidtopikaldiperentaraiolehpenghambatansintesisDNA
dan mitosis, sebagian menjelaskan tindakan terapi obat ini dalam skala dermatosis.
Merekadikenaluntukmengurangiukurankeratinositdanproliferasi.Aktivitasfibroblast
danpembentukankolagenjugadihambatolehkortikosteroidtopikal.
Vasokonstriksi
Mekanismekortikosteroidmenginduksivasokonstriksibelumsepenuhnyajelas.Halini
didugaterkaitdenganpenghambatanvasodilatoralamisepertihistamin,bradikinin,dan
prostaglandin.Steroidtopikalmenyebabkankapilerdalamdermissuperfisialmengerut,
sehingga mengurangi eritema. Kemampuan agen kortikosteroid diberikan untuk
menyebabkan vasokonstriksi biasanya berkorelasi dengan potensi antiinflamasi, dan
dengandemikian,tesvasokonstriksiseringdigunakanuntukmemprediksiaktivitasklinis
agen.Tesini,dalamkombinasidenganujiklinisdoubleblind,telahdigunakanuntuk
memisahkan kortikosteroid topikal menjadi tujuh kelas berdasarkan potensi. Kelas 1
meliputipalingkuat,sementarakelas7berisipalinglemah.diedisionlinebanyakdari
kortikosteroidtopikalyangtersediasesuaidenganklasifikasiini.Perhatikanbahwaobat

yangsamadapatditemukandalamklasifikasipotensiyangberbedatergantungpadaapa
yangdigunakan.
FARMAKOKINETIKA
Kortikosteroidmemilikistrukturrangkadasaryangterdiridari17atomkarbondisusun
dalamtigacincinberanggotaenamdansatucincinberanggotalima.Modifikasikortisol
(Gambar1),denganpenambahanatauperubahangugusfungsipadaposisitertentu,telah
menyebabkan senyawa dengan potensi variabel anti inflamasi, glucocorticosteroid
dibandingkanaktivitasmineralokortikoid,danefeksamping.

gambar1basicmolekulsteroid

Penelitiankortikosteroidtopikaltelahdifokuskanpadastrategiuntukmengoptimalkan
potensi dan meminimalkan efek samping. Salah satu strategi adalah untuk
mengembangkansenyawadenganmeningkatkanefekantiinflamasidanefekyangtidak
diinginkanminimalpenekananatrophogenicdanadrenal.Dalamhalini,kemajuantelah
dibuat dengan perkembangan molekul glukokortikoid itu, sementara tetap
mempertahankanaktivitastinggidikulitberikutaplikasitopikal,dengancepatdipecah
menjadimetabolittidakaktif,sehinggamengurangisistemikdanmungkinbeberapaefek
toksik lokal ("soft" glukokortikoid) . Beberapa senyawa ini meliputi diesters 17,21
aseponase hidrokortison dan hidrokortison 17butirat21propionat, prednikarbat,
mometason furoat, methylprednisolone aceponate, alclometasone dipropionat, dan
carbothioate seperti fluticasone propionate.agen terakhir ini diklasifikasikan sebagai
kortikosteroid kuat dengan potensi yang lebih rendah menyebabkan atrofi kulit dan
supresiadrenalkarenatinggilipofilisitas,reseptorglukokortikoidtinggimengikatdan
aktivasi dan metabolisme yang cepat pada kulit. yang menawarkan keuntungan dari
aplikasi sehari sekali dan reaksi alergi lokal jarang terjadi. Mometason furoat juga

memilikiefekyangsangatantiinflamasidenganinsidenrendahadrenalsuppression.
Hidrokortison aceponate, prednicarbate, dan methylprednisolone aceponate memiliki
efekantiinflamasiyangsignifikan,namunkapasitassetidaknyauntukmenginduksiatrofi
kulitOlehkarenaitu,merekadapatdigunakanuntukmengobatidaerahsepertiwajah,
skrotum,danareapermukaantubuhyangbesarpadaanakanak,denganminimalefek
merugikan. Sebelum memilih persiapan glukokortikoid topikal, kita harus
mempertimbangkanpasienterkaitdanfaktoryangberhubungandenganobatyangdapat
mempengaruhi penyerapan sistemik nya. Usia pasien, tingkat dan lokasi dari luas
permukaantubuhharusdiperhatikandanadaatautidakadanyaperadangankulit,sangat
mempengaruhiaktivitasagentopikal.Penetrasiglukokortikoidbervariasimenurutsitus
kulit,berhubungandenganketebalanstratumkorneumdanpasokanvascularkedaerah.
Sebagaicontoh,penetrasisteroidtopikalmelaluikelopakmatadanskrotumadalahempat
kalilebihbesardaripadadahidan36kalilebihbesardaripadatelapaktangandantelapak
kaki.Meradang,lembab,dankulitgunduljugamenunjukkanpeningkatanpenetrasi.Area
tubuhdimanakulitsecarainherentipistidakhanyamemungkinkanuntukmeningkatkan
penetrasi obat, tetapi juga lebih rentan untuk mengembangkan efek samping
dibandingkandaerahlaindimanakulittebal.Steroidtopikalpoten(kelas1dan2)harus
berhatihati dalam penggunaanya, jika pernah, digunakan di daerahdaerah dengan
tingkattertinggipenetrasi,sepertikelopakmata.Konsentrasizatterapiyangdigunakan,
durasiaplikasi,penggunaandressingoklusif,perantaraterpilih,dankarakteristikintrinsik
dari molekul yang dipilih, juga dapat mempengaruhi penyerapan dan tingkat efek.
merugikan target tempat kortikosteroid topikal adalah epidermis atau dermis, dan
respons klinis terhadap formulasi berbanding lurus dengan konsentrasi kortikosteroid
dicapai pada situs tempat target. Sebuah studi perbandingan konsentrasi kulit setelah
topikal dibandingkan pengobatan kortikosteroid oral menemukan bahwa kebanyakan
kortikosteroidtopikalmemilikipotensiuntukmencapaitingkatobatyangefektifyang
lebih besar di lapisan superfisial kulit daripada yang dicapai dengan dosis standar
prednisonoral.Olehkarenaitu,khasiatternyatalebihbesardariterapioralkortikosteroid
mungkin disebabkan sebagian kepatuhan pasien social ekonomi yang rendah dengan
terapi. topikal kortikosteroid diperparah di beberapa formulasi dan dengan berbagai
kekuatan. Penelitian terbaru telah menekankan pentingnya kepatuhan terhadap
pengobatandalampengelolaankondisikulit.Dengandemikian,formulasibarutermasuk
spray, foam, lotion, hidrogel, dan formulasi sampo telah dikembangkan untuk
meningkatkan kenyamanan pasien dan penerimaan, tanpa mengorbankan efektivitas,
keamanan dan tolerabilitas salep dan krim formulasi tradisional. Sebuah tinjauan
sistematis terbaru dari literatur menemukan bahwa sementara ada beberapa studi
perbandinganlangsungantaraclobetasolpropionat,kelas1steroid,dalamperantarayang
berbeda,tingkatkeberhasilanuntukformulasiyanglebihbarukirakirasebandingdengan
clobetasolsalepdalampengobatanpsoriasis.Efeksampingyangpalingumumadalah
menyengat ringan dan sementara / pembakaran di lokasi lesi, yang mungkin karena
kandunganalkoholyangditemukandidalamformulasiini.Taksatupundariujiklinis
langsung dibandingkan formulasi ini dengan satu dan lainnya. Meningkatkan hidrasi
stratumkorneumdapatmeningkatkanpenyerapankortikosteroidtopikalempatsampai
lima kali. Sebuah studi retrospektif dressing basah digunakan dengan kortikosteroid

topikal(hidrokortison1%krimuntukwajahdanlipatandantriamcinolone0,1%krim
dari leher ke bawah) untuk orang dewasa dengan penyakit kulit gatal etiologi yang
berbeda,mengurangipruritusdalam98%padapasienyangdisingkirkan.peningkatan
penetrasikortikosteroidhanyasalahsatudaribanyakmanfaatdaridressingbasah.

INDIKASI
Kortikosteroid topikal direkomendasikan untuk aktivitas antiinflamasi pada penyakit
kulit inflamasi, tetapi mereka juga dapat digunakan untuk efek antimitosis dan
kapasitasnyauntukmengurangisintesismolecules.jaringanikatvariabeltertentuharus
dipertimbangkan ketika mengobati gangguan kulit dengan glukokortikoid topikal.
Sebagai contoh, respon dari penyakit untuk glukokortikoid topikal bervariasi. Dalam
pengaturanini,penyakitdapatdibagimenjaditigakategoriditunjukkanpada(Tabel2)
(1)sangatresponsif,(2)cukupresponsif,dan(3)setidaknyaresponsif.
Tabel2

PRINSIPsaatmemulaitopikal
Memulaipotensiterendahuntukmengontrolpenyakit.
MenghindariPenggunaanjangkapanjangdariagenpotensisedang.
Ketika area permukaan besar yang terlibat, dianjurkan persiapan pengobatan dengan
potensirendahsedang
Sangatresponsifpenyakitbiasanyaakanmenanggapipersiapansteroidlemah,sedangkan
penyakitkurangresponsifmembutuhkanmediaataupotensitinggisteroidtopikal.
Potensirendah,Nonhalogenatedharusdigunakanpadawajahdandaerahintertriginosa.

Kortikosteroid yang sangat kuat, sering di bawah oklusi, biasanya diperlukan untuk
penyakitkulithiperkeratosisataulichenifieddanuntukketerlibatantelapaktangandan
telapak.
Karena peningkatan luas permukaan tubuh untuk rasio indeks massa tubuh dan
meningkatkanrisikopenyerapansistemik,persiapanpotensitinggidanpersiapanpotensi
terhalogenasimenengah,harusdihindaripadabayidananakanak,selainuntukaplikasi
jangkapendek.
MELANJUTKAN PENGGUNAAN steroid topikal
Formulasi potensi kuat harus digunakan untuk jangka pendek (2-3
minggu) atau intermitten.
Setelah pengendalian penyakit sebagian dicapai, penggunaan senyawa
kurang kuat harus dimulai.
Mengurangi frekuensi aplikasi (misalnya, aplikasi hanya di pagi hari,
terapi alternative/hari, penggunaan akhir pekan) setelah pengendalian
penyakit sebagian dicapai.
Kortikosteroid topikal harus dihindari pada kulit ulserasi atau atrofi, dan
pada kulit dengan penyakit kulit menular hidup berdampingan.
Penghentian mendadak harus dihindari setelah penggunaan jangka
panjang untuk mencegah fenomena rebound.
Pedoman khusus harus diikuti ketika merawat daerah tertentu tubuh
(misalnya, daerah intertriginosa) atau populasi tertentu (misalnya,
anak-anak atau orang tua) untuk mencegah terjadinya efek samping
lokal atau sistemik.
Tes laboratorium harus dipertimbangkan jika penyerapan sistemik
kortikosteroid diduga.
Gunakan terapi kombinasi ketika ada indikasi klinis (misalnya,
penambahan inhibitor kalsineurin topikal, tretinoin atau kalsipotriena).
KOMPLIKASI
Efek samping lokal penggunaan kortikosteroid topikal yang lebih umum
daripada reaksi sistemik. Mereka sebagian besar karena efek
antiproliferatif dari agents.49 ini atrofi
PERUBAHAN Atrofi
KOMPLIKASI
Efek samping lokal penggunaan kortikosteroid topikal yang lebih umum
daripada reaksi sistemik. Mereka
sebagian besar karena efek antiproliferatif dari agents.49 ini atrofi
PERUBAHAN
Atrofi kulit adalah efek samping yang paling menonjol kulit, dan
melibatkan kedua epidermis dan dermis. Atrofi kulit berkembang dari

efek antiproliferatif langsung kortikosteroid topikal pada fibroblast,


dengan penghambatan kolagen dan sintesis mukopolisakarida, yang
mengakibatkan hilangnya kontitunitas dermal. Penurunan sintesis jenis
I dan kolagen III setelah digunakan glukokortikoid topikal telah terbukti
dalam berbagai penelitian. Pengurangan produksi glikosaminoglikan
juga telah dijelaskan .Levels dari Hyaluronan, yang glikosaminoglikan
utama dalam kulit, juga cepat menurun setelah pengobatan
glukokortikoid jangka pendek, karena penurunan sintesis Hyaluronan.
Fragmentasi dan penipisan serat elastis berkembang di lapisan atas,
sedangkan serat lebih dalam membentuk jaringan kompak dan padat.
Sebagai hasil dari perubahan atrofi, ada dilatasi pembuluh darah,
telangiectasias, purpura, mudah memar, pseudoscars stellata
(purpura, berbentuk tidak teratur, dan bekas luka atrofi
hipopigmentasi), dan ulserasi. Meskipun atrofi adalah, sampai batas
tertentu, reversibel, pembentukan striae, bekas luka linear terlihat
yang membentuk di daerah kerusakan kulit mungkin selama stres
mekanik, adalah permanen
REAKSI acneiform
Pengembangan atau eksaserbasi penyakit kulit wajah, termasuk
rosacea steroid, jerawat, dan dermatitis perioral, adalah efek samping
terkenal dari kortikosteroid topikal. Meskipun steroid awalnya
mengarah pada penekanan papula inflamasi dan pustula, pasien
menjadi kecanduan karena mereka melihat bahwa lesi suar ketika
pengobatan diberhentikan. Ini sering mengarah pada penggunaan
terus potensi kuat kortikosteroid topikal. Untuk alasan ini, penggunaan
steroid harus dikurangi dalam pengobatan rosacea dan perioral
dermatitis dan periokular. Pengobatan kortikosteroid jangka panjang
juga dapat mengakibatkan "steroid acne" yang ditandai dengan
tanaman padat, pustula meradang dalam tahap perkembangan yang
sama. Lesi ini terjadi pada wajah, dada, dan punggung (gambar ?).
Pasien dengan psoriasis juga rentan terhadap suar papulopustular
setelah pemberhentian potensi tinggi, terapi kortikosteroid topikal ke
area permukaan yang luas untuk jangka waktu lama.
Hipertrikosis
Hipertrikosis jarang terjadi pada wanita dan anak-anak yang berlaku
kortikosteroid ampuh untuk wajah. Mekanismenya masih belum
diketahui.
Perubahan pigmen
Penurunan pigmentasi adalah efek samping yang umum dari
penggunaan steroid topikal. Pigmen umumnya kembali setelah
penghentian terapi.
PENGEMBANGAN INFEKSI

Kortikosteroid topikal bertanggung jawab untuk memperburuk dan /


atau menutupi penyakit menular kulit. Kejadian infeksi kulit selama
terapi kortikosteroid bervariasi tetapi mungkin antara 16% dan 43%.
Panu, infeksi Alternaria disebarluaskan, dan dermatofitosis, termasuk
tinea incognito (infeksi dermatofit masked) , dapat berkembang.
Granuloma gluteale infantum, ditandai dengan lesi granulomatosa
kemerahan keunguan pada daerah popok, adalah yang terkenal
komplikasi
dermatitis
popok
yang
sedang
diobati
dengan
kortikosteroid. Candida albicans umumnya pulih pada pasien ini.
Kortikosteroid topikal juga telah berpengaruh pada perpanjangan atau
memburuknya herpes simpleks, moluskum kontagiosum, dan infeksi
skabies.
REAKSI ALERGI
Dermatitis kontak alergi dari steroid harus dicurigai jika
penggunaannya
memperburuk
dermatitis
tersebut,
tidak
menyebabkan peningkatan atau perubahan pola klinis penyakit. Hal ini
terjadi lebih sering pada pasien dengan fungsi terganggu, seperti
pasien dengan dermatitis stasis, ulkus kaki dan atopik dermatitis
.suatu prevalensi topikal kortikosteroid berkisar sensitisasi antara 0,2%
dan 6,0%, dan meningkat dengan kontak yang terlalu lama dan seleksi
pengobatan tertentu Dalam sebuah penelitian retrospektif 6 tahun,
127 dari 1.188 pasien (10,7%) Patch diuji dengan kortikosteroid topikal
menunjukkan reaksi positif untuk setidaknya satu agen, pada 56
pasien
bereaksi
terhadap
beberapa
kortikosteroid
topikal.
Kortikosteroid topikal diakui Amerika Dermatitis Kontak Society tahun
2005 sebagai alergen berdasarkan prevalensi . klasifikasi A telah
dibuat untuk menentukan reaktivitas silang antara berbagai persiapan
yang tersedia. Klasifikasi ini memiliki empat kelompok atas dasar
struktur dan pola reaktivitas silang (Tabel 3). Setiap kelas diwakili oleh
agen. Kelas A diwakili oleh jenis hidrokortison, kelas B dengan steroid
asetonid, kelas C oleh jenis betametason dan kelas D, dibagi menjadi
dua kelompok, D1 diwakili oleh betametason dipropionat dan D2 oleh
methylprednisolone aceponate. Reaksi patch-test untuk steroid kelas A
yang paling umum, sedangkan reaksi Patch-test untuk kelas C steroid
sangat langka. Ketika alergi terhadap kortikosteroid topikal sangat
dicurigai dan pengujian patch tidak tersedia, dokter harus meresepkan
steroid kelas C dengan perantara yang tidak mengandung alergen.
Desoximethasone 0,25% salep dan 0,05% gel adalah dua produk yang
memenuhi kriteria tersebut. perantara atau pengawet juga bisa
bertanggung jawab untuk alergi dengan persiapan kortikosteroid.
Sebuah tinjauan sistematis bahan dalam kendaraan kortikosteroid
baru-baru ini diterbitkan. Para penulis menemukan tujuh bahan
kendaraan yang biasa digunakan dalam persiapan kortikosteroid
topikal dan yang terkenal alergen: (1) propilen glikol, (2) sesquioleate
sorbitan, (3) formaldehida-releasing pengawet (imidazolidinylurea dan

diazolidinylurea), (4) paraben , (5) methylchloroisothiazolinone /


methylisothiazolinone, (6) lanolin, dan (7) wangi (lihat Kotak 216-3).
Dari 166 kortikosteroid topikal, 128 (termasuk semua krim) memiliki
setidaknya satu dari komponen kendaraan tersebut. Lebih banyak
produk generik bebas dari alergen dari yang produk bermerek. Solusi
dan salep adalah kendaraan alergi setidaknya. Yang paling umum hadir
alergen potensial yang propilen glikol dan sesquioleate sorbitan

EFEK SAMPING SISTEMIK


EFEK OCULAR.
Perkembangan glaukoma dari penggunaan kortikosteroid topikal
sekitar
mata
telah
dijelaskan.
Penggunaan
kortikosteroid
berkepanjangan juga menyebabkan kehilangan penglihatan.
PEMBERANTASAN DARI hipotalamus-hipofisis-adrenal AXIS.
Penindasan sumbu HPA telah dijelaskan dengan penggunaan
kortikosteroid topikal poten. Sindrom Cushing iatrogenik dankortikosteroid terkait Addison krisis telah dijelaskan setelah
penggunaan jangka panjang dari ampuh persiapan kortikosteroid
topikal. Sebuah dosis 14 g / minggu clobetasol propionat atau 49 g /
minggu betametason dipropionat cukup untuk menekan kortisol
plasma
tingkat Secara umum diasumsikan bahwa efek sistemik yang lebih
umum dengan potensi tinggi kortikosteroid topikal; Namun, laporan
kasus baru-baru dijelaskan pasien anak dengan sindrom Netherton
yang dikembangkan sindrom Cushing dari penyerapan perkutan dari
hidrokortison 1%, sebuah rendah
Potensi kortikosteroid agent.69 Sastra meninjau efek potensi
kortikosteroid topikal dan pertumbuhan vertikal di dermatitis atopik
adalah keseluruhan meyakinkan tapi telah dicampur hasil. Penampang
penelitian telah menunjukkan bahwa anak-anak dengan dermatitis
atopik telah berkurang pertumbuhan, sementara yang lain telah

menemukan bahwa perubahan sementara dalam kadar kortisol tidak


mempengaruhi tinggi dewasa akhirnya. Sebuah studi kuesioner
terkontrol terbaru menemukan bahwa tinggi keseluruhan anak-anak
dengan dermatitis atopik
diobati dengan kortikosteroid topikal tidak terpengaruh.
EFEK SAMPING METABOLIK.
Peningkatan produksi glukosa dan penurunan penggunaan glukosa
menginduksi hiperglikemia dan dapat menyebabkan diabetes mellitus.
Femoral nekrosis avascular jarang telah dikaitkan dengan penggunaan
topikal
kortikosteroid