Anda di halaman 1dari 19

SATUAN ACARA PENYULUHAN (SAP)

IBU HAMIL TENTANG KEHAMILAN RISIKO TINGGI


DI DESA KALIBEJI RT 02 RW 06 KECAMATAN SEMPOR
KABUPATEN KEBUMEN

Disusun oleh :
NAMA

: ETY PURNANINGSIH

NIM

: B1301052

PROGRAM STUDI DIII KEBIDANAN


SEKOLAH TINGGI ILMU KESEHATAN MUHAMMADIYAH
GOMBONG
2015

SATUAN ACARA PENYULUHAN (SAP)


RISIKO TINGGI KEHAMILAN
Hari / Tanggal

Rabu, 21 Oktober 2015

Waktu

Pukul 14.00 WIB

Pokok Bahasan

Kehamilan risiko tinggi

Sub Pokok Bahasan

Menjelaskan mengenai risiko tinggi kehamilan

Sasaran

Ny. T

Penyuluh

: Ety Purnaningsih

Tempat

Rumah Pasien, Desa Kalibeji RT 02 RW 06

A. TUJUAN
1. Tujuan Instruksional Umum (TIU)
Setelah dilakukan penyuluhan pendidikan kesehatan 1 x 60 menit, diharapkan ibu
hamil Ny. T dapat mengerti mengenai risiko tinggi dalam kehamilan.
2. Tujuan Instruksional Khusus (TIK)
Setelah dilakukan penyuluhan tentang risiko tinggi kehamilan ibu mengetahui :
1.

Menyebutkan kembali pengertian kehamilan resiko tinggi

2.

Menyebutkan kembali 3 dari 5 kriteria ibu hamil dengan faktor


resiko

3.

Menyebutkan kembali 3 dari 5 ibu hamil yang tergolong resiko


tinggi

4.

Menyebutkan kembali 4 dari 7 tanda bahaya dalam kehamilan

B. GARIS BESAR
1. Apa pengertian kehamilan resiko tinggi
2. Apa saja 3 dari 5 kriteria ibu hamil dengan faktor resiko
3. Apa saja 3 dari 5 ibu hamil yang tergolong resiko tinggi
4. Apa saja 4 dari 7 tanda bahaya dalam kehamilan
C. METODE
1. Ceramah

2. Diskusi
3. Tanya Jawab/ Demonstrasi
4. Tindakan
D. MEDIA
Leaflet
E. PROSES KEGIATAN
No KEGIATAN
1. Pendahuluan :

Respon Ibu Hamil

a. Memberi

salam

pembuka

dan

perkenalan diri
b. Menjelaskan

Waktu

a. Membalas salam
b. Mendengarkan

maksud

5 Menit

c. Memberi respon

dan tujuan
c. Kontrak waktu
2. Penjelasan materi :
a. Apa pengertian
kehamilan resiko
tinggi
b. Apa saja 3 dari 5
kriteria ibu hamil
dengan faktor resiko
c. Apa saja 3 dari 5 ibu hamil

Mendengarkan

dengan

penuh perhatian

20 Menit

yang tergolong resiko


tinggi
d. Apa saja 4 dari 7 tanda
bahaya

dalam

kehamilan
3. Penutup :
a. Tanya jawab
b. Menyimpulkan
penyuluhan
c. Memberikan

a. Menanyakan

hal

yang belum jelas


hasil
salam

b. Aktif

bersama

menyimpulkan

15Menit

penutup
F.
1.
a.
b.
c.
d.

c. Membalas salam

EVALUASI
Mengajukan pertanyaan lisan.
Apa pengertian kehamilan resiko tinggi
Apa saja 3 dari 5 kriteria ibu hamil dengan faktor resiko
Apa saja 3 dari 5 ibu hamil yang tergolong resiko tinggi
Apa saja 4 dari 7 tanda bahaya dalam kehamilanApa yang dimaksud

dengan kehamilan trimester 3


2. Observasi.
a. Respon/tingkah laku ibu saat diberi pertanyaan: apakah diam atau
menjawab (benar atau kurang tepat).
b. Ibu antusias atau tidak.
c. Ibu mengajukan pertanyaan atau tidak.
G. KRITERIA EVALUASI
1. Peserta dapat menjawab pertanyaan tentang pengertian kehamilan resiko
tinggi
2. Peserta dapat menjawab pertanyaan tentang3 dari 5 kriteria ibu hamil
dengan faktor resiko
3. Peserta dapat menjawab pertanyaan tentang 3 dari 5 ibu hamil yang
tergolong resiko tinggi
4. Peserta dapat menjawab pertanyaan tentang 4 dari 7 tanda bahaya dalam
kehamilan
H. REFERENSI
Anonim. 2009/2010. Kehamilan Risiko Tinggi.http://medicastore.com/.0409-2012.
Imam
Musbikin.2005.Panduan

Bagi

Ibu

Hamil

dan

Melahirkan.Yogyakarta.Mitra Pustaka
Curtis,Glade B.1999.Kehamilan di atas usia 30.Jakarta.Arcan
Manuaba. IBG. 1998. Ilmu Kebidanan, Penyakit Kandungan dan Keluarga
Berencana untuk Bidan. Jakarta. EGC
_____,
2007.Konsep
Obsteteri

dan

Ginekologi

Sosial

Indonesia.Jakarta.EGC
Anonim. 1999/2000. Pengenalan Tanda Bahaya pada Kehamilan,
Persalinan dan Nifas. Jakarta. Departemen Kesehatan RI.

I. LAMPIRAN
Materi Lengkap

Lampiran
MATERI
KEHAMILAN RISIKO TINGGI

A. PENGERTIAN :
Kehamilanrisikotinggiadalahibuhamildenganberbagaifaktorrisiko
yangdapatmenggangguproseskehamilansampaibersalinataumengancamjiwa
ibudanjanin.
Kehamilan risiko tinggi adalah kehamilan yang akan menyebabkan
terjadinya bahaya dan komplikasi yang lebih besar, baik terhadap ibu
maupunterhadapjaninyangdikandungnyaselamamasakehamilan,melahirkan
ataupunnifasbiladibandingkandengankehamilanpersalinandannifasnormal.
Kehamilan usia dini memuat risiko yang tidak kalah berat. Pasalnya,
emosionalibubelumstabildanibumudahtegang.Sementarakecacatankelahiran

bisa muncul akibat ketegangan saat dalam kandungan, adanya rasa penolakan
secaraemosionalketikasiibumengandungbayinya.(Ubaydillah,2000).
B. Kriteria Ibu Hamil dengan Factor Resiko :
1. Usia => kurang dari 20 tahun atau lebih dari 35 tahun
2. Paritas => primipara (kehamilan pertama) atau kehamilan telah lebih dari
empat
3. Jarak persalinan terakhir kurang dari 2 tahun
4. Tinggi badan kurang dari 142 cm
5. Lingkar lengan atas kurang dari 23,5 cm pada trimester III
C. Ibu Hamil yang Tergolong Resiko Tinggi :
1.

Ibu hamil yang sering pusing berat, penglihatan kabur, kaki bengkak dan
kenaikan tekanan darah

2.

Ibu hamil dengan kelainan letak (sungsang atau lintang)

3.

Ibu hamil yang diperkirakan bayinya kembar

4.

Riwayat kehamilan jelek

5.

Ibu dengan riwayat penyakit jantung, ginjal, TBC, liver, hipertensi dan
penyakit berat lainnya

6.

Untuk menentukan suatu kehamilan risiko tinggi, dilakukan penilaian


terhadapwanitahamiluntukmenentukanapakahdiamemilikikeadaanatau
ciriciri yang menyebabkan dia ataupun janinnya lebih rentan terhadap
penyakit atau kematian (keadaan atau ciri tersebut disebut faktor risiko).
Faktor risiko bisa memberikan suatu angka yang sesuai dengan beratnya
risiko.

Secaraumum,kelompokibuhamilyangtergolongresikotinggiantaralain:
1.Umurdibawah20tahun,karenarahimdanpanggulibubelum
berkembang
2.Umurdiatas35tahun,karenakesehatandankeadaanrahimsudahtidak
sebaikumursebelumnya

3.Pernahmengalamikesulitandankehamilandalampersalinan
sebelumnya
4.Jumlahanaklebihdari4orang,karenamakinbanyakanak,rahimibu
makinlemah
5.Jarakpersalinanterakhirdenganawalkehamilansekarangkurangdari2
tahun,karenapadakeadaantersebutrahimdankesehatanibubelumpulih
kembalidenganbaik
6.Jarakpersalinanterakhirdenganawalkehamilansekaranglebihdari10
tahun(terlalulama)
7.Tinggibadankurangdari145cm,karenaibumungkinmempunyai
panggulsempit,sehinggasulitmelahirkan
8.Kebiasaanibu(merokok,alkohol,danobatobatan)
2.1.FAKTORRISIKOSEBELUMKEHAMILAN
Sebelum hamil, seorang wanita bisa memiliki suatu keadaan yang
menyebabkan meningkatnya resiko selama kehamilan. Selain itu, jika seorang
wanita mengalami masalah pada kehamilan yang lalu, maka resikonya untuk
mengalamihalyangsamapadakehamilanyangakandatangadalahlebihbesar.
2.1.1.Karakteristikibu
Usiawanitamempengaruhiresikokehamilan.Anakperempuanberusia15
tahunataukuranglebihrentanterhadapterjadinya preeklamsi (suatukeadaan
yang ditandai dengan tekanan darah tinggi, protein dalam air kemih dan
penimbunancairanselamakehamilan)dan eklamsi (kejangakibatpreeklamsi).
Merekajugalebihmungkinmelahirkanbayidenganberatbadanrendahataubayi
kuranggizi.
Risikokehamilanpadaibuyangterlalumudabiasanyatimbulkarenamereka
belumsiapsecarapsikismaupunfisik.Secarapsikis,umumnyaremajabelumsiap
menjadiibu.Bisasajakehamilanterjadikarena"kecelakaan".Akibatnya,selain
tidak ada persiapan, kehamilannya pun tidak dipelihara dengan baik. Kondisi
psikis yang tidak sehat ini dapat membuat kontraksi selama proses persalinan
tidakberjalanlancarsehinggakemungkinanoperasisesarjadilebihbesar.

Risikofisiknyapuntakkalahbesarkarenabeberapaorganreproduksiremaja
putrisepertirahimbelumcukupmatanguntukmenanggungbebankehamilan.
Bagianpangguljugabelumcukupberkembangsehinggabisamengakibatkan
kelainanletakjanin.
Kurangnya persiapan untuk hamil juga dikaitkan dengan defisiensi asam
folat dalam tubuh. Akibat kurangnya asam folat, janin dapat menderita spina
bifida(kelainantulangbelakang)ataujanintidakmemilikibatokkepala.Risiko
akanberkurangpadaibuyanghamildiusiatuakarenabiasanyamerekasudah
mempersiapkankehamilandenganbaik.
Risikokehamilanyangakandihadapipadaprimigravidatuahampirmirip
padaprimigravidamuda.Hanyasaja,karenafaktorkematanganfisikyang
dimilikimakaadabeberaparisikoyangakanberkurangpadaprimigravidatua.
Misalnyamenurunnyarisikocacatjaninyangdisebabkankekuranganasamfolat.
Risikokelainanletakjaninjugaberkurangkarenarahimibudiusiainisudah
matang.Panggulnyajugasudahberkembangbaik.Bahayayangmengancam
primigravidatuajustruberkaitandenganfungsiorganreproduksidiatasusia35
tahunyangsudahmenurunsehinggabisamengakibatkanperdarahanpadaproses
persalinandanpreeklamsia.
Hal yang patut dipertimbangkan adalah meningkatnya risiko kelainan
sindromdownpadajanin,yaitusebuahkelainankombinasidariretardasimental
dan abnormalitas bentuk fisik yang disebabkan kelainan kromosom. "Pada
kehamilandibawah usia 30tahunkemungkinan adanyasindrom downhanya
1:1600,tapidiatas35tahunmenjadi1:600,dandiusia40tahunmenjadi1:160.
Peningkatanbeberapakalilipatinidikarenakanperubahankromosomakibatusia
ibu yang semakin tua. Pada wanita hamil yang berusia diatas 35 tahun bisa
dilakukanpemeriksaancairanketuban(amniosentesis)untukmenilaikromosom
janin.
Wanitayangberusia35tahunataulebih,lebihrentanterhadaptekanandarah
tinggi,diabetesatauobesitasdanterhadapkeadaanmedislainnya
Seorangwanitayangpadasaattidakhamilmemilikiberatbadankurangdari
50kg,lebihmungkinmelahirkanbayiyanglebihkecildariusiakehamilan(KMK,
keciluntukmasakehamilan).Jikakenaikanberatbadanselamakehamilankurang
dari7,5kg,makaresikonyameningkatsampai30%.Sebaliknya,seorangwanita
gemuk lebih mungkin melahirkan bayi besar. Obesitas juga menyebabkan

meningkatnya resiko terjadinya diabetes dan tekanan darah tinggi selama


kehamilan.Seorangwanitayangmemilikitinggibadankurangdari1,4meter,
lebihmungkinmemilikipanggulyangsempit.Selainitu,wanitatersebutjuga
memiliki resiko yang lebih tinggi untuk mengalami persalinan prematur dan
melahirkanbayiyangsangatkecil.
2.1.2.RiwayatKehamilanSebelumnya
Seorang wanita yang 3 kali berturutturut mengalami keguguran pada
trimesterpertama,memilikiresikosebesar35%unukmengalamikeguguranlagi.
Keguguranjugalebihmungkinterjadipadawanitayangpernahmelahirkan
bayi yang sudah meninggal pada usia kehamilan 48 minggu atau pernah
melahirkanbayiprematur.
Sebelum mencoba hamil lagi, sebaiknya seorang wanita yang pernah
mengalamikeguguranmenjalanipemeriksaanuntuk:
kelainankromosomatauhormon
kelainanstrukturrahimatauleherrahim
penyakitjaringanikat(misalnyalupus)
reaksikekebalanpadajanin(biasanyaketidaksesuaianRh).
Jika penyebab terjadinya keguguran diketahui, maka dilakukan tindakan
pengobatan.Kematiandidalamkandunganataukematianbayibarulahirbisa
terjadiakibat:
Kelainankromosompadabayi
Diabetes
Penyakitginjalataupembuluhdarahmenahun
Tekanandarahtinggi
Penyalahgunaanobat
Penyakitjaringanikatpadaibu(misalnyalupus).
Seorangwanitayangpernahmelahirkanbayiprematur,memilikiresikoyang
lebih tinggi untuk melahirkan bayi prematur pada kehamilan berikutnya.
Seorangwanitayangpernahmelahirkanbayidenganberatbadankurangdari1,5
kg,memilikiresikosebesar50%untukmelahirkanbayiprematurpadakehamilan
berikutnya.

Jikaseorangwanitapernahmelahirkanbayidenganberatbadanlebihdari4
kg, mungkin dia menderita diabetes. Jika selama kehamilan seorang wanita
menderitadiabetes,makaresikoterjadinyakeguguranatauresikokematianibu
maupunbayinyameningkat.
Pemeriksaankadarguladarahdilakukanpadawanitahamilketikamemasuki
usiakehamilan2028minggu.Seorangwanitayangtelahmengalamikehamilan
sebanyak6kaliataulebih,lebihmungkinmengalami:
kontraksiyanglemahpadasaatpersalinan(karenaototrahimnyalemah)
perdarahansetelahpersalinan(karenaototrahimnyalemah)
persalinan yang cepat, yang bisa menyebabkan meningkatnya resiko
perdarahanvaginayangberat
plasentaprevia(plasentaletakrendah).
Jika seorang wanita pernah melahirkan bayi yang menderita penyakit
hemolitik,makabayiberikutnyamemilikiresikomenderitapenyakityangsama.
PenyakitiniterjadijikadarahibumemilikiRhnegatif,darahjaninmemiliki
Rhpositifdanibumembentukantibodiuntukmenyerangdarahjanin;antibodiini
menyebabkan kerusakan pada sel darah merah janin. Pada kasus seperti ini,
dilakukanpemeriksaandarahpadaibudanayah.Jikaayahmemiliki2genuntuk
Rhpositif, maka semua anaknya akan memiliki Rhpositif; jika ayah hanya
memiliki1genuntukRhpositif,makapeluanganakanaknyauntukmemilikiRh
positif adalah sebesar 50%. Biasanya pada kehamilan pertama, perbedaan Rh
antaraibudenganbayinyatidakmenimbulkanmasalah,tetapikontakantaradarah
ibu dan bayi pada persalinan menyebabkan tubuh ibu membentuk antibodi.
Akibatnya,resikopenyakithemolitikakanditemukanpadakehamilanberikutnya.
Tetapi setelah melahirkan bayi dengan Rhpositif, biasanya pada ibu yang
memiliki Rhnegatif diberikan immunoglobulin RhnolD, yang akan
menghancurkan antibodi Rh. Karena itu, penyakit hemolitik pada bayi jarang
terjadi.
Seorang wanita yang pernah mengalami preeklamsi atau eklamsi,
kemungkinanakanmengalaminyalagipadakehamilanberikutnya,terutamajika
diluar kehamilan dia menderita tekanan darah tinggi menahun. Jika seorang

wanita pernah melahirkan bayi dengan kelainan genetik atau cacat bawaan,
biasanyasebelummerencanakankehamilanberikutnya,dilakukananalisagenetik
padabayidankeduaorangtuanya.
2.1.3.Kelainanstruktur
Kelainanstrukturpadaorganreproduksiwanita(misalnyarahimgandaatau
leher rahim yang lemah) bisa meningkatkan resiko terjadinya keguguran.
Untuk mengetahui adanya kelainan struktur, bisa dilakukan pembedahan
diagnostik, USG atau rontgen. Fibroid (tumor jinak) di dalam rahim bisa
meningkatkanresikoterjadinya.
kelahiranprematur
gangguanselamapersalinan
kelainanletakjanin
kelainanletakplasenta
keguguranberulang.
2.1.4.Keadaankesehatan
Keadaankesehatantertentupadawanitahamilbisamembahayakanibudan
bayiyangdikandungnya.Keadaankesehatanyangsangatpentingadalah:
Tekanandarahtinggimenahun
Penyakitginjal
Diabetes
Penyakitjantungyangberat
Penyakitselsabit
Penyakittiroid
Lupus
Kelainanpembekuandarah.
2.1.5.Riwayatkeluarga
Riwayatadanyaketerbelakanganmentalataupenyakitketurunanlainnyadi
keluarga ibu atau ayah menyebabkan meningkatnya kemungkinan terjadinya
kelainan tersebut pada bayi yang dikandung. Kecenderungan memiliki anak
kembarjugasifatnyaditurunkan.
2.2.FaktorRisikoSelamaKehamilan
Seorangwanitahamildenganresikorendahbisamengalamisuatuperubahan
yangmenyebabkanbertambahnyaresikoyangdimilikinya.
Diamungkinterpaparoleh teratogen (bahanyangbisamenyebabkancacat
bawaan),seperti radiasi,bahankimiatertentu,obatobatandaninfeksi;ataudia

bisa mengalami kelainan medis atau komplikasi yang berhubungan dengan


kehamilan.
2.2.1

Obatobatanatauinfeksi

Obatobatanyangdiketahuibisamenyebabkancacatbawaanjikadiminum
selamahamiladalah:
Alkohol
Phenitoin
Obatobatyangkerjanyamelawanasamfolat(misalnyatriamterenatau
trimethoprim)
Lithium
Streptomycin
Tetracyclin
Talidomide
Warfarin.
Infeksiyangbisamenyebabkancacatbawaanadalah:
Herpessimpleks
Hepatitisvirus
Influenza
Gondongan
CampakJerman(rubella)
Cacarair(varisela)
Sifilis
Listeriosis
Toksoplasmosis
Infeksiolehviruscoxsackieatausitomegalovirus.
Merokok berbahaya bagi ibu dan janin yang dikandungnya, tetapi hanya
sekitar20%wanitayangberhentimerokokselamahamil.Efekyangpalingsering
terjadiakibatmerokokselamahamiladalahberatbadanbayiyangrendah.Selain
itu,wanitahamilyangmerokokjugalebihrentanmengalami:
komplikasiplasenta
ketubahpecahsebelumwaktunya
persalinanpremature
infeksirahim.
Seorang wanita hamil yang tidak merokok sebaiknya menghindari asap
rokokdarioranglainkarenabisamemberikanefekyangsamaterhadapjaninnya.

Cacatbawaanpadajantung,otakdanwajahlebihseringditemukanpadabayi
yangibunyamerokok.
Merokok selama hamil juga bisa menyebabkan meningkatnya resiko
terjadinya sindroma kematian bayi mendadak. Selain itu, anakanak yang
dilahirkan oleh ibu perokok bisa mengalami kekurangan yang sifatnya ringan
dalam hal pertumbuhan fisik, perkembangan intelektual dan perilaku. Efek ini
diduga disebabkan oleh karbon monoksida (yang menyebabkan berkurangnya
pasokan oksigen ke jaringan tubuh) dan nikotin (yang merangsang pelepasan
hormon yang menyebabkan pengkerutan pembuluh darah yang menuju ke
plasentadanrahim).
Mengkonsumsi alkohol selama hamil bisa menyebabkan cacat bawaan.
Sindromaalkoholpadajaninmerupakansalahsatuakibatutamadaripemakaian
alkoholselamahamil.Sindromainiditandaidengan:
keterbelakanganpertumbuhansebelumatausesudahlahir
kelainanwajah
mikrosefalus (ukurankepalalebihkecil),yangkemungkinandisebabkan
olehpertumbuhanotakyangdibawahnormal
kelainanperkembanganperilaku.
Sindroma alkohol pada janin seringkali menyebabkan keterbelakangan
mental. Selain itu, alkohol juga bisa menyebabkan keguguran dan gangguan
perilaku yang berat pada bayi maupun anak yang sedang tumbuh (misalnya
perilakuantisosialdankurangmemperhatikan).
Resikoterjadinyakeguguranpadawanitahamilyangmengkonsumsialkohol
adalah2kalilipat,terutamajikawanitatersebutadalahpeminumberat.Berat
badanbayiyangdilahirkanberadadibawahnormal,yaituratarata2kg.Suatu
pemeriksaanlaboratoriumyangsensitifdantidakmemerlukanbiayabesar,yaitu
kromatografi, bisa digunakan untuk mengetahui pemakaian heroin, morfin,
amfetamin,barbiturat,kodein,kokain,marijuana,metadonataufenotiazinpada
wanitahamil.
Wanitayangmenggunakanobatsuntikmemilikiresikotinggiterhadap:
Anemia

Bakteremia
Endokarditis
Abseskulit
Hepatitis
Flebitis
Pneumonia
Tetanus
Penyakitmenularseksual(termasukAIDS).
Sekitar75%bayiyangmenderitaAIDS,ibunyaadalahpemakaiobatsuntik
atau pramuria. Bayibayi tersebut juga memiliki resiko menderita penyakit
menular seksual lainnya, hepatitis dan infeksi. Pertumbuhan mereka di dalam
rahim kemungkinan mengalami kemunduran dan mereka bisa lahir prematur.
Kokain merangsang sistem saraf pusat, bertindak sebagai obat bius lokal dan
menyebabkan pengkerutan pembuluh darah. Pembuluh darah yang mengkerut
bisa menyebabkan berkurangnya aliran darah sehingga kadang janin tidak
mendapatkanoksigenyangcukup.Berkurangnyaalirandarahdanoksigenbisa
menyebabkangangguanpertumbuhanberbagaiorgandanbiasanyamenyebabkan
cacatkerangkasertapenyempitansebagianusus.
Pemeriksaanairkemihuntukmengatahuiadanyakokainbiasanyadilakukan
jika:
seorangwanitahamiltibatibamenderitatekanandarahtinggiyangberat
terjadiperdarahanakibatpelepasanplasentasebelumwaktunya
terjadi kematian dalam kandungan yang sebabnya tidak diketahui.
31% dari wanita pemakai kokain mengalami persalinan prematur, 19%
melahirkan bayi yang pertumbuhannya terhambat dan 15% mengalami
pelepasanplasentasebelumwaktunya.
Jika pemakaian kokain dihentikan setelah trimester pertama, maka resiko
persalinanprematurdanpelepasanplasentasebelumwaktunyatetapmeningkat,
tetapipertumbuhanjaninnyanormal.
2.2.2.Keadaankesehatan

Tekanandarahtinggipadawanitahamilbisadisebabkanolehkehamilanatau
keadaanlain.Tekanandarahtinggidiakhirkehamilanbisamerupakanancaman
seriusterhadapibudanbayinyadanharussegeradiobati.Jikaseorangwanita
hamilpernahmenderitainfeksikandungkemih,makadilakukanpemeriksaanair
kemihpadaawalkehamilan.Jikaditemukanbakteri,segeradiberikanantibiotik
untukmencegahinfeksiginjalyangbisamenyebabkanpersalinanprematurdan
ketubanpecahsebelumwaktunya.Infeksivaginaolehbakteriselamahamiljuga
bisa menyebabkan persalinan prematur dan ketuban pecah sebelum waktunya.
Untukmencegahterjadinyahaltersebut,diberikanantibiotik.
Penyakityangmenyebabkandemam(suhulebihtinggidari39,4Celsius)
pada trimester pertama menyebabkan meningkatnya kemungkinan terjadinya
kegugurandankelainansistemsarafpadabayi.Demampadatrimesterterakhir
menyebabkanmeningkatnyakemungkinanterjadinyapersalinanprematur.
2.2.3.Komplikasikehamilan
1.InkompatibilitasRh
Ibu dan janin yang dikandungnya bisa memiliki jenis darah yang tidak
sesuai. Yang paling sering terjadi adalah inkompatibilitas Rh, yang bisa
menyebabkanpenyakithemolitikpadabayibarulahir.Penyakithemolitikbisa
terjadijikaibumemilikiRhnegatif,ayahmemilikiRhpositif,janinmemilikiRh
positifdantubuhibumembuatantibodiuntukmelawandarahjanin.Jikaseorang
ibuhamilmemilikiRhnegatif,makadilakukanpemeriksaanantiboditerhadap
janinsetiap2bulan.12
Resikopembentukanantibodiinimeningkatpadakeadaanberikut:
setelahterjadinyaperdarahandimanadarahibudandarahjaninbercampur
setelahpemeriksaanamniosentesis
dalam waktu 72 jam setelah melahirkan bayi dengan Rhpositif.
Padasaatinidanpadakehamilan28minggu,diberikanimunoglobulinRhnolD
kepadaibu,yangakanmenghancurkanantibodiRh.12
2.Perdarahan
Penyebabperdarahanpalingseringpadatrimesterketigaadalah:

Kelainanletakplasenta
Pelepasanplasentasebelumwaktunya
Penyakit pada vagina atau leher rahim (misalnya infeksi).
Perdarahanpadatrimesterketigamemilikiresikoterjadinyakematianbayi,
perdarahan hebat dan kematian ibu pada saat persalinan.

Untuk menentukan penyebab terjadinya perdarahan bisa dilakukan


pemeriksaanUSG,pengamatanleherrahimdanPapsmear.12
3.Kelainanpadacairanketuban
Airketubanyangterlalubanyakakanmenyebabkanpereganganrahimdan
menekan diafragma ibu.Halinibisamenyebabkangangguanpernafasanyang
berat pada ibu atau terjadinya persalinan prematur. Air ketuban yang terlalu
banyakcenderungterjadipada:
ibuyangmenderitadiabetesyangtidakterkontrol
kehamilanganda
inkompatibilitasRh
bayi dengan cacat bawaan (misalnya penyumbatan kerongkongan atau
kelainansistemsaraf).
Airketubanyangterlalusedikitditemukanpada:
bayiyangmemilikicacatbawaanpadasalurankemih
bayiyangmengalamihambatanpertumbuhan
bayiyangmeninggaldidalamkandungan.12
4.Persalinanprematur
Persalinanprematurlebihmungkinterjadipadakeadaanberikut:
ibumemilikikelainanstrukturpadarahimatauleherrahim
perdarahan
stressfisikataumental
kehamilanganda
ibupernahmenjalanipembedahanrahim.
Persalinanprematurseringkaliterjadijika:
bayiberadadalamposisisungsang
plasentaterlepasdarirahimsebelumwaktunya
ibumenderitatekanandarahtinggi
airketubanterlalubanyak
ibumenderitapneumonia,infeksiginjalatauapendisitis.12
5.Kehamilanganda
Kehamilanlebihdari1janinjugabisamenyebabkanmeningkatnya
kemungkinanterjadinyacacatbawaandankelainanpadasaatpersalinan.12
6.Kehamilanlewatwaktu

Padakehamilanyangterusberlanjutsampailebihdari42minggu,
kemungkinanterjadinyakematianbayiadalah3kalilebihbesar.12
D. Tanda Bahaya dalam Kehamilan
1.

Muntah terus menerus, tidak bisa makan, keadaan ini akan membahayakan
ibu

2.

Perdarahaan
Perdarahan pada hamil muda dapat menyebabkan keguguran. Dan juga
perdarahan pada hamil tua dapat membahayakan keselamatan ibu dan bayi
dalam kandungan

3.

Pucat
Pucat pada conjungtiva, muka, telapak tangan menunjukkan anemia
(kekurangan darah)

4.

Bengkak di kaki, tangan dan wajah, atau sakit kepala kadangkala disertai
kejang, kondisi ini dapat membahayakan keselamatan ibu dan bayi dalam
kandungan

7.

Demam tinggi, biasanya karena infeksi. Demam yang tinggi bisa


membahayakan keselamatan jiwa ibu, menyebabkan keguguran atau
kelahiran kurang bulan

8.

Keluar air ketuban sebelum waktunya, merupakan tanda adanya gangguan


pada kehamilan, dapat membahayakan bayi dalam kandungan

9.

Bayi dalam kandungan gerakannya berkurang atau tidak bergerak, keadaan


ini merupakan tanda bahaya pada janin
E. Hal yang Harus Dilakukan
1. Pemeriksaan kehamilan secara berkala
2. Perawatan diri selama hamil : Nutrisi, perawatan payudara, kebersihan diri,
aktivitas,senam hamil
F. Pelayanan yang Didapatkan oleh Ibu Hamil pada saat
Memeriksakan Kehamilannya
1.

Penimbangan berat badan

2.

Pemeriksaan tekanan darah

3.

Pengukuran fundus uteri

4.

Imunisasi TT

5.

Tablet tambah darah

6.

Penyuluhan kesehatan

1.
2.
3.
4.
5.
6.
7.
8.

G. BAHAYAYANGDAPATDITIMBULKAN
Bayilahirbelumcukupbulan.
Bayilahirdenganberatkahirrendah(BBLR).
Keguguran(abortus)
Persalinantidaklancar/macet.
Perdarahansebelumdansesudahpersalinan.
Janinmatidalamkandungan.
Ibuhamil/bersalinmeninggaldunia.
Keracunankehamilan/kejangkejang.
H. DETEKSIKEHAMILANRESIKOTINGGI
Melakukanpemeriksaankehamilansecararutindidokter/bidanterdekat.
I. PENCEGAHAN
Kehamilanrisikotinggidapatdicegahdandiatasidenganbaikbila

gejalanyaditemukansedinimungkinsehinggadapatdilakukantindakan
perbaikinya,dankenyataannya,banyakdarifaktorresikoinisudahdapat
diketahuisejaksebelumkonsepsiterjadi.
Jadisemakindinimasalahdideteksi,semakinbaikuntukmemberikanpenanganan
kesehatanbagiibuhamilmaupunbayi.Jugaharusdiperhatikanbahwapada
beberapakehamilandapatmulaidengannormal,tetapimendapatkanmasalah
kemudian.
SangatpentingbagisetiapibuhamiluntukmelakukanANC(AntenatalCare)
ataupemeriksaankehamilansecarateratur,yangbermanfaatuntukmemonitor
kesehatanibuhamildanbayinya.Denganmemeriksakankehamilansedini
mungkindanteraturkePosyandu,Puskesmas,RumahSakit,palingsedikit4kali
selamamasakehamilan.
DenganmendapatkanimunisasiTT2X.
Biladitemukankelainanrisikotinggipemeriksaanharuslebihseringdanlebih

intensif.
Makanmakananyangbergiziyaitumemenuhi4sehat5sempurna.
Hindarirokok,alkohol,dll
Caramencegahkehamilanrisikotinggi
1. Usiahamiltidakkurangdari20tahunataulebihdari35tahun.
2. Rencanakanjumlahanak2orangsaja.
3. Hindarijarakkehamilanterlaludekatatauterlalujauh.
4. Memeriksakehamilansecarateraturkepadatenagakesehatan.
5. Menggunakanalatkontrasepsiuntukmenundakehamilan.
6. Melahirkandenanpertolongantenagakesehatan.