Anda di halaman 1dari 24

LEMBAR PENGESAHAN

Nama
NIM
Judul Referat

: Vania Paramitha
: 030.09.263
: Hipotiroid

Referat ini telah disetujui oleh dokter pembimbing untuk dijadikan salah satu syarat
mengikuti ujian kepaniteraan klinik Ilmu Kesehatan Anak periode 14 September 2015
sampai dengan 21 November 2015 di RSUD Budhi Asih Jakarta.
Yang bertanda tangan dibawah
ini,
Dokter Pembimbing

dr.MeihartyZSp.A

KATA PENGANTAR
Puji dan syukur penulis panjatkan kepada Allah SWT, karena atas rahmat dan
karunia-Nya penulis dapat menyelesaikan referat dalam Kepaniteraan Klinik Ilmu

Kesehatan Anak periode 14 September 2015 sampai dengan 21 November 2015 di


RSUD Budhi Asih, yang berjudul Hipotiroid.
Penulis mengucapkan terimakasih kepada dr. Meiharty Z Sp.A yang telah
membimbing dalam penyusunan referat ini, serta kepada seluruh dokter yang telah
membantu membimbing penulis selama kepaniteraan klinik Ilmu Kesehatan Anak di
RSUD Budhi Asih Jakarta. Dan juga ucapan terima kasih kepada teman-teman di
kepaniteraan ini, serta kepada semua pihak yang tidak dapat disebutkan satu per satu
yang telah memberi dukungan dan bantuannya kepada penulis.
Semoga referat ini dapat bermanfaat bagi kami dan para pembaca pada
umumnya. Penulis menyadari bahwa penulisan referat ini masih jauh dari sempurna,
oleh karena itu kritik dan saran yang membangun diharapkan dari pembaca sekalian.
Jakarta, November 2015

Penulis

BABI

1.1Pendahuluan

Iodium merupakanmikronutrien yangsangatdibutuhkanoleh tubuhdalamsistem


hormontiroidyangmempunyaiperansangatvitaldalampertumbuhanotak,system
saraf dan fungsi fisiologis organorgan tubuh. Kelompok yang rentan terkena
kekuranganiodiuminiadalahwanitausiasuburatauWUSyangjikahamilmakaakan
berdampak pada janinnya, ibu hamil, ibu menyusui dan anakanak. prevalensi
hipotiroid di Indonesia belum diketahui secara pasti. Riset kesehatan dasar
(Riskesdas)2007melakukanpemeriksaankadarTSHsebagaisalahsatupenunjang
diagnostikgangguantiroid.DaripemeriksaanTSHtersebutdidapatkan2,7%laki
lakidan2,2%perempuanmemilikikadarTSHtinggiyangmenunjukankecurigaan
adanyahipotiroid.1
Tujuan penyusunan sari pustaka ini karena kasus hipotiroid dirasa penting untuk
diketahui sebagai salah satu bekal untuk menjadi seorang dokter umum yang
kompeten. Pada kasus hipotiroid, diperlukan tatalaksana secara dini agar dapat
mencegah terjadinya komplikasi yang dapat berakhir dengan retardasi mental berat.
Peran seorang dokter umum ialah sebagai ujung tombak dari pelayanan primer
kesehatan sehingga penting dalam upaya deteksi dini kasus-kasus hipotiroid. Namun,
pada anak dengan hipotiroid seringkali didapatkan gejala klinis yang kurang spesifik
sehingga perlu suatu pedoman atau kriteria untuk menegakkan diagnosis hipotiroid.
Oleh karena itu, pada sari pustaka ini akan dibahas mengenai epidemiologi, definisi,
etiologi, anatomi, fisiologi, patofisiologi, gejala klinis, pemeriksaan laboratorium,
penegakkan diagnosis, dan akhirnya tatalaksana dari hipotiroid. 1
1.2 Batasan Masalah
sari pustaka ini membahas tentang hipotiroid
1.3 Tujuan Penulisan
Tujuan penulisan sari pustaka ini adalah untuk memenuhi tugas kepaniteraan klinik di
bagian Ilmu Kesehatan Anak RSUD Budhi Asih dan meningkatkan pemahaman
mahasiswa mengenai hipotiroid.
1.4 Manfaat Penulisan
Sari pustaka ini diharapkan dapat memberi manfaat untuk menambah pengetahuan
dan pemahaman mengenai diagnosis dan tatalaksana hipotiroid

1.5 Metode Penulisan


Metode penulisan sari pustaka ini menggunakan metode studi kepustakaan dari
berbagai literatur.

BABII

2.1Epidemiologi
PrevalensihipotiroiddiIndonesiabelumdiketahuisecarapasti.Risetkesehatandasar
(Riskesdas)2007melakukanpemeriksaankadarTSHsebagaisalahsatupenunjang
diagnostikgangguantiroid.DaripemeriksaanTSHtersebutdidapatkan2,7%laki
lakidan2,2%perempuanmemilikikadarTSHtinggiyangmenunjukankecurigaan
adanyahipotiroid.1
Kecukupan konsumsi atau asupan iodium di masyarakat dapat dinilai melalui
pengukuran UrinaryIodineExcretion(UIE)atauekskresiiodiumdalamurin(EIU)
setelah urin dikumpulkan selama 24 jam. Kadar UIE ini merupakan indicator
biokimianoninvasiveyangmenggambarkankonsumsiiodiumhariankarena90%
asupaniodiumakandikeluarkankembalimelaluiurin.DistribusikadarEIUdapat
digunakanuntukmenilaiasupaniodiumdanstatusiodiumdanstatusiodiumpopulasi.
NilainormalmedianEIUmenurutkriteriaWHOadalah100199g/L,sehingga
daerahdengannilaimediankurangdari100g/Lmenunjukanbahwadaerahtersebut
kekuranganiodium(WHO,2007)1
Tabel1.Kondisiasupaniodiumdanstatus(gizi)iodiumpadapopulasiberdasarkan
nilaimedianEIU(g/L)1

Tabel2.KondisiasupaniodiumpadaibuhamilberdasarkanEIU

Gambar1.KecenderungannilaimediaEIUdarisampelurinsesaatpadakelompok
populasimenuruttempattinggal.1

NilaimedianEIUpadaanak612tahunsebesar215g/L,WUS187g/L,ibuhamil
163 g/L dan ibu menyusui 164 g/L, masingmasing lebih tinggi di perkotaan
daripadadipedesaan.NilaiinimenunjukanbahwaasupaniodiumdiIndonesiasudah
cukup untuk kelompok populasi rentan. Nilai median EIU terendah 151 g/L
ditemukanpadaibuhamildipedesaan,yangmenggambarkanasupaniodiumpadaibu
hamildidaerahpedesaantergolongcukupnamunharustetapwaspadakarenaberada
padalevelterendahdarinilainormalmedianEIUpadaibuhamil.1
Diseluruh dunia, prevalensi hipotiroid kongenital diperkirakan mendekati 1:3000
kelahirandengankejadiansangattinggididaerahkekuranganiodium,yaitu1:900
kelahiran,lebihseringterjadipadaanakperempuandenganperbandingan2:1.Angka
kejadianhipotiroidkongenitalbervariasiantarNegara,dipengaruhipulaolehfaktor
etnisdanrasnya.Prevalensicenderunglebihtinggipadaketurunanasiadansangat
jarangpadapopulasikulithitam.AngkakejadiandibeberapaNegaraadalahsebagai
berikut:
Tabel3.KasusHipotiroidKongenitalDiBeberapaNegaraAsia(infodatin)

Indonesia belum memiliki data kasis hipotiroid kongenital secara nasional. Data
hipotiroid kongenital di Indonesia baru dapat diperoleh dari RSUP Dr. Cipto
MangunkusumoJakartadanRSHasanSadikinBandungdengandatasebagaiberikut:

Kejadianhipotiroidkongenitaltahun2000sampaidenganSeptember2014,
dari213.669bayibaru lahiryangdilakukansrininghipotiroidkongenital,
didapatkanhasilpositifsejumlah85bayiatau1:2513kelahiran9lebihtinggi

darirasioglobal1:3000kelahiran
Telaah rekam medis di klinik endokrin RSUP Dr. Cipto Mangunkusumo
Jakarta dan RS Hasan Sadikin Bandung menunjukan ada lebih dari 70%
hipotiroid kongenital didiagnosis pada umur lenih dari 1 tahun dengan
keterbelakanganmentalpermanen.Hanya2,3%yangdidiagnosispadaumur
kurangdari3bulan.Padabayiyangterdeteksisebelumusia3bulanhanya

terjadiketerbelakanganpertumumbuhandanperkembanganyangminimal.
Jikaangkakelahiransebanyak5jutabayi/tahundengankejadian1:3000
kelahiran maka terdapat lebih dari 1600 bayi dengan hipotiroid kongenital
pertahunyangakanterakumulasisetiaptahunnya.1

2.2Definisi
Terdapatbeberapajenishipotiroidisme,yangpertamaadalahbergantungpadalokasi
timbulnyamasalah.Hipotiroidismeprimerapabiladidapatkankelainanyangtimbul
karena proses patologis yang terjadi pada kelenjar tiroid tersebut atau sekunder
apabilakelainanyangtimbuladalahakibatdaridefisiensisekresiTSHhipofisis.Yang
keduaadalahbergantungpadausiaawitannya,apabilakekuranganhormonetiroid
sebelumatausegerasetelahlahirmakadisebutjugadenganhipotiroidismekongenital
ataukretinisme.Apabilatimbulnyagejalasetelahusia1atau2tahunmakadisebut
juga dengan hipotiroidisme juvenilis, apabila timbul pada saat usia dewasa maka
dinamakanhipotiroidismedewasaataumiksedema.2
Hipotiroidismekongenitalataukretinismemerupakankelainankekuranganhormone
tiroid sejak lahir atau menjadi nyata gejalanya dalam beberapa bulan pertama
kehidupan.Terdapatpulasebutankretinendemicdimanadigunakanuntukbayibayi
yanglahirpadadaerahdaerahdenganasupaniodiumyangrendah.Kretinendemic
merupakankelainanakibatkekuranganiodiumyangberatpadasaatmasafetaldan
merupakanindikatorklinikyangpentingbagigangguanakibatkekuranganiodium.
Terdapat 3 tipe kretinisme kretinisme tipe nervosa, tipe miksedematosa dan tipe
campuran.Kretintipenervosamerupakangangguandefisiensiintelektual,tulidan
motorrigidityyangmenggambarkanketerlibatanneocortexcerebri,ganglionbasal
7

dancochlea.Sedangkantipemiksedematosaadalahkretinismeyanggejalaklinisnya
lebihcenderungcebol,kulitkering,rambutjarangdanterdapatperkembanganseksual
yang terhambat. Tipe terakhir yaitu tipe campuran adalah gabungan antara kretin
nervosadanmiksedematosayaituadanyaretardasimental,gangguanneuromotirik
yangjelasdanadanyatandatandahipotiroidklinik.2,3
2.3Anatomidanfisiologikelenjartiroid
Kelenjar tiroid terdiri dari dua lobus yang menyatu di bagian tengah oleh bagian
sempitkelenjar,sehinggakelenjariniterlihatsepertidasikupukupu.4
Gambar2.AnatomiKelenjarTiroid4

SumberLauraleeSherwood
Selselsekretorikutamatiroidtersusunmenjadugelembunggelembungberongga,
yangmasingmasingmembuatunitfungsionaldisebutfolikel.Apabiladilihatsecara
mikroskopik, folikel tampak seperti cincincincin sel folikel yang meliputi lumen
bagian dalam yang meliputi lumen bagian dalam yang dipenuhi koloid. Yang
merupakansuatubahanyangberfungsisebagaitempatpenyimpananekstraseluntuk
hormontiroid.4
Gambar3.SelFolikeldanKoloid4

SumberLauraleeSherwood
Bagianutamadarikoloidadalahmolekulbesardankompleksyangdikenalsebagai
tiroglobulin,yangdalamnyaadalahhormonehormontiroiddalamberbagaitahapan
pembentukannya.Selselfolikeltersebutmenghasilkanduahormonyangberasaldari
asamaminotirosinyaitutetralodotironinatauT4atautiroksindantriiodotironinatau
T3, angka yang terdapat pada hormone tiroid tersebut menunjukan jumlah atom
iodium yang masing masing terdapat di dalam setiap molekul hormone. Kedua
hormoneini,yangsecarakolektifdisebutsebagaihormonetiroid,yangmerupakan
regulator penting bagi laju metabolism basal keseluruhan. Diruang interstisium di
antarafolikeltersebutterdapatselsekretorikyaituselC,disebutselCkarenaselini
mengeluarkanhormonkalsitonin.Yangberperanpadapembentukankalsium.Namun
kalsitonintidakmemilikihubungandengankeduahormontiroidtersebut.4
Bahanbahandasaruntuksintesishormontiroidadalahtirosindaniodium
yangkeduanyadidapatkandaridarah,diserapolehselselfolikel.Tirosin,suatuasam
aminoyangdisintesadalamjumlahcukupolehtubuhmakatidakdibutuhkandari
makanan,sedangkaniodiumharusdiperolehdarimakanan.4,5
Semualangkahsintesishormontiroidberlangsungdimolekultiroglobulindi
dalam koloid. Tiroglobulin sendiri dihasilkan oleh kompleks golgi atau reticulum
endoplasmaselfolikeltiroid.Tirosinmenyatukedalammolekultiroglobulinsewaktu
molekul besar ini di produksi. Setelah di produksi, tiriglobulin yangmengandung
tirosin dikeluarkan dari sel folikel ke dalam koloid melalui eksositossis. Tiroid
menangkapiodiumdaridarahdanmemindahkannyakedalamkoloidmelaluisuatu
pompa iodium yang aktif atau disebut juga dengan iodinetrapping mechanism.
9

hampirsemuaiodiumditubuhdipindahkankekelenjartiroiduntuksintesis.Didalam
koloid,iodiumdengancepatmelekatkesebuahtirosindidalammolekuktiroglobulin.
PerlekatantersebutmenghasilkanmonoiodotirosinatauMIT.Perlekatanduaiodium
dengan tirosin menghasilkan diiodotirosin atau DIT. Kemudian terjadi proses
penggabungan antara molekul tirosin beriodium tersebut. Penggabungan dua DIT
menghasilkantetraiodotironinatauT4atautiroksin.PenggabungansatuMITdengan
satuDITmenghasilkantriiodotirosinatauT3.PenggabungandiamolekulMITtidak
terjadi.4,5
Semuareaksiiniterjadididalammolekultiroglobulin,semuaprodukiniakan
tetapmelekankeproteinbesartersebut.Hormonhormontiroidtetapdisimpan
dalambentukinidikoloidsampaimerekadipecahdandisekresikan.Jumlahhormon
tiroidyangsecaranormaldisintesisdandisimpandikoloidcukupuntukkebutuhan
tubuhuntukbeberapabulan.Pengeluaranhormonhormontiroidkedalamsirkulasi
sistemikmemerlukanprosesyangrumit.Pertama,sebelumdikeluarkan,T4danT3
tetapterikatkemolekultiroglobulin,kedua,hormoninidisimpanditempatekstrasel
lumen folikel, sebelum dapat memasuki pembuluh darah yang berjalan di ruang
interstisialmerekaharusdiangkutmenembusruanginterstisium.Prosessekresiini
sebenarnyaadalahprosespengigitansepotongkoloidolehselfolikel,sehingga
molekultiroglobulinterpecahdanT4danT3dapatkeluarkedalamdarah.Hormon
tiroidinisifatnyasangatlipofiliksehinggadenganmudahmelewatimembraneluar
selfolikeldanmasukkedalamdarah.MITdanDITyangiutkeluarkeperedarah
darahtidakmemilikinilaiendokrinsehinggadiaakandipecahdaniodiumnyaakan
diambilkembaliuntukdidaurulanguntuksintesislebihbanyakhormonkembali.T4
yangkeluarsebagianakandiubahmenjadibentukT3ataudiaktifkanmelaluiproses
pengeluaran satu iodium di hati dan di ginjal. T4 dan T3 yang bersifat lipofilik
tersebutakancepatberikatandengaproteinplasmadidarah.Terdapattigaprotein
plasmayangpentingdalampengikatanhormontiroid.Yangpertamaadalahglobulin
pengikat tiroksin ( thyroxinebinding globulin ), albumin dan thyroxinebinding
prealbumin.4

Gambar4.Prosessintesishormontiroid4

10

sumberLauraleeSherwood
Efek pada laju metabolism untuk hormon tiroid ini adalah meningkatkan laku
metabolicbasaltubuhkeseluruhan.Hormoniniadalahregulatorpentingbagitingkat
konsumsiO2danpengeluaranenergytubuhpadakeadaanistirahat.Hormoninijuga
berefek kepada produksi panas yaitu efek kalorigenik. Selain meningkatkan laju
metabolism basal, hormon tiroid memodulasi banyak reaksi spesifik. Seperti
berpengaruhpadapemecahankarbohidrat.Lemakdanprotein.
Hormontiroidinijugamempunyaiefeksimpatomimetikyangmirimseperti
respons simpatis yaitu meningkatkan ketanggapan sel saraf simpatis terhadap
katekolaminsehinggadapatmenyebabkanproliferasireseptorspesifikkatekolamindi
selsasaran.Padajantunghormonhormoninimeningkatkanketanggapanjantung
terhadap katekolamin dalam darah, hormon tiroid meningkatkan kecepatan denyut
dan kekuatan kontraksi pada otot jantung sehingga menyebabkan curah jantung
meningkat. Pada saraf hormon ini mampu meningkatkan kecepatan saraf perifer
menghantarkanimpuls.4
Tyroidstimulating hormone atau TSH dari hipofisis anterior adalah
merupakan regulator terpenting bagi sekresi hormon tiroid. Selain itu TSH juga
bertugas untuk mempertahankan kelenjar tiroid, tanpa adanya TSH maka kelenjar
tiroiddapatmenjadiatrofisertaberkurangnyasekresihormontiroid.Hormontiroid
denganmekanismeumpanbaliknegativeakanmematikansekresiTSHsementara

11

tyrotropinreleasing hormone atau TRH dari hipotalamus menghidupkan sekresi


TSHolehhipofisisanterior.4

2.4Patofisiologi
Penyebab penurunan pelebasan hormon tiroid biasanya ditemukan kelainan
padakelenjartiroiditusendiriyaituterjadigangguansintesishormontiroidseperti
penurunan asupan iodin didalam makanan sehingga bahan untuk sisntesinya
berkurang. Gangguan pengambilan iodon di sel tiroid dapat dikarenakan oleh
perklorat,nitratatautiosianat.Pemecahantiroglobulinyangabnormal.Defekpada
penggabunganiodin.Kurangnyasensitivitasorgantargetakibatdefekreseptoratau
perubahan menjadi T3 yang lebih efektif tidak adekuat sehingga menurunkan
efektivitas T4 atau T3. Mutasi TSH juga dapat mengubah kadar tiroid. Penyebab
peningkatanpelepasanhormontiroidyangpalingseringadalahpadapenyakitGraves
terjadipeningkatanlongactingtyroidstimulatoratauLATSatautyroidstimulating
immunoglobulin TSI. Hal ini menyebabkab perangan pelepasan hormon dan
pembesarantiroid.6

12

Gambar5.Patofisiologihipotiroid6

sumberatlaspatofisiologiberwarna
2.5Etiologi
Hipotiroidisme kongenital dapat terjadi secara primer maupun sekunder. Kausa
primernyaadalahberupagagaltumbuhnyakelenjartiroid,defisiensisintesishormon
tiroiddanterdapatgangguanpadaTSH.85%diNegaradenganasupaniodincukup
13

diapatkan hipotiroid kongenital karena tidak tumbuh sempurnanya kelenjar tiroid


sehinggamenyebabkanpermanenkongenitalhipotiroidisme.Haliniberkaitandengan
perkembangan pada saat fase embriologi. Sedangkan 10 15%nya dikarenakan
sintesishormontiroidyangsedikitataudiproduksinamundengankualitasyangtidak
baikyangdapatpuladisebutdengan dyshormonogenesis.Sebabyangkeduaadalah
disgenesiskelenjartiroid.Halinidibagimenjaditigayaituektopiktiroid,athyreosis
atau hypoplasia tiroid. Tiroid ektopi merupakan kelenjar tiroid yang tumbuh atau
beradadilokasiyangtidakseharusnya.7
Tabel.4Etiologihipotiroidkongenital7

SumberCongenitalHypotiroidismeRastogiMKet.al
Etiologilainnyajugadapatdikarenakanolehmutasigeneticyaitutyroidtranscription
factor(TTF2)yangmenimbulkangejalaklinisatresiakoana,bibirsumbing,rambut
berdiri dan disgenesis tiroid. Pada mutasi kompleks genetic NIKX2.1 didapatkan
kelainanberupakongenitalhipotiroid,respiratorydistress,ataxiadanbenignchorea.
Apabila terdpat mutasi genetic NIKX2.5 maka didapatkan kelainan klinis yaitu
hipotiroidkongenitaldankelainanpembentukanpadajantung.Kemuddianapabila
terjadi kelainan genetic pax8 maka didapatkan kelainan klinis berupa disgenesis
tiroid, ginjal dan kelainan pada pembentukan saluran kemih. Tiroid
dishormonogenesisyangsifatnyaadalahautosomalresesif.
Hal ini berhubungan dengan kerusakan thyroid peroxidase yang fungsinya
adalahmenyatukaniodindidalamtubuh.IniterjadipadaPandredssyndromeyaitu
kerisakanpadamembraneproteinpendrin(7q31)yangmemilikitriassebagaiberikut
hipotiroidisme,goiterdantuli.Hipotiroidkongenitalsekunderlebihkearahkelainan
padaproduksiTSHyangbersifatautosomalresesif.Peripheraldefectsyaituterdapat

14

kerusakangeneticpadasystemtransportasiplasmahormontiroid.Padaetiologiini
berhubungan sekali degan defek neurologis seperti quadriplegia yang disebabkan
olehtidakadekuatnyaT3masukkedalamneuronyangdisebutjugadengan Allan
HerndonDudleysyndrome.PadaTransientcongenitalhypotiroidismeinipenyebabny
adalahdefisiensiiodiumyangbiasanyaterjadipadabayibayiyanglahirpreterm
yang dikarenakan ibunya tidak konsumsi iodium dengan jumlah yang seharusnya.
Yang kedia adalah terdapat blokade antibody antitiroid di reseptor TSH pada ibu
hamilyangsedangmenjalanipengobatanhipertiroid.7
Tabel.5Etiologihipotiroidkongenital

15

SumberCongenitalHypotiroidismeRastogiMKet.al

2.6Diagnosis
2.6.1Anamnesis
Padaanamnesisdapatdilihatdaripadasaatpasienitudatangberobat,dilihatdariusia
diadatang,biasanyauntukhipotiroidkongenitalakandatangpadausialebihdari8
minggukarenasebelumitukeluhanmasihbelumterlalumenonjol.Bilabayidatang

16

denganusialebihtuamakakeluhanibubiasanyadidapatkanperkembangananaknya
terlambatdantidakmengalamipertumbuhanyangseharusnyasepertiterdapatberat
badanyangstabiltidakmeningkatdantinggibadanyangtidakbertambahsehingga
ibumerasakananaknyainiterlihatlebihpendekdaribayiseusianya.
Didapatkanjugakeluhanberupabayinyalemasataukurangaktifjikadiajak
bermain,konstipasi,pucatdanapabilamenangisdidapatkansuarayangparauatau
serak. Tanyakan pula apakah ibu pasien tinggal di daerah endemis kekurangan
iodium.Padariwayatkelahiranbiasanyadidapatkanusiakelahiranyangpostmatur
atau lebih bulan, berat badan lahirnya kurang dari 2000gr atau lebih dari 4000gr
Terdapatriwayatgangguantiroiddalamkeluarganyaatauibunyasendiriyangsakit
tiroiddansedangkonsumsiobatantitiroidatausedangmenjalaniterapisinar.8
2.6.2Pemeriksaanfisik
Padapemeriksaanfisikbiasanyadidapatkanubunubunbesaryanglebihlebardari
bayinormalpadaumumnyadanbelummenutupdiusiayangseharusnya.Didapatkan
wajahkesanDullface,downsyndromenamunpadadownsyndromebayicenderung
lebih aktif lidah yang besar, kulit cenderung kering, terdapat hernia umbilikalis,
mottling,didapatkankesanbayiyangtidakaktifpadasaatdiajakbermain.Didapatkan
ototyanghipotonus,pucatpadakeseluruhan.8

Gambar5.Gambarangejalaklinishipotiroidisme

17

sumberCongenitalHypotiroidismeRastogiMKet.al
2.6.3Pemeriksaanpenunjang
PemeriksaandarahdapatdilakukanpemeriksaanfungsitiroidT4danTSHdilakukan
untukmemasikandiagnosis,apabilapadahasilnyaditemukankadarT4yangrendah
dandisertaipulaolehTSHyangmeningkat,makadiagnosishipotiroidismesudah
dapatditegakkan.Apabilaibudicurigaimenderitahipotiroidmakabayijugaperlu
diperiksaantibodyantitiroid.KadarTBGakandiperiksabilaadadugaandefisiensi
TBGyaitubiladenganpengobatanhormontiroidtidakadarespons.
Pemeriksaanpenunjanglainnyaberupapemeriksaanradiologisyangakandi
dapatkanboneageterlambat,pemeriksaanskintigrafikelenjartiroiddapatdilakukan
untukmenentukanpenyebabhipotiroiddandapatmembantudalamkonselinggenetic.
Ultrasonografijugadapatdilakukanuntukmelihatukurandarikelenjartiroidapakah
mengecil atau tidak.Thyroid radionuclide uptake and scan dapat menegakkan
diagnosis disgenesis tiroid. Yang digunakan adalah iodine123 atau sodium
pertechnetate99muntukmeminimalisisefekradiasi.DilihatdenganUSGapabila
uptakenegativemakateebuktiadadisgenesisdaritiroid.7,8

18

Gambar6.HasilThyroidRadionuclideuptakeandscan7

sumberCongenitalHypotiroidismeRastogiMKet.al
2.6.4Skriningfungsitiroidpadabayibarulahir
Bayidengankecurigaanhipotiroidkongenitalbiasanyadiidentifikasipadamingguke
3setelahkelahiran.
Tabel6.Formdeteksidinisuspekkritin(DDSK)7

19

sumberCongenitalHypotiroidismeRastogiMKet.al
TerdapatsebuahpenelitianyangdialakukanolehSamsudinMet.aldenganjudulnilai
diagnostic indikator fisik dibandingkan baku emas untuk menegakkan diagnosis
terdugakretinpadabatitadidapatkankesimpulandiperolehbahwasensitivitasdan
spesifisitasnyakurangmemadaisehinggaperludilakukanbeberapaperbaikanpada
komponendanskoringnya.7
Gambar.7Alogaritmadiagnostikkongenitalhipotiroid7

sumberCongenitalHypotiroidismeRastogiMKet.al
2.7Penatalaksanaan
Hipotiroidkongenitalmerupakansebabdariretardasimentalyangpalingdapatdi
tatalaksana. Dari penelitian yang dilakukan didapatkan bahwa waktu pengobatan
adalahyangpaling[enting,kapanhipotiroidkongenitalmulaidiobati,haliniakan
berdampakpadaefekneurologisnyadikemudianhari.Semakincepatdiobatisemakin
baikprognosisneurologisnya.Targetdaripengobatanhipotiroidkongenitaliniadalah

20

anakanakyangmenderitahipotiroidkongenitalagardapattumbuhdanberkembang
mendekatinormalanakseusianya.
TerapimedikamentosanyaadalahdenganmenggunakanobatpilihanberupaL
Thyroxine.Pengobataniniharussegeradimulaisetelahbayipositiveterhadaphasil
skriningawal.Obatiniterdapatdalamtigabentukyaitutablet,suspensedandrop.
Namunsuspensejarangdigunakandiamerikakarenadinilaidosisnyatidakadekuat
pada pemberian dengan bentuk suspense. Obat ini tidak boleh diberikan bersama
dengansusuformulaberbasiskedelai,suplemenserat,sucralfatedansuplemenbesi,
Karena akan mengganggu absorbs dari Ltyroxine. Target kadar T4 yang harus
dicapaiadalah>129mmol/L(>10g/L)secepatmungkinangkainiharusdicapai.
Namun dipertimbangkan pula inisial dosisnya, menurut American Academy of
Pediatric (AAP) dan the European Society for Pediatric Endocrinology (ESPE)
adalah1015mcg/kgperhari.7,8
Tabel7.DosisLThyroxine8
Umur

Dosisg/kgBB/hari

03bulan

1015

36bulan

810

612bulan

68

15tahun

56

212tahun

45

>12tahun

23

Targetpengobatannya menurut AAP danESPEadalahserum T4bebas atau total


T4nyaharusdiatasnormalpadausiatahunpertamakehidupanserumT41016
g/Ldan1.42.3ng/dluntukT4bebas.SerumTSHharusdipertahankandibawah
5,U/L.halyangharusdiperhatikanselamapengobatanadalahbeberapabulanpada3
tahunpengobatanharusdilakukanpemeriksaanrutinserumT4,T4bebasdanTSH.
AAPtelahmenganjurkanjadwalsebagaiberikut:7

Duaatauempatminggusetelahterapipertama
Setiapsatusampaiduapada6bulanpertama
Setiap34bulanpada6bulanberikutnyasampaitahunke3
21

Setiap612bulansampaimasapertumbuhanselesai
Setiap4mingguapabiladidapatkanperubahandosis

2.8Prognosis
Prognosis dari hipotiroid dilihat berdasarkan onset dari pengobatan dan IQ yang
dihasilkanratarata.Frenchnationalscreeningprogrammelaporkanbahwaapabila
pengobatan dimulai kurang dari 30 hari kehidupan didapatkan IQ ratarata 109.8
apabiladimulaipengobatanantaraharike22sampai30makadidapatkanIQ107.7,
antara15sampai21harididapatkanIQ115.3dansebelum15harididapatkanIQ
119.2. Selain itu prognosis dapat juga dilihat dari pemberian dosis awalnya pada
penelitianyangdilakukanoleh LaFranchi&Austin tahun2007didapatkansebagai
berikut:7
Tabel.8KadardosisawaldanefekterhadapSerumT4danTSH7

sumberCongenitalHypotiroidismeRastogiMKet.al
Padapenelitianlainjugadisebutkanbahwapadapasienyangmendapatkandosisawal
lebihtinggididapatkanIQrataratayanglebihtinggipula.Prognosishipotiroidjuga
dapatditentukandariseberapaberatetiologinya.BiladidapatkanserumT4awal<3
ug/dLmakadidapatkanprognosisyanglebihburukdibandingdenganyangserumT4
awalnyaadalah>3ug/dL.7

BABIII
KESIMPULAN

22

Diseluruh dunia, prevalensi hipotiroid kongenital diperkirakan mendekati 1:3000


kelahirandengankejadiansangattinggididaerahkekuranganiodium,yaitu1:900
kelahiran,lebihseringterjadipadaanakperempuandenganperbandingan2:1.Angka
kejadianhipotiroidkongenitalbervariasiantarNegara,dipengaruhipulaolehfaktor
etnisdanrasnya.Prevalensicenderunglebihtinggipadaketurunanasiadansangat
jarangpadapopulasikulithitam.
Hipotiroidisme kongenital dapat terjadi secara primer maupun sekunder.
Kausaprimernyaadalahberupagagaltumbuhnyakelenjartiroid,defisiensisintesis
hormontiroiddanterdapatgangguanpadaTSH.85%diNegaradenganasupaniodin
cukup diapatkan hipotiroid kongenital karena tidak tumbuh sempurnanya kelenjar
tiroidsehinggamenyebabkanpermanenkongenitalhipotiroidisme.
Hipotiroid kongenital merupakan sebab dari retardasi mental yang paling
dapat di tatalaksana. Dari penelitian yang dilakukan didapatkan bahwa waktu
pengobatanadalahyangpaling[enting,kapanhipotiroidkongenitalmulaidiobati,hal
iniakanberdampakpadaefekneurologisnyadikemudianhari.Semakincepatdiobati
semakinbaikprognosisneurologisnya.Targetdaripengobatanhipotiroidkongenital
iniadalahanakanakyangmenderitahipotiroidkongenitalagardapattumbuhdan
berkembangmendekatinormalanakseusianya.

DAFTARPUSTAKA

23

1. SituasiDanAnalisisPenyakitTiroid.PusatDataDanInformasiKementrian
KesehatanRI;2015
2. PriceSA,WilsonLM.Patofisiologikonsepklinisprosesprosespenyakit.6 th
ed.Indonesia:SchteingartDE;2006.bab60.Gangguankelenjartiroid;P.1225
31
3. Kumorowulan S, Supadmi S. Kretin Endemik dan Kretin Sporadik
( Hipotiroid kongenital ).Balai penelitian dan Pengembangan GAKI.2010
Desember;Vol.1:1067
4. Sherwood L. Fisiologi Manusia dari sel ke Sistem. 2 nd ed. Indonesia:
SherwoodL;2001.bab19.OrganEndokrinPerifer:P.6449
5. Green JH. Pengantar fisiologi tubuh manusia. 1 st ed. Tangerang:Saputra
L;2009.bab16.Kenjarendokrin:P.323
6. SilbernaglS,LangF.Teks&Atlasberwarnapatofisiologi.1sted.Penerbitbuku
kedokteran:HandayaniS,Faisal;2007.bab9.Hormon:P.280.
7. SamsudinM,kumorowulanS.NilaiDiagnostikIndikatorFisikDibandingkan
BakuEmasUntukMenegakkanDiagnosisTerdugaKretinPadaBatita:2014:
P.114
8. Rastogi MV, LaFranchi SH. Congenital Hypotiroidsm.Orphanet journal of
rarediseases:2010:P122
9. PudjiadiAH,HegarB,HandryastutiS,IdrisNS,GandaputraEP,Harmoniati
ED. Pedoman Pelayanan Medis Ikatan Dokter Anak Indonesia. Indonesia:
2009.HipotiroidKongenital:P.1258.

24