Anda di halaman 1dari 31

Nadia Bella Roselina

1102013197
B-8
TUGAS MANDIRI
Sasaran Belajar
1. Memahami dan menjelaskan genital feminina
1.1 Makroskopis
Genitalia Eksterna :
a. Mons Pubis
Daerah kulit yang menonjol di depan symphisis pubis
Kulit berambut banyak jaringan lemak.
Berisi jaringan lemak, jaringan ikat, pembuluh darah dan saraf-saraf
Meluas ke bwah belakanaglabium mayora.
Rambut kemaluan disebut pubes.

b. Labium Majus Pudendi


Suatu lipatan kulit, ke dorsocaudal berhubungan satu dengan yang lain membentuk
comissura posterior labiorum majorum, sedang yang ke ventrocrainal membentuk comissura
anterior labiorum majora.
Fascia lateralis memiliki rambut dan bnayka pigmen. Sedangkan, fascia medialis mempunyai
gld. Sebacea yang besar dan tidak mempunyai rambut.
Terdapat jaringan pengikat, lemak dan jaringan menyerupai tunica dartos scorti.
Celah yang dibatasi oleh kedua labia majora disebut rima pudendi.
c. Labium Minus Pudendi
Labium minora ke dorsocaudal berhubungan satu dengan yang lain membentuk frenulum
labiorum minorum.
Ke ventrocrainal berhubunan satu dengan yang lain membentuk preputium clitoridis.
Dari labio minora berjalan suatu lipatan kulit ke ventral cranial melekat pada dataran
dorsocaudal glans clitoridis kanan kiri dari linea mediana disebut frenulum clitoridis.
Tidak ada foliculi rambut dan jaringan lemak.
Banyak pembuluh darah.
d. Vestibulum Vaginae
Daerah yang terletak diantara kedua bulbi vestibuli.
Batas-batasnya yaitu kanan dan kiri oleh labia minora, ventrocranial oleh frenulum clitoris,
dan dorsocaudal oleh frenulum labiorum minorum (frenulum labiorum pudendi)
Kedalam veestibulum vaginae bermuara urethra, vagina, gld. Paraurethralis, gld. Vestibularis
minor dan gld. Vestibularis major.
e. Ostium Vaginae
Muara vagina disebut juga introitus vaginae.
Diantara introitus vaginae dan frenulum labiorum minorum terdapat fossa navicularis (fossa
vestibuli vaginae).

Di sebelah kanan dan kiri pada fossa naviculare terdapat saluran kedua glandula Bartholini
bermuara.
f. Clitoris
Terdiri dari ujun poksimal corpus cavernosum clitoridis melekat di dataran medial ramus
inferior osis pubis dengan dataran lateralnya.
Ke ventral kedua crura clitoridis bersatu membentuk corpus clitoridis. Terdapat corpus
cavernosum yang membentuk glans clitoridis.
g. Urethra Feminina
Berjalan dari leher kandung kemih menuju ostium urethrae eksternum yang terletak diantara
clitoris dengan vagina.
Disebelah kanan dan kiri lubang kemih terdapat dua lubang kecil dari saluran yang buntu
( ductus skene atau ductus parauretralis).
h. Perineum
Merupakan area berbentuk belah ketupat
Dibagi oleh ramus inferior ossis pubis dan ramus ossis ischii kanan dan kiri dan kedua lig.
Sacrotuberale.
Terbagi menjadi regio urogenitalis di anterior (ventral) dan regio analis di posterior (dorsal).

Gambar 1. Genitalia Eksterna Wanita


Sumber : http://uncennursing.blogspot.com/2011/06/sistem-reproduksi-perkembangbiakan.html

Genitalia Interna :
Gambar 2. Genitalia Interna Wanita

Gambar 3. Genitalia Interna Wanita


Sumber : http://kelas-bidan.blogspot.com/2011/04/anatomi-fisiologi-organ-reproduksi.html
1. Ovarium

Terletak di dalam pelvis dan jumlahnya sepasang


Berbentuk bulat memanjang, agak pipih
Terdiri dari coretx dan medulla (berisi pembuluh darah, limfe dan saraf)
Dilekatkan oleh mesovarium pada ligamentum latum (berupa lipatan peritoneum sebelah kiri
dan kanan uterus. Meluas sampai dinding panggul dan dasr panggul)
Difiksasi oleh :
- Ligamentum suspensorium ovarii (Lig.infudibulopelvicum) :
Ligamentum ini menggantungkan uterus pada dinding panggul antara sudut tuba
- Ligamentum ovarii propium : menfiksasi ovarium ke uterus.
- Ligamentum teres uteri (lig. Rotundum) : terdapat di bagian atas lateral dari uterus,
caudal dari tuba kedua ligamentum ini melalui canalis inguinalis ke bagian cranial labium
majus.
2. Tuba Uterina (salpinx)

Jumlahnya sepasang kanan dan kiri dengan panjang 10 cm.


Menjulur dari uterus kearah ovarium dengan ujung distal terbuka kedalam rongga
peritoneum disebut ostium abdominale.
Terdiri dari :
- Infudibulum bangunan yang berbentuk seperti corong

Ampula, bangunan yang membesar dan tempat terjadinya fertilisasi.


Isthmus, bangunan ynag menyempit.
Pars uterina tubae ialah bagian yang melalui dinding uterus.
Ostium uterinum yaitu pintu muara tuba di dalam uterus.

3. Uterus

Organ muscular, berbentuk peer, dibedakan menjadi :


Fascia vesicalis, di dataran ventral menghadap ke vesica urinaria.
Fascia intestinalis, di dataran dorsal menghadap ke usus.
Margo lateralis kanan dan kiri.
Uterus dapat dibagi dalam :
- Fundus uteri, yang terletak pada bagian atas (proksimal ) osteum tuba uterina.
- Corpus uteri, terletak pada bagian tengah uterus yang berbentuk bulat melebar. Batas
antara corpus uteri dan cervix uteri dibentuk oleh isthmus. Sebelum memasuki cervix
terdapat ostium uteri internum.
- Cervix uteri, bagian yang paling sempit dan menonjol kedalam rongga vagina. Pada
bagian ujung distal cervix terdapat banguna ynag menyempit disebut ostium uteri
externum. Rongga di dalam cervix uteri disebut canalis cervix.
4. Vagina

Berbentuk tabung muskular.


Panjangnya antara 8-12 cm.
Bagian distal cervix menonjol ke dalam rongga vagina, disebut portio vaginalis cervicis uteri.
Bagian cervix proksimalnya disebut portio supravaginalis cervicis uteri.

Rongga vagina yang mengelilingi portio vaginalis cervicis disebut fornix yang terbagi
menjadi :
- Fornix lateralis dextra dan sinistra
- Fornix anterior dan posterior
Tunica mucosa membentuk rugae yang transversal pada dinding ventral dan dorsal disebut
columna rugarum.
Pada virgo intacta introitus vaginae sebagian ditutupi oleh selaput disebut hymen.

Bentuk hymen :
- Hymen anularis (cincin)
- Hymen seminularis (bulan sabit)
- Hymen cribriformis (berlubang-lubang seperti saringan)
- Hymen fimbriatus (dengan tepi seperti jari-jari)

Hymen imperforatus (tidak berlubang)


Gambar 4. Bentuk-bentuk hymen

5. Jaringan penunjang
a. Ligamentum cardinale sinistra dan dekstra (Mackendrot)
Ligamentum terpenting untuk menahan uterus agar tidak turun.
Berjalan dari cerviks dan puncak vagina ke arah lateral dinding pelvis.
b. Ligamentum sakrouterinum sinistra dan dextra
Menahan uterus agar tidak banyak bergerak
Berjalan melengkung dari dorsal cerviks melalui dinding rectum ke arah os sakrum.
c. Ligamentum rotundum sinistra dan dextra
Menahan uterus dalam antefleksi
d. Ligamentum pubivesikale sinistra dan dextra
Berjalan dari os pubis melalui kandung kemih dan seterusnya sebagai ligamentum
vesikouterinum ke cerviks.
e. Ligamentum latum sinistra dan dextra
Berjalan dari uterus ke arah lateral dan tidak banyak mengandung jaringan ikat.
Merupakan bagian dari peritoneum viscerale yang meliputi uterus dan kedua tuba dan
berbentuk sebagai lipatan.
f. Ligamentum infundibulopelvikum
Menahan tuba falopi.
Berjalan dari arah infundibulum ke dinding pelvis.
g. Ligamentum ovarii proprium sinistra dan dextra
Berjalan dari sudut kiri dan kanan fundus uteri ke ovarium.
DIAPHRAGMA PELVIS
1. Pelvis mayor : berisi saluran cerna, VU, ureter, sistem genitalis
2. Pelvis minor
- PAP (aditus pelvis)
Dibentuk oleh : promontorium, linea terminalis, ala osis sacralis, dan supra pubis.

a. Conjugate vera : ukuran antero posterior


Jarak antara pinggir atas pubis sampai promontorium, penting untuk menentukan
dapat todaknya bayi melewati sehingga dapat menentukan tindak lanjut persalinan
pervaginam atau section secaria.
Dengan bantuan conjugate diagonalis (diukur dengan vaginal touch) sampai
promontorium. Conjugate diagonalis(12,5 cm) 1,5 = 11-13cm
b. Conjugate transversa : diukur dari titik terjauh linea terminalis kiri dan kanan tegak
lurus dengan conjugate vera. 13-14,5 cm.
c. Conjugate obstetrica : jarak antara promontorium ke pinggir tengah simpisis pubis.
Bagian aditus pelvis yang paling sempit, 10,6 cm.
-

Mid pelvis
Dibentuk oleh : apex arcus pubis, spina ischiadica, ujung os.sacrum.
Paling sempit, bentuk oval, sering terjadi kemacetan pada persalinan.
Ukuran yang penting :
a. Anteroposterior : tepi bawah simp.pubis sampai pertengahan os.sacrum 4. 11,5-12
cm.
b. Transversa : spina ischiadica kanan kiri. 10-10,5 cm
c. Sagittal : anteroposterior dengan
potongan transversa
-

PBP (exitus pelvis)


a. Anteroposterior : 9,5-11,5 cm
b. Transversa : tuber ischiadicum kanan
kiri. 10,5-11 cm
c. Sagitalis posterior : ujung os sacrum
dengan
perpotongan
antara
anteroposterior
dengantransversa.10,5-11cm.

Bidang Hodge: untuk menentukan petunjuk


turunnya bagian bawah fetus.
Hodge I : bidang yang sama dengan PAP
Hodge II : sejajar H I setinggi pinggir bawah
sim.pubis
Hodge III : sejajar H I melalui spina ischiadica
Hodge IV : sejajar H I setinggi ujung os sacrum

Gambar 5. Diaphragma Pelvis


Perdarahan :
Arteri iliaca interna -> arteri uterina -> arteri vaginalis. Arteri vaginalis ke arah fundus kemudian
bercabang menjadi :
a. R.ovaricus melalui ligamentum ovarii proprium menuju ovarium
b. A. Ligamenti teretis uteri, mengikuti lig. Teres uteri
c. R. Tubarius mengikuti tuba uterina.
Persarafan :
N.pudendus untuk persarafan genitalia eksterna , n.pudendus masuk ke foramen ischiadicum
sebagai n. Clitoridis. Cabang yang lain: n.hemorrhoidalis inferior utnuk m.spinchter ani externus
dan ke kulit regio analis. N. Perianalis berkahir sebagai n.labialis untuk labium majus. Plexus
hypogastricus superior dan inferior untuk persarafan genitalia interna.
Pembuluh lympe:
Bagaian proximal mengikuti kembali r.vaginalis a. Uternae ke lnn. Illiaci interni.
Bagian medial mengikuti kembali r.Vaginali a.Vesicalis inferior ke Inn sepanjang a.Vesicalis
inferior ke Inn. Illiaca interni.
Bagian dari vagina distal, dinding vestibulum vaginae, labia minora, labia major.
1.2 Mikroskopis
Ovarium :
Epitel sel kuboid rendah atau gepeng yaitu epitel germinal
Dibawah epitel germinal adalah jaringan ikat padat yang disebut tunika albuginea.
Ovarium memiliki :
- Korteks di tepi : folikel-folikel, fibrosit dengan serat kolagen dan retikular.
- Medulla di tengah : pembuluh darah,saraf dan pembuluh limfe.
Folikel primordial : folikel terdiri dari oosit primer yang diliputi sel folikel gepeng.
Folikel primer : sel folikel mulai bentuk kuboid, tidak ada ruang berisi liqour foliculi dan
zona pelusida terbentuk pada akhir fase folikel primer
Folikel sekunder : epitel berlapis kuboid, stroma membentuk teka folikel yaitu teka interna
dan teka eksterna, terbentuk zona pelusida
Folikel tersier : ruang-ruang follicle bersatu membentuk antrum folliculi yang berisi cairan,
sel telur terdeak ke tepi terletak di atas gundukan sel follicular disebut cumulus oophorus.
Folikel yang mengalami atresia pada semua tahap perkembangan folikel menajdi folikel
atretik.
Ovum : ovum dikelilingi sel granulosa yang membentuk bukit kecil yaitu kumulus ooforus.
Satu lapisan sel granulosa yang berdekatan dengan oosit primer membentuk korona radiata.
Di antara korona radiata dan sitoplasma oosit primer adalah glikoprotein terpulas asidofilik
disebut zona pellusida.
Corpus luteum : sel granulosa hipertropi, bentuknya berubah menjadi pilyhedral, inti
membesar dengan sitoplasma dipenuhi oleh lipd. Terdapat sel lutein granulosa yang
berpigmen kuning dan sel lutein theca.

Corpus albicans : corpus luteum yang berdegenerasi karena tidak terjadi kehamilan. Corpus
albicans bersifat aselular dan dipenuhi serat hialin.

Ovarium

corpus luteum

Tuba Uterina :
Epitel selapis silindris bersilia (epitheliocytus ciliatus) dan tidak bersilia (sel sekretorik)
Sel bersilia menciptakan arus ke arah uterus dan menjadi predominan dalam fase proliperatif.
Sel sekretorik menghasilkan nutrisi
Mukosa terdiri dari banyak plica dan membentuk lumen yang tidak rata.

Tuba Uterina

Epitel Tuba Uterina

Uterus
Dinding luar yaitu perimetrium, tengah miometrium dan sebelah dalam endometrium.
Endometrium dilapisi oleh epitel selapis silindris.Dibagi dalam dua lapisan yaitu stratum
basale dan stratum functionale
Terdapat kelenjar uterus di lamina propia.
Terdapat arteri spiralis di endometrium.
Miometrium terdiri dari otot polos, dipisahkan oleh jaringan ikat interstisial dengan banyak
pembuluh darah .

Uterus

pot.
Uterus

Serviks, Kanalis dan Forniks Vagina


Kanalis servikalis dilapisi oleh epitel kolumner tinggi penghasil mukus.
Epitel serviks dilapisi oleh kelenjar serviks ke dalam lamina propia.
Kelenajar serviks yang tersumbat dan berkembang menjadi kista glandular.
Jaringan ikat di lamina propria serviks lebih fibrosa daripada di uterus.
Porsio vagina dilapisi epitel berlapis gepeng tanpa tanduk.

melintang

Vagina
Dilapisi epitel berlapis gepeng tanpa lapisan tanduk.
Lamina propria tidak memiliki kelenjar tetapi mengandung banyak pembuluh darah dan
lomfosit.

2. Memahami dan menjelaskan keputihan


2.1 Definisi
Keputihan sudah menjadi masalah yang banyak ditemui para wanita. Diperkirakan 75%
wanita Indonesia pernah mengalami keputihan sekali dalam hidupnya. Kebanyakan
wanita Indonesia menganggap keputihan sebagai sesuatu yang lumrah terjadi pada
wanita. Secara definisi keputihan adalah keluarnya sekret dari vagina. Sekret tersebut
dapat bervariasi dalam konsistensi, warna dan bau. Keadaan ini dapat bersifat fisiologis
atau patologis.
Leukorea adalah sekret berwarna putih dan kental dari vagina dan rongga uterus (dorland,
2010). Vagina yang normal selalu berada dalam kondisi lembab dan permukaannya
basah oleh cairan/lendir. Sekret diproduksi oleh kelenjar pada leher rahim (serviks),
dinding vagina dan kelenjar bartholin dibibir kemaluan, menyatu dengan sel-sel dinding
vagina yang lepas serta bakteri normal didalam vagina, bersifat asam.
2.2 Epidemiologi
Dalam dunia kedokteran, keputihan (fluor albus) adalah keluarnya cairan selain darah
dari liang vagina diluar kebiasaan, baik berbau ataupun tidak, serta rasa gatal setempat
(Kusmiran, 2012). Penyebab terbanyak keputihan (fluor albus) di RSU Dr.Kariadi
Semarang pada tahun 19982002 adalah mikroorganisme tak patologis (36,6%),
mikroorganisme patologis tunggal yakni Candida ( 31,6%), Gardnerela (17,6%),
Trikomonas (6,7%), dan gonokokus (0,9%). Usia terbanyak yang menderita keputihan
(fluor albus) patologis dengan penyebab mikroorganisme patologis tunggal adalah usia
reproduksi sehat (59,8%) dan paritas terbanyak adalah paritas 0 (62,0%), status menikah
adalah yang terbanyak (44,5%), tingkat pendidikan yang terbanyak adalah tinggi
(62,0%), diagnosis klinis terbanyak adalah vaginitis (54,9%) (Ramayanti, 2004).
2.3 Klasifikasi
Flour Albus Fisiologis
Normalnya hanya ditemukan pada daerah porsio vagina.

Gejala : cairan vagina jernih, tidak berwarna, tidak gatal, dan jumlah cairan biasanya
sedikit.
Etiologi : timbul dalam keadaan ovulasi, saat menjelang atau setelah menstruasi
akibat rangsangan seksual, saat wanita hamil dan dalam keadaan stress
Biasanya ditemukan pada : waktu sekitar ovulasi, dengan sekret dari kelenjar
kelenjar serviks uteri menjadi lebih encer, waktu disekitar menarche karena mulai
terdapat pengaruh estrogen.

Keputihan terbagi menjadi dua, yaitu keputihan yang patologis dan keputihan yang
fisiologis. Keputihan yang fisiologis dapat timbul saat terjadi perubahan siklus hormonal,
seperti sebelum pubertas, stress psikologis, sebelum dan setelah datang bulan, kehamilan,
saat menggunakan kontrasepsi hormonal, atau saat menopause. Ciri-ciri dari cairan lendir
keputihan yang fisiologis adalah berwarna bening encer, tidak berbau, tidak gatal dan
tidak menimbulkan keluhan.
Flour Albus Patologis
Gejala : cairan dari vagina keruh dan kental, warna tergantung dari kuman yang
menginfeksi, berbau busuk, terasa gatal, dan jumlah cairan banyak.
Etiologi : infeksi daerah genital dapat juga disebabkan oleh sakit yang lama, kurang
gizi dan anemia, kuman penyebabnya dapat berupa jamur (Candida Albicans), bakteri
(kuman E.Coli, Staphylococcus), protozoa (Trichomonas Vaginalis).
Sekret patalogiknya biasanya terdapat pada dinding vlateral dan anterior vagina.
Penyebab lain, selain karenan infeksi. Bisa juga terjadi karena iritasi (sabun cuci dan
pelembut pakaian, cairan antiseptic untuk mandi, permbersih vagina, celana yang
ketat atau tidak menyerap keringat). Karena Tumor atau jaringan abnormal lain,
radiasi.
Keputihan yang patologis merupakan keputihan yang tidak normal yang terjadi karena
infeksi pada vagina, adanya benda asing pada vagina atau adanya keganasan. Infeksi bisa
diakibatkan karena virus, bakteri, jamur dan parasit. Dapat pula di sebabkan oleh karena
iritasi saat berhubungan seks, penggunaan tampon dan alat kontrasepsi. Keputihan ini
berupa cairan berwarna kekuningan hingga kehijauan, jumlahnya banyak bahkan sampai
keluar dari selana dalam, kenatal, lengket, berbau sangat tidak sedap, menimbulkan gatal
yang sangat hebat dan panas, dan dapat menimbulkan luka didaerah mulut vagina.
Keputihan yang patologis seperti ini yang harus diwaspadai, karena dapat menjadi salah
satu indikasi gejala adanya kanker serviks, maka dari itu harus dicari penyebab dan
obatnya secara adekuat sejak dini.
2.4 Etiologi
Fluor albus fisiologik pada perempuan normalnya hanya ditemukan pada daerah porsio
vagina. Sekret patologik biasanya terdapat pada dinding lateral dan anterior vagina.
Fluor albus fisiologik ditemukan pada :
Bayi baru lahir sampai umur kira-kira 10 hari, disini sebabnya ialah pengaruh
estrogen dari plasenta terhadap uterus dan vagina janin.
Menjelang atau setelah haid.
Wanita dewasa apabila dirangsang sebelum dan pada waktu koitus, disebabkan oleh
pengeluaran transudasi dari dinding vagina. Hal ini berkaitan dengan kesiapan vagina
untuk menerima penetrasi pada senggama.
Ovulasi, sekret dari kelenjar-kelenjar serviks uteri menjadi lebih encer.

Kehamilan
Stres, kelelahan
Pemakaian Kontrasepsi Hormonal
Pengeluaran sekret dari kelenjar serviks uteri juga bertambah pada wanita dengan
penyakit menahun, dan pada wanita dengan ektropion porsionis uteri.

Sedangkan fluor albus abnormal (patologik) disebabkan oleh:


Infeksi
a. Bakteri :

Gonococcus

Penyebab Gonococcus adalah coccus gram negative Neisseria gonorrhoeae ditemukan oleh
Neisser in 1879. N. gonorrhoeae adalah diplokok berbentuk biji kopi, bakteri yang tidak dapat
bergerak, tidak memiliki spora, jenis diplokokkus gram negatif dengan ukuran 0,8 1,6 mikro,
bersifat tahan asam. Bakteri gonokokkus tidak tahan terhadap kelembaban, yang cenderung
mempengaruhi transmisi seksual. Bakteri ini bersifat tahan terhadap oksigen tetapi biasanya
memerlukan 2-10% CO2 dalam pertumbuhannya di atmosfer. Bakteri ini membutuhkan zat besi
untuk tumbuh dan mendapatkannya melalui transferin, laktoferin dan hemoglobin. Organisme ini
tidak dapat hidup pada daerah kering dan suhu rendah, tumbuh optimal pada suhu 35-37C dan
pH 7.2-8.5 untuk pertumbuhan yang optimal.
Pada sediaan langsung dengan gram bersifat tahan asam. Pada sediaan langsung dengan
pewarnaan gram bersifat gram negative, terlihat diluar dan dalam leukosit, kuman ini tidak tahan
lama diudara bebas, cepat mati dalam keadaan kering, dan tidak tahan zat desinfektan
Secara morfologik gonokok terdiri atas 4 tipe, yaitu tipe 1 dan 2 yang mempunyai pili dan
bersifat virulen, serta 3 dan 4 yang tidak mempunyai pili dan bersifat nonvirulen. Pili akan
melekat pada mukosa epitel dan akan menyebabkan reaksi radang. Organisme ini menyerang
membran mukosa, khususnya epitel kolumnar yang terdapat pada uretra, servik uteri, rectum,
dan konjungtiva.Gambaran tersebut dapat terlihat pada pemeriksaan Pap Smear, tetapi biasanya
bakteri ini diketahui pada pemeriksaan sedian apus dengan pewarnaan Gram. Cara penularan
penyakit ini adalah dengan senggama.
Chlamidia trachomatis
Bakteri ini sering menyebabkan penyakit mata yang dikenal dengan penyakit traukoma. Bakteri
ini juga dapat ditemukan pada cairan vagina yang berwarna kuning seperti pus. Sering kencing
dan terdapat perdarahan vagina yang abnormal.
Dan terlihat melalui mikroskop setelah diwarnai dengan pewarnaan Giemsa. Bakteri ini
membentuk suatu badan inklusi yang berada dalam sitoplasma sel-sel vagina.
Pada pemeriksaan Pap Smear sukar ditemukan adanya perubahan sel akibat infeksi clamidia ini
karena siklus hidupnya tidak mudah dilacak.
Gardanerrella vaginalis
Gardanerrella menyebabkan peradangan vagina yang tidak spesifik dan kadang dianggap sebagai
bagian dari mikroorganisme normal dalam vagina karena seringnya ditemukan. Bakteri ini
biasanya mengisi penuh sel epitel vagina dengan membentuk bentukan khas dan disebut clue
cell. Pertumbuhan yang optimal pada pH 5.0-6.5.
Gardanerrella menghasilkan asam amino yang diubah menjadi senyawa amin yang menimbulkan
bau amis seperti ikan.
Treponema Pallidum (Spirochaeta pallida)

Bakteri ini merupakan penyebab penyakit sifilis. Pada perkembangan penyakit dapat terlihat
sebagai kutil-kutil kecil di vulva dan vagina yang disebut kondiloma lata. Bakteri berbentuk
spiral P: 6 15 , L: 0,25 , lilitan: 9 24 dan tampak bergerak aktif (gerak maju & mundur,
Berotasi undulasi sisi ke sisi) pada pemeriksaan mikroskopis lapangan gelap.
Mati pada kekeringan, panas, antiseptik ringan, hidup beberapa lama di luar tubuh. Penularan
dapat secara kontak langsung yaitu melalui coital STD dan dapat juga melalui non-coital
(jarum suntik) sulit terjadi.
b. Jamur

Candida albicans

Cairan yang dikeluarkan biasanya kental, berwarna putih


susu seperti susu pecah atau seperti keju, dan sering disertai
gatal, vagina tampak kemerahan akibat proses peradangan.
Dengan KOH 10% tampak sel ragi (blastospora) dan hifa
semu (pseudohifa).
Beberapa keadaan yang dapat merupakan tempat yang
subur bagi pertumbuhan jamur ini adalah kehamilan,
diabetes mellitus, pemakai pil kontrasepsi. Pasangan
penderita juga biasanya akan menderita penyakit jamur ini.
Keadaan yang saling menularkan antara pasangan suami-istri disebut sebagai phenomena pingpong.
c. Parasit
Trichomonas vaginalis
Parasit ini berbetuk lonjong dan mempuyai bulu getar dan dapat bergerak berputar-putar dengan
cepat. Gerakan ini dapat dipantau dengan mikroskop.
Cara penularan penyakit ini dengan senggama. Walaupun jarang dapat juga ditularkan melalui
perlengkapan mandi, seperti handuk atau bibir kloset.
d. Virus
Virus Herpes simpleks
Virus herpes yang paling sering > 95% adalah virus herpes simpleks tipe 2 yang merupakan
penyakit yang ditularakan melalui senggama. Namun 15-35% dapat juga disebabkan virus herpes
simpleks tipe 1.Pada awal infeksi tampak kelainan kulit seperti melepuh seperti terkena air panas
yang kemudian pecah dan meimbulkan luka seperti borok. Pasien merasa kesakitan.

Gambar 15. Herpes Virus


sumber : http://www.oculist.net/downaton502/prof/ebook/duanes/pages/v4/v4c019.html

Human Papilloma Virus

Papovavirus merupakan virus kecil ( diameter 45-55 nm ) yang mempunyai genom beruntai
ganda yang sirkuler diliputi oleh kapsid (kapsid ini berperan pada tempat infeksi pada sel) yang
tidak berpembungkus menunjukkan bentuk simetri ikosahedral. Berkembang biak pada inti sel.
Human Papilloma Virus merupakan penyebab dari kondiloma
akuminata. Kondiloma ditandai dengan tumbuhnya kutil-kutil
yang kadang sangat banyak dan dapat bersatu membentuk
jengger ayam berukuran besar.
Cairan di vagina sering berbau tanpa rasa gatal. Penyakit ini
ditularkan melalui senggama dengan gambaran klinis menjadi
lebih buruk bila disertai gangguan sistem imun tubuh seperti
pada kehamilan, pemakain steroid yang lama seperti pada
pasien dengan gagal ginjal atau setelah transplantasi ginjal,
serta penderita HIV AIDS.

Iritasi
1 Sperma, pelicin, kondom
2 Sabun cuci dan pelembut pakaian
3 Deodorant dan sabun
4 Cairan antiseptic untuk mandi.
5 Pembersih vagina.
6 Celana yang ketat dan tidak menyerap keringat
7 Kertas tisu toilet yang berwarna.
Tumor dan Jaringan Abnormal
Tumor atau kanker akan menyebabkan fluor albus patologis akibat gangguan pertumbuhan sel
normal yang berlebihan sehingga menyebabkan sel bertumbuh sangat cepat secara abnormal dan
mudah rusak, akibatnya terjadi pembusukan dan perdarahan akibat pecahnya pembuluh darah
yang bertambah untuk memberikan makanan dan O2 pada sel tumor atau kanker tersebut.
Pada keadaan seperti ini akan terjadi pengeluaran cairan yang banyak dan berbau busuk akibat
terjadinya proses pembusukan tersebut dan sering kali disertai adanya darah yang tidak segar.
Benda Asing
Adanya benda asing seperti tertinggalnya kondom atau benda tertentu yang dipakai sewaktu
senggama, adanya cincin pesarium yang digunakan wanita dengan prolapsus uteri dapat
merangsang pengeluaran caian vagina secara berlebihan. Jika rangsangan ini menimbulkan luka
akan sangat mungkin terjadi infeksi penyerta dari flora normal yang berada dalam vagina
sehingga timbul fluor albus.
Penyebab Lain
1 Psikologi : Volvovaginitis psikosomatik
2

Tidak diketahui : Desquamative inflammatory vaginitis


2.5 Patofisiologi

Meskipun banyak variasi warna, konsistensi, dan jumlah dari sekret vagina bisa
dikatakan suatu yang normal, tetapi perubahan itu selalu diinterpretasikan penderita
sebagai suatu infeksi, khususnya disebabkan oleh jamur. Beberapa perempuan pun
mempunyai sekret vagina yang banyak sekali. Dalam kondisi normal, cairan yang keluar
dari vagina mengandung sekret vagina, sel-sel vagina yang terlepas dan mucus serviks,
yang akan bervariasi karena umur, siklus menstruasi, kehamilan, penggunaan pil KB.
Lingkungan vagina yang normal ditandai adanya suatu hubungan yang dinamis antara
Lactobacillus acidophilus dengan flora endogen lain, estrogen, glikogen, pH vagina dan
hasil metabolit lain. Lactobacillus acidophilus menghasilkan endogen peroksida yang
toksik terhadap bakteri pathogen. Karena aksi dari estrogen pada epitel vagina, produksi
glikogen, lactobacillus (Doderlein) dan produksi asam laktat yang menghasilkan pH
vagina yang rendah sampai 3,8-4,5 dan pada level ini dapat menghambat pertumbuhan
bakteri lain.
Kandidiasis vaginalis merupakan infeksi vagina yang disebabkan oleh Candida sp.
terutama C. albicans. Infeksi Candida terjadi karena perubahan kondisi vagina. Sel ragi
akan berkompetisi dengan flora normal sehingga terjadi kandidiasis. Hal-hal yang
mempermudah pertumbuhan ragi adalah penggunaan antibiotik yang berspektrum luas,
penggunaan kontrasepsi, kadar estrogen yang tinggi, kehamilan, diabetes yang tidak
terkontrol, pemakaian pakaian ketat, pasangan seksual baru dan frekuensi seksual yang
tinggi. Perubahan lingkungan vagina seperti peningkatan produksi glikogen saat
kehamilan atau peningkatan hormon esterogen dan progesterone karena kontrasepsi oral
menyebabkan perlekatan Candida albicans pada sel epitel vagina dan merupakan media
bagi prtumbuhan jamur. Candida albicans berkembang dengan baik pada lingkungan pH
5-6,5. Perubahan ini bisa asimtomatis atau sampai sampai menimbulkan gejala infeksi.
Penggunaan obat immunosupresan juga menajdi faktor predisposisi kandidiasis vaginalis.
Pada penderita dengan Trikomoniasis, perubahan kadar estrogen dan progesterone
menyebabkan peningkatan pH vagina dan kadar glikogen sehingga berpotensi bagi
pertumbuhan dan virulensi dari Trichomonas vaginalis.
Vaginitis sering disebabkan karena flora normal vagina berubah karena pengaruh bakteri
patogen atau adanya perubahan dari lingkungan vagina sehingga bakteri patogen itu
mengalami proliferasi. Antibiotik kontrasepsi, hubungan seksual, stres dan hormon dapat
merubah lingkungan vagina tersebut dan memacu pertumbuhan bakteri patogen. Pada
vaginosis bacterial, diyakini bahwa faktor-faktor itu dapat menurunkan jumlah hidrogen
peroksida yang dihasilkan oleh Lactobacillus acidophilus sehingga terjadi perubahan pH
dan memacu pertumbuhan Gardnerella vaginalis, Mycoplasma hominis dan Mobiluncus
yang normalnya dapat dihambat. Organisme ini menghasilkan produk metabolit misalnya
amin, yang menaikkan pH vagina dan menyebabkan pelepasan sel-sel vagina. Amin juga
merupakan penyebab timbulnya bau pada flour albus pada vaginosis bacterial.
Flour albus mungkin juga didapati pada perempuan yang menderita tuberculosis, anemia,
menstruasi, infestasi cacing yang berulang, juga pada perempuan dengan keadaan umum
yang jelek , higiene yang buruk dan pada perempuan yang sering menggunakan
pembersih vagina, disinfektan yang kuat.
Pada keadaan normal, cairan/sekret yang keluar dari vagina wanita dewasa sebelum
menopause terdiri dari sel epitel vagina (terutama yang paling luar/superfisial yang
terkelupas dan dilepaskan ke dalam rongga vagina), beberapa sel darah putih (leukosit),
cairan transudasi dari dinding vagina, sekresi dari endoserviks berupa mukus, sekresi
darri saluran yang lebih atas dalam jumlah yang bervariasi serta mengandung berbagai
organisme terutama Lactobasilus Doderlein (batang gram positif, flora vagina terbanyak);
beberapa jenis bakteri lain kokus seperti Streptokokus dan Stapilokokus, dan Eschericia
coli.

Peranan basil doderlein dianggap menekan pertumbuhan mikroorganisme patologis


karena basil Doderlein mempunyai kemampuan mengubah glikogen dari epitel vagina
yang terlepas menjadi asam laktat, sehingga vagina tetap dalam keadaan asam dengan pH
3,0-4,5 pada wanita dalam masa reproduksi. Suasana asam inilah yang mencegah
tumbuhnya mirkoorganisme patologis.

Bila terjadi suatu ketidakseimbangan suasana flora vagina yang disebabkan oleh beberapa
faktor maka terjadi penurunan fungsi basil Doderlein dengan berkurangnya jumlah
glikogen karena fungsi proteksi basil Doderlein berkurang maka terjadi aktivitas dari
mikroorganisme patologis yang selama ini ditekan oleh flora normal vagina. Progresifitas
mikroorganisme patologis secara klinis akan memberikan suatu reaksi inflamasi di daerah
vagina. Sistem imun tubuh akan bekerja membantu fungsi dari basil Doderlein sehingga
terjadi pengeluaran lekosit PMN maka terjadilah fluor albus.
2.6 Manifestasi klinis
Penyebab

Gejala Klinis

Pendekatan Diagnosis

Anak-anak
Benda asing (biasanya Keluar cairan dari vagina dengan bau Evaluasi klinis
kertas tissue
busuk dan bercak vagina
Infeksi(misalnya
Pruritus, keputihan dengan eritema dan
Candida,
cacing pembengkakan vulva, sering kali
kremi,streptokokus,staf dengan dysuria.
ilokokus)
Memburuknya pruritus pada malam
hari (menunjukkan infeksi cacing
kremi)
Signifikan eritema dan edema vulva
dengan discharge (menunjukkan infeksi
streptokokus atau stafilokokus)

Pemeriksaan mikroskopis dari


cairan vagina untuk ragi dan
hifa
dan
kultur
untuk
konfirmasi
Pemeriksaan vukva dan anus
untuk cacing kremi

Pelecehan seksual

Nyeri vulvovagina, vagina berdarah Evaluasi kinis


atau cairan vagina berbau busuk.
Kultur seksual
Seringkali,keluhan medis samar-samar
untuk
dan nonspesifik (misalnya kelelahan, Langkah-langkah
nyeri perut) atau perubahan perilaku memastikan keselamatan anak
dan laporan pada pihak yang
(misalnya amarah)
berwenang jika kekerasan
diduga

Wanita usia reproduktif


Vaginosis bakterial

Infeksi Kandidiasis

Bau busuk(amis), discharge vagina Kriteria diagnosis (3 dari 4) :


abu-abu tipis dengan pruritus dab
- Discharge vagina abu-abu
iritasi.
- pH sekresi vagina >4,5
Eritema dan edema tidak biasa
- Bau amis
- Clue cell terlihat selama
pemeriksaan mikroskopis
Infeksi candida vulva dan iritasi Evaluasi klinis ditambah
vagina,edema, pruritus.
Discharge yang menyerupai keju - pH vagina <4,5
cottage dan melekat pada dinding - Ragi atau hifa diidentifikasi
pada preparat basah atau
vagina.
KOH
Kadang-kadang memburuknya gejala
Kadang-kadang kultur
setelah hubungan seksual dan sebelum
menstruasi

Infeksi Trikomonas

Cairan kuning-hijau, vagina berbusa Organisme mortil, berbentuk


sering dengan nyeri, eritema dan edema buah pir memiliki flagel dilihat
dari vulva dan vagina
selama
pemeriksaan
mikroskopis.
Kadang-kadang sisuria dan dispareinia
Uji diagnostic cepat untuk
Kadang-kadang belanh, bintik-bintik Trichomonas(jika tersedia)
merah strawberry di dinding vagina
atau serviks

Benda asing

Cairan sangatberbau busuk dan sering Evaluasi klinis


berlimpah, eritema vagina, dysuria dan
kadang-kadang dyspareunia
Obyek terlihat selama pemeriksaan

Semua umur
Reaksi hipersensitivitas

Vulvovaginal eritema, edema,pruritus Evaluasi klinis dan hindari


(sering intens), keputihan
penyebab
Riwayat
penggunaan
semprotan
kebersihan atau parfum, air mandi
aditif, pengobatan topical untuk infeksi
candida, pelembut kain, pemutih, atau

sabun cuci
Infalamasi (misalnya Keputihan
purulent,
dyspareunia,
radiasi
dsiuria, iritasi
pelvis,ooferoktomi,
Kadang-kadang pruritus, eritema, nyeri
kemoterapi)
terbakar, perdarahan ringan
Jaringan vagina,tipis

Diagnosis
ekslusi
berdasarkanfaktor-faktor
riwayat dan risiko
pH vagina >6
Uji Whiff negative
Granulosit dan sel parabasal
dilihat selama pemeriksaan
mikroskopis

Fistula
enterik Vagina cairan berbau busuk dengan Visualisasi
langsung
atau
(komplikasi persalnan, berlalunya feses dari vagina
palpasi fistula di bagian bawah
operasi
panggul,atau
vagina
penyakit
inflamasi
usus)

2.7 Diagnosis dan diagnosis banding


Diagnosis
1. Anamnesis
Usia, jumlah, masa inkubasi/lama terjadinya, paparan PHS, pemakaian antibiotic
(kortikostreroid), hubungan dengan menstruasi ovulasi dan kehamilan, antibiotic vaginal touche,
warna, iritatisi : infeksi, benda asing, neoplasma. Pruritus : T.vaginalis/ C.albikans. penyakit
sistemik, pil KB.
2. Pemeriksaan fisik :
Inspeksi kulit perut bawah terutama perineum dan anus, inspeksi rambut pubis, inspeksi dan
palpasi genitalia eksterna, pemeriksaan speculum untuk vagina dan serviks, pemeriksaan
bimanual pelvis, palpasi pembesaran KGB inguinal dan femoral.
3. Pemeriksaan penunjang
Nilai sekresi dinding vagina (warna, konsistensi, bau), kertas indicator PH (n=4-4,5), swab untuk
pemeriksaan dengan larutan garam fisiologis dan KOH 10%, kultur (pila perlu), pewarnaan
gram, serologi sifilis, tes PAP.
Diagnosis penyebab infeksi:
1. Trikomoniasis
-

Anamnesis:
sering tidak menunjukkan keluhan , kalau ada biasanya berupa duh tubuh vagina yang
banyakmdan baerbau maupun dispareunia, perdarahan pasca coitus dan perdarahan
intermestrual. Jumlah lekore banyak, berbau, menimbulkan iritasi dan gatal.Warna sekret
putih, kuning atau purulen.Konsistensi homogen, basah, frothy atau berbusa
(foamy).Terdapat eritem dan edema pada vulva disertai dengan ekskoriasi.Sekitar 2-5%
tampak strawberry servix yang sangat khas pada trichomonas.
Laboratorium: pH>4,5 dan Sniff test (+)

Mikroskopik: pemeriksaan sediaan basah dengan larutan garam fisiologis terlihat pergerakan
trichomonas berbentuk ovoid, ukuran lebih besar dari PMN dan mempunyai flagel, leukosit
(+) dan clue cell dapat (+)

2. Kandidosis vulvovaginal
-

Anamnesis:
keluhan panas, atau iritasi pada vulva dan keputihan yang tidak berbau. Rasa gatal/iritasi
disertai keputihan tidak berbau atau berbau asam. Keputihan bisa banyak, putih keju atau
seperti kepala susu/krim, tetapi kebanyakan seperti susu pecah. Pada dnding vagina biasanya
dijumpai gumpalan keju (cottage cheeses). Pada vulva/dan vagina terdapat tanda-tanda
radang, disertai maserasi, psuedomembran, fissura dan lesi satelit papulopustular
Laboratorium: pH vagina <4,5 dan Whiff test (-)
Mikroskopik: pemeriksaan sediaan basah dengan KOH 10% atau dengan pewarnaan gram
ditemukan blastopora bentuk lonjong, sel tunas, pseudohifa dan kadang kadang hifa asli
bersepta

3. Vaginosis bacterial
-

Anamnesis:
Mempunyai bau vagina yang khas yaitu bau amis terutama waktu berhubungan seksual,
namun sebagian besar dapat asimtomatik. Keputihan dengan bau amis seperti ikan. Sekret
berlebihan, banyaknya sedang sampai banyak, homogen, warna putih atau keabu-abuan,
melekat pada dinding vagina.Tidak ada tanda-tanda inflamasi.
Laboratorium: pH >4,5 biasanya berkisar antara 5-5,5 dan Whiff test (+)

Mikroskopik: clue cell (+) jarang terdapat leukosit

4. Servisitis Gonore
-

Anamnesis:
Gejala subjektif jarang ditemukan .Pada umumnya wanita datang berobat kalau sudah ada
komplikasi.Sebagian besar penderita ditemukan pada pemeriksaan antenatal atau
pemeriksaan keluarga berencana.Duh tubuh serviks yang mukopurulen.Serviks tampak
eritem, edema, ektopi dan mudah berdarah pada saat pengambilan bahan pemeriksaan.

Laboratorium: kultur

Mikroskopik: Pemeriksaan sedian langsung dengan pengecatan gram ditemukan diplokokus


gram negatif, intraseluler maupun ekatraseluler

5. Klamidiasis
-

Anamnesis
gejala sering tidak khas, asimtomatik, atau sangat ringan. Eksudat seviks mukopurulen, erosi
seviks, atau folikel-folikel kecil (microfollicles)
Laboratorium: pemeriksaan serologis untuk deteksi antigen melalui ELISA

Mikroskopik: dengann pengecatan giemsa akan ditemukan badan elementer dan badan
retikulat

Gambar 17. Cara Pemeriksaan PAP Smear


Pemeriksaan Pap Smear untuk pertama kali harus dilakukan segera setelah wanita tersebut mulai
melakukan hubungan seksual dan harus diulangi setelah 1 tahun, karena sel-sel abnormal dapat
terluput dari sekali pemeriksaan. Jika tidak didapati kelainan pada salah satu hasil pemeriksaan
Pap Smear, pemeriksaan dapat dilakukan secara teratur dengan interval 2 tahun sekurangkurangnya sampai wanita hamil.
Pengertian Pap Smear
Pap Test (Pap Smear) adalah pemeriksaan sitologik epitel porsio dan endoservik uteri untuk
penentuan adanya perubahan pra ganas maupun ganas di porsio atau servik uteri (Tim
PKTP,RSUD Dr. Soetomo/ FK UNAIR, 2000). Sedangkan menurut Hariyono Winarto dalam
seminarnya pada tanggal 05-10-2008 tentang Pap Smear Sebagai Upaya Menghindari Kanker
Leher Rahim Bagi Wanita Usia Reproduksi, pengertian Pap Test (Pap Smear) adalah suatu
pemeriksaan dengan cara mengusap leher rahim (scrapping) untuk mendapatkan sel-sel leher
rahim kemudian diperiksa sel-selnya, agar dapat ditahui terjadinya perubahan atau tidak.
Dari pengertian di atas, dapat disimpulkan bahwa Pap Smear adalah pemeriksaan usapan pada
leher rahim untuk mengetahui adanya perubahan sel-sel yang abnormal yang diperiksa dibawah
mikroskop.
Gambar 18. cara pengambilan sampel
Tujuan Pap Smear

Menemukan sel abnormal atau sel yang dapat berkembang menjadi kanker termasuk infeksi
HPV. (Ramli, dkk: 2000). Untuk mendeteksi adanya pra-kanker, ini sangat penting ditemukan
sebelum seseorang menderita kanker. (Hariyono.W, 2008). Mendeteksi kelainan kelainan yang
terjadi pada sel-sel leher rahim.
Mendeteksi adanya kelainan praganas atau keganasan servik uteri (Tim PKTP, RSUD Dr.
Soetomo / FK UNAIR, 2000).
Syarat Pengambilan Pap Smear
Beberapa hal penting yang perlu diperhatikan dalam pemeriksaan Pap Smear adalah sebagai
berikut :
a Waktu pengambilan minimal 2 minggu setelah menstruasi dimulai dan sebelum
menstruasi berikutnya.
b

Berikan informasi sejujurnya kepada petugas kesehatan tentang riwayat kesehatan dan
penyakit yang pernah diderita

Hubungan intim tidak boleh dilakukan dalam 24 jam sebelum pengambilan bahan
pemeriksaan.

Pembilasan vagina dengan macam-macam cairan kimia tidak boleh dikerjakan dalam 24
jam sebelumnya.

Hindari pemakaian obat-obatan yang dimasukkan ke dalam vagina 48 jam sebelum


pemeriksaan.

Bila anda sedang minum obat tertentu, informasikan kepada petugas kesehatan, karena
ada beberapa jenis obat yang dapat mempengaruhi hasil analisis sel. (Republika. C,
2007).

Klasifikasi Pap Smear


Negative: tidak ditemukan sel ganas.
Klasifikasi menurut Papanicolau adalah sebagai berikut :
Kelas I : Hanya ditemukan sel-sel normal.
Kelas II : Ditemukan beberapa sel atipik, akan tetapi tidak ada bukti keganasan.
Kelas III : Gambaran sitologi mengesankan ,tetapi tidak konklusif keganasan.
Kelas IV : Gambaran sitologi yang mencurigakan keganasan.
Kelas V : Gambaran sitologi yang menunjukkan keganasan.
(Tim PKTP RSUD Dr. Soetomo/FK UNAIR, 2000).
Interpretasi hasil pap test menurut Papanicolaou:
Kelas I : Identik dengan normal smear pemeriksaan ulang 1 tahun lagi.
Kelas II : Menunjukkan adanya infeksi ringan non spesifik, kadang disertai:
a) Kuman atau virus tertentu.
b) Sel dengan kariotik ringan.
Pemeriksaan ulang 1 tahun lagi, pengobatan yang sesuai dengan kausalnya. Bila ada erosi atau
radang
bernanah,
pemeriksaan
ulang
1
bulan
setelah
pengobatan.
Kelas III : Ditemukannya sel diaknostik sedang dengan keradangan berat. Periksa ulang 1 bulan
sesudah pengobatan
Kelas IV : Ditemukannya sel-sel yang mencurigakan ganas dalam hal demikian dapat ditempuh 3
jalan, yaitu:
a) Dilakukan biopsi.

b) Dilakukan pap test ulang segera, dengan skreping lebih dalam diambil 3 sediaan
c) Rujuk untuk biopsi konfirmasi.
Kelas V : Ditemukannya sel-sel ganas. Dalam hal ini seperti ditempuh 3 jalan seperti pada hasil
kelas IV untuk konfirmasi. (Tim PKTP RSUD Dr. Soetomo/FK UNAIR, 2000).
Gambar 19. Alat-alat untuk pemeriksaan PAPSmear

Alat-alat yang diperlukan untuk pengambilan pap test yaitu :


1. Formulir konsultasi sitologi.
2. Spatula ayre yang dimodifikasi dan cytobrush.
3. Kaca benda yang pada satu sisinya telah diberikan tanda/label.
4. Spekulum cocor bebek (gravels) kering.
5. Tabung berisikan larutan fiksasi alcohol 95 %. (Arif Mansjoer, 2000).
Cara pengambilan sediaan :
Sebelum memulai prosedur, pastikan bahwa label wadah specimen diisi, pastikan bahwa
preparat diberi label yang menulis tanggal dan nama serta nomor identitas wanita.
Gunakan sarung tangan.
Insersi spekulum dengan ukuran tepat, visualisasi serviks, fiksasi speculum untuk
memperoleh pajanan yang diperoleh. Pastikan secara cermat membuang setiap materi yang
menghalangi visualisasi serviks/ mengganggu studi sitologi.
Salah satu dari 4 metode pengumpulan spesimen berikut untuk apusan pap dapat digunakan :
a) Tempatkan bagian panjang ujung spatula kayu yang ujungnya sedikit runcing/ pengerik
plastic mengenai dan masuk ke dalam mulut eksterna serviks dan tekan. Ambil specimen
kanalis servikalis dengan memutar spatula satu lingkaran penuh.
b) Ujung kapas aplikator berujung kapas dilembabkan dengan normal saline, insersi
aplikator tersebut ke dalam saluran serviks 2 cm dan putar 3600.
c) Insersi alat gosok sepanjang 1-2 cm ke dalam saluran serviks dan putar 90-1800.
d) Gunakan kombinasi metode untuk metode memasukkan spatula.

Sebarkan sel-sel pada preparat yang sudah diberi label. Apabila sel-sel dikumpulkan pada
spatula kayu, tempatkan satu sisi diatas dekat label diatas setengah bagian atas preparat dan
usap 1 kali sampai ke ujung preparat. Kemudian balikkan spatula dan tempatkan sisi datar
lain dekat label pada setengah bagian bawah preparat dan usap satu kali sampai ujung
preparat.

Segera semprot preparat dengan bahan fiksasi/ masukkan bahan tersebut didalam tabung
berisi larutan fiksasi.(Helen Varney, 2007).

Bila fasilitas pewarnaan jauh dari tempat praktek sederhana, dapat dimasukkan dalam
amplop/pembungkus yang dapat menjamin kaca sediaan tidak pecah. Dengan pengambilan

sediaan yang baik, fiksasi dan pewarnaan sediaan baik serta pengamatan mikroskopik yang
cermat, merupakan langkah yang memadai dalam menegakkan diagnosis. (Ramli,dkk, 2000).
Konseling pra pap smear yang tepat:
Waktu pengambilan minimal 2 minggu setelah menstruasi dimulai dan sebelum menstruasi
berikutnya.

Berikan informasi sejujurnya kepada petugas kesehatan tentang riwayat kesehatan dan
penyakit yang pernah diderita

Hubungan intim tidak boleh dilakukan dalam 24 jam sebelum pengambilan bahan
pemeriksaan.

Pembilasan vagina dengan macam-macam cairan kimia tidak boleh dikerjakan dalam 24 jam
sebelumnya.

Hindari pemakaian obat-obatan yang dimasukkan ke dalam vagina 48 jam sebelum


pemeriksaan.
Bila anda sedang minum obat tertentu, informasikan kepada petugas kesehatan, karena ada
beberapa jenis obat yang dapat mempengaruhi hasil analisis sel.

Cara pengambilan kesediaan


Pengambilan kesediaan yang tak adekuat (62 %), bisa terjadi kegagalan skrining (15 %),
interpretasi (23 %), dan angka positif palsu (3-15 %). Untuk ketepatan diagnostik perlu
diperhatikan komponen dosenviks dan ektoserviks yang diambil dengan gabungan cytobrush dan
spatula.
FaktorfaktoryangmempengaruhipapsmearmenurutFitria(2007)
a.Umur
Perubahanselselabnormalpadaleherrahimpalingseringditemukanpadausia3555tahundan
memilikiresiko23kalilipatuntukmenderitakankerleherrahim.Semakintuaumurseseorang
akanmengalamiproseskemunduran,sebenarnyaproseskemunduranitutidakterjadipadasuatu
alatsaja,tetapipadaseluruhorgantubuh.Semuabagiantubuhmengalamikemunduran,
sehinggapadausialebihlamakemungkinanjatuhsakit(Fitria,2007).
b.SosialekonomiGolongansosialekonomiyangrendahseringkaliterjadikeganasanpadasel
selmulutrahim,halinikarenaketidakmampuanmelakukanpapsmearsecararutin(Fitria,
2007).
c.ParitasParitasadalahseseorangyangsudahpernahmelahirkanbayiyangdapathidup.Paritas
denganjumlahanaklebihdari2orangataujarakpersalinanterlampaudekatmempunyairesiko
terhadaptimbulnyaperubahanselselabnormalpadaleherrahim.Jikajumlahanak
menyebabkanperubahanselabnormaldariepitelpadamulutrahimyangdapatberkembangpada
keganasan(Fitria,2007).
d.UsiawanitasaatnikahUsiamenikah<20tahunmempunyairesikolebihbesarmengalami
perubahanselselmulutrahim.Halinikarenapadasaatusiamudaselselrahimmasihbelum
matang,makaselseltersebuttidakrentanterhadapzatzatkimiayangdibawaolehspermadan
segalamacamperubahanya,jikabelummatang,bisasajaketikaadarangsanganselyangtumbuh
tidakseimbangdanselyangmati,sehinggakelebihanselinibisamerubahsifatmenjadisel
kanker(Fitria,2007).

WanitayangdianjurkantespapsmearWanitayangdianjurkanuntukmelakukantespapsmear
biasanyamerekayangtinggiaktifitasseksualnya.Namuntidakmenjadikemungkinanjuga
wanitayangtidakmengalamiaktivitasseksualnyamemeriksakandiri,berikutiniadalahwanita
wanitasasarantespapsmear(Sukaca,2009)yaitu:
a.Setiap612bulanuntukwanitayangberusiamudasudahmenikahataubelummenikahnamun
aktivitasseksualnyasangattinggi.
b.Setiap612bulanuntukwanitayangbergantigantipasanganseksualataupernahmenderita
infeksiHIVataukutilkelamin.
c.Setiaptahununtukwanitayangberusiadiatas35tahun.d.Setiaptahununtukwanitayang
memakaipilKB.e.Paptessetahunsekalibagiwanitaantaraumur4060tahun.f.Sesudah2kali
paptes()denganinterval3tahundengancatatan
bahwawanitaresikotinggiharuslebihseringmenjalankanpap
smear.g.Seseringmungkinjikahasilpapsmearmenunjukkanabnormal
seseringmungkinsetelahpenilaiandanpengobatanprakankermaupunkankerserviks.
KendalaPapSmear(RomaulidanVindari.2011)
Dilakukandiatashanya5%perempuandiIndonesiayangbersediamelakukanpemeriksaanpap
smearbanyakkendala.haltersebutterjadiantaralain:
a.Kurangnyatenagaterlatihuntukpengambilansediaan.
b.Tidaktersedianyaperalatandanbahanuntukpengambilansediaan.
c.Tidaktersedianyasaranapengirimansediaan.
d.Tidaktersedianyalaboratoriumpemprosesansediaansertatenagaahlisitologi.
Faktorfaktoryangmempengaruhi(Sukaca,2009)antaralain:
a.Carapengambilancairanyangtepat
Pengambilancairandapatterjadihalhalyangtidakdiinginkanyaitubisaterjadikegagalan
skrining(15%),interpretasi(23%),danangkapositifpalsu(315%).
b.Petugaskesehatan
Kadangkalapetugaskesehatandapatsalahtafsirdalammenginterprestasikandata.Kesalahan
tersebutdiantaranya:1)Kadangkalapetugaskesehatantidakmampumemberikan
pelayanandanmemberikanjawabanyangbaik.2) Petugaskesehatandalammemberikan
pelayanantesabnormalpapsmear.3) Petugastidakdapatmengindikasikanselabnormal.
c.LaboratoriumDidalamlaboratoriumjugadapatterjadikesalahan,kasalahanyanglazim
dilakukandalamlaboratoriumadalahsebagaiberikut:1) Laboratoriumgagaldalammendeteksi
selabnormal.2)Kegagalandalammelaporkankualitascairanyangtidak
memuaskan.3) Laboratoriuntidakmaumelakukanpengulangan.4) Cairanfiksasitidak
menggunakanalcohol95%.5)
Cairanterlalukeringdantipis.
d.PetugasLaboratoriumTerkadangpetugaslaboratoriumjugamelakukansuatukesalahanantara
lain:
Carapetugaslaboratoriunmtidaksesuaidenganprosedur.
Reagenyangdipakaisudahkadaluarsa.
Petugastidakcakapdalammembacakanhasilpemeriksaan.
Ketrampilandanketelitianpetugasdiragukan
e.WaktupengambilanyangtepatWaktupemeriksaanpapsmearyangtepatadalahsaatanda
telahmenikah.Begituhalnyapadawanitayangmemilikitingkatseksualitasyangtinggi.Tesini
dianjurkanagarwanitadapatterbebasdaripenyakitkankerleherrahimyangganas.

Diagnosis Banding
Kanker serviks (keputihan warna putih purulent yang berbau dan tidak gatal)
Normal
Vaginosis
Vaginitis
Vulvovaginitis
Bakteri
Trichomonas
Candida albicans
vaginalis
Gejala
primer

Tidak ada

Sekret,
bau Sekret, bau busuk, Sekret, gatal dan
busuk, mungkin mungkin gatal
seperti
terbakar
gatal
pada kulit vulva

Sekret
vagina

Sedikit,
flokulan

pH

< 4,5

> 4,5

Bau

Tidak ada

Sering, seperti Dapat ada, seperti Tidak ada


bau ikan
bau ikan

Mikroskopis

Sel epitel dengan Clue


cells Trikomonas motil; Preparat
KOH
lactobacillus
dengan
basil banyak PMN
memperlihatkan
adheren; tidak
tangkai ragi dan
ada PMN
pseudohifa

Pengobatan

Tidak ada

putih, Meningkat,
tipis, homogen,
putih, abu-abu,
adheren

Metronidazole

Meningkat, kuning, Meningkat, putih,


hijau,
berbusa, keju lembut seperti
adheren;
petekia dadih
servikal sering ada
> 4,5

Metronidazole

4,5

Antifungi
topikal

azol

2.8 Tatalaksana dan pencegahan


Apabila keputihan yang dialami adalah yang fisiologik tidak perlu pengobatan, cukup hanya
menjaga kebersihan pada bagian kemaluan.Apabila keputihan yang patologik, sebaiknya segera
memeriksakan kedokter, tujuannya menentukan letak bagian yang sakit dan dari mana keputihan
itu berasal. Melakukan pemeriksaan dengan menggunakan alat tertentu akan lebih memperjelas.
Kemudian merencanakan pengobatan setelah melihat kelainan yang ditemukan.Keputihan yang
patologik yang paling sering dijumpai yaitu keputihan yang disebabkan Vaginitis, Candidiasis,
dan Trichomoniasis.Penatalaksanaan yang adekuat dengan menggabungkan terapi farmakologi
dan terapi nonfarmakologi.
Tujuan pengobatan:
- Menghilangkan gejala
-

Memberantas penyebabrnya

Mencegah terjadinya infeksi ulang- Pasangan diikutkan dalam pengobatan

a. Terapi farmakologi
Antiseptik :
Povidone Iodin

Sediaan ini berbentuk larutan 10% povidon iodin dan ada yang diperlengkapi dengan alat
douche-nya sebagai aplikator larutan ini. Selain sebagai antiinfeksi yang disebabkan jamur
Kandida, Trikomonas, bakteri atau infeksi campuran, juga sebagai pembersih.
Tidak boleh digunakan pada ibu hamil dan menyusui. Bila terjadi iritasi atau sensitif pemakaian
harus dihentikan.
Antibiotik
Clotrimazole
Memiliki aktivitas antijamur dan antibakteri. Untuk infeksi kulit dan vulvovaginitis yang
disebabkan oleh Candida albicans.
Efek samping : pemakaian topikal dapat terjadi rasa terbakar,eritema, edema ,gatal dan
urtikaria
Sediaan dan posologi : Tersedia dalam bentuk krim dan larutan dengan kadar 1% dioleskan 2 kali
sehari . Krim vagina 1% untuk tablet vagina 100 mg digunakan sekali sehari pada malam hari
selama 7 hari atau tablet vagina; 500 mg, dosis tunggal.
Tinidazole
Tinidazole adalah obat antiparasit yang digunakan untuk membrantas infeksi Protozoa, Amuba.
Efek samping : obat ini sama seperti Metronidazole tetapi dengan kelebihan tidak perlu minum
dengan waktu yang panjang sehingga mengurangi efek sampingnya.
Tinidazole sebagai preparat vaginal digunakan untuk infeksi Trichomonas. Biasa dikombinasi
dengan Nystatin sebagai anti jamurnya. Bentuk sediaan yang ada adalah vaginal tablet.
Metronidazole
Diberikan peroral ( 2 gram sebagai dosis tunggal , 1gr setiap 12 jam x 2 atau 250 mg 3xsehari
selama 5-7 hari) untuk infeksi Trichomonas vaginalis.
Diberikan 500 mg 2xsehari selama seminggu dan lebih baik secara mitraseksual. Untuk infeksi
Gardnerella vaginalis
Efek samping : mual kadang kadang muntah, rasa seperti logam dan intoleransi terhadap alkohol.
Kontra indikasi : pada trimester pertama kehamilan

Nimorazole

Nimorazole merupakan antibiotika golongan Azol yang terbaru. Selain dalam sediaan tunggal
dalam bentuk tablet oral (diminum) juga ada kombinasinya (Chloramphenicol dan Nystatin)
dalam bentuk vaginal tablet.

Penisilin

Ampisilin pada pemberian oral dipengaruhi besarnya dosis dan ada tidaknya makanan dalam
saluran cerna

Amoksisilin lebih baik diberikan oral ketimbang ampisilin karena tidak terhambat makanan
dalam absorbsinya.

Efek samping : Reaksi alergi , nefropati, syok anafilaksis, efek toksik penisilin terhadap susunan
saraf menimbulkan gejala epilepsi karena pemberian IV dosis besar
Sediaan dan posologi :
Ampisilin :
- Tersedia dalam bentuk tablet atau kapsul 125mg, 250mg, 500mg
- Dalam suntikan 0,1 ; 0,25 ; 0,5 dan 1 gram pervial

Amoksisilin :
Dalam bentuk kapsul atau tablet ukuran 125, 250, 500 gram dan sirup125mg/5mL dosis
diberikan 3 kali 250-500 mg sehari
Anti jamur :
Nystatin
Nystatin adalah obat antijamur polien untuk jamur dan ragi yang sensitif terhadap obat ini
termasuk Candida sp. Di dalam darah sangat berbahaya bagi tubuh, tetapi dengan sifatnya yang
tidak bisa melewati membran kulit sangat baik untuk digunakan sebagai obat pemakaian luar
saja. Tetapi dalam penggunaannya harus hati-hati jangan digunakan pada luka terbuka.
Anti Virus :
Asiklovir
Bekerja menghambat enzim DNA polimerase virus. Sediaan dalam bentuk oral, injeksi dan krim
untuk mengobati herpes dilabia.
Efek samping :
Oral : pusing, mual, diare,sakit kepala
Topikal : Kulit kering dan rasa terbakar dikulit.
Kontraindikasi : tidak boleh digunakan pada ibu hamil.
Berikut ini adalah pengobatan dari penyebab paling sering :
1 Candida albicans
Topikal
Nistatin tablet vagina 2 x sehari selama 2 minggu
Klotrimazol 1% vaginal krim 1 x sehari selama 7 hari
Mikonazol nitrat 2% 1 x ssehari selama 7 14 hari
Sistemik
Nistatin tablet 4 x 1 tablet selama 14 hari
Ketokonazol oral 2 x 200 mg selama 7 hari
Nimorazol 2 gram dosis tunggal
Ornidazol 1,5 gram dosis tunggal
Pasangan seksual dibawa dalam pengobatan
2

Chlamidia trachomatis

Metronidazole 600 mg/hari 4-7 hari (Illustrated of textbook gynecology)


Tetrasiklin 4 x 500mg selama 10-14 hari oral
Eritromisin 4 x 500 mg oral selama 10-14 hari bila
Minosiklin dosis 1200mg di lanjutkan 2 x 100 mg/hari selama 14hari
Doksisiklin 2 x 200 mg/hari selama 14 hari
Kotrimoksazole sama dengan dosis minosiklin 2 x 2 tablet/hari selama 10 hari
3

Gardnerella vaginalis

Metronidazole 2 x 500 mg
Metronidazole 2 gram dosis tunggal
Ampisillin 4 x 500 mg oral sehari selama 7 hari
Pasangan seksual diikutkan dalam pengobatan

Neisseria gonorhoeae

Penicillin prokain 4,8 juta unit im atau


Amoksisiklin 3 gr im
Ampisiillin 3,5 gram im atau
Ditambah :
Doksisiklin 2 x 100mg oral selama 7 hari atau
Tetrasiklin 4 x 500 mg oral selama 7 hari
Eritromisin 4 x 500 mg oral selama 7 hari
Tiamfenikol 3,5 gram oral
Kanamisin 2 gram im
Ofloksasin 400 mg/oral
5

Neisseria gonorhoeae penghasil Penisilinase

Seftriaxon 250 mg im atau


Spektinomisin 2 mg im atau
Ciprofloksasin 500 mg oral
Ditambah
Doksisiklin 2 x 100 mg selama 7 hari atau
Tetrasiklin 4 x 500 mg oral selama 7 hari
Eritromisin 4 x 500 mg oral selama 7 hari
6

Virus herpeks simpleks

Belum ada obat yang dapat memberikan kesembuhan secara tuntas


Asiklovir krim dioleskan 4 x sehari
Asiklovir 5 x 200 mg oral selama 5 hari
Povidone iododine bisa digunakan untuk mencegah timbulnya infeksi sekunder
b. Terapi Nonfarmakologi
1. Perubahan Tingkah Laku
Keputihan (Fluor albus) yang disebabkan oleh jamur lebih cepat berkembang di lingkungan yang
hangat dan basah maka untuk membantu penyembuhan menjaga kebersihan alat kelamin dan
sebaiknya menggunakan pakaian dalam yang terbuat dari katun serta tidak menggunakan
pakaian dalam yang ketat (Jones,2005). Keputihan bisa ditularkan melalui hubungan seksual dari
pasangan yang terinfeksi oleh karena itu sebaiknya pasangan harus mendapat pengobatan juga.
2. Personal Hygiene
Memperhatikan personal hygiene terutama pada bagian alat kelamin sangat membantu
penyembuhan, dan menjaga tetap bersih dan kering, seperti penggunaan tisu basah atau produk
panty liner harus betul-betul steril.Bahkan, kemasannya pun harus diperhatikan. Jangan sampai
menyimpan sembarangan, misalnya tanpa kemasan ditaruh dalam tas bercampur dengan barang
lainnya. Karena bila dalam keadaan terbuka, bisa saja panty liner atau tisu basah tersebut sudah
terkontaminasi.Memperhatikan kebersihan setelah buang air besar atau kecil.Setelah bersih,
mengeringkan dengan tisu kering atau handuk khusus.Alat kelamin jangan dibiarkan dalam
keadaan lembab.
3. Pengobatan Psikologis
Pendekatan psikologik penting dalam pengobatan keputihan.Tidak jarang keputihan yang
mengganggu, pada wanita kadang kala pemeriksaan di laboratorium gagal menunjukkan infeksi,

semua pemgujian telah dilakukan tetapi hasilnya negatif namun masalah atau keluhan tetap ada.
Keputihan tersebut tidak disebabakan oleh infeksi melainkan karena gangguan fsikologi seperti
kecemasan, depresi, hubungan yangburuk, atau beberapa masalah psikologi yang lain yang
menyebabkan emosional. Pengobatan yang dilakukan yaitu dengan konsultasi dengan ahli
psikologi.Selain itu perlu dukungan keluarga agar tidak terjadi depresi.

Pencegahan Leukorea
Menjaga kesehatan reproduksi untuk pencegahan keputihan pada wanita diawali dengan menjaga
kebersihan organ kewanitaan. Beberapa hal yang perlu diperhatikan dalam menjaga kebersihan
organ kewanitaan, yaitu :
1. Membersihkan kotoran yang keluar dari alat kelamin dan anus dengan seksama.
Membersihkan dilakukan dari depan kebelakang (dari daerah kemaluan ke arah anus)
secara satu arah. Hal ini dilakukan untuk mencegah kotoran dari anus masuk kedalam
vagina.
2. Membasuh secara teratur bagian bibir vagina secara hati-hati menggunakan air bersih dan
sabun yang lembut setiap habis BAK , BAB, dan ketika mandi. Yang terpenting adalah
membersihkan bekas keringat dan bakteri yang ada disekitar bibir vagina.
3. Gunakan sabun lembut tanpa pewangi saat mandi untuk menjaga keasaman vagina.
Normalnya vagina berbau asam dan kecut dengan pH keasaman sekitar 4-4,5. Terlalu
sering membasuh vagina dengan cairan kimia dan menggunakan deodoran disekitar
vagina akan merusak keseimbangan organisme dan cairan vagina sehingga
memungkinkan terjadinya infeksi pada vagina (vaginitis).
4. Mengeringkan alat kelamin dengan tisu atau handuk agar tidak lembab setiap kali setelah
mandi atau buang air. Usahakan agar daerah kemaluan dan selangkangan selalu kering,
lebih lebih bila tergolong gemuk karena suasana lembab sangat disukai oleh jamur. Selalu
keringkan bagian vagina sebelum berpakaian.
5. Hindari pemakaian bedak pada organ kewanitaan dengan tujuan agar vagina kering
sepanjang hari. Bedak memiliki partikel partikel halus yang mudah terselip disana sini
yang akhirnya mengundang jamur dan bakteri bersarang.
6. Mengganti celana dalam minimal dua kali sehari setelah mandi, terutama bagi wanita
aktif dan mudah berkeringat. Gunakan celana dalam yang kering dan bila celana dalam
keadaan basah segera mengganti celana dalam yang bersih dan belum dipakai.
7. Tidak memakai celana dalam yang terlalu ketat , karena celana dalam yang terlalu ketat
menyebabkan permukaan vagina menjadi lebih mudah berkeringat. Gunakan celana
dalam yang bahannya menyerap keringat seperti katun. Celana dalam dari satin atau
bahan sintetik lain membuat suasana disekitar vagina panas dan lembab.
8. Pakaian luar juga harus diperhatikan. Celana jeans tidak dianjurkan karena pori porinya
sangat rapat, pilihlah seperti rok atau celana bahan non jeans agar sirkulasi udara
disekitar organ intim bergerak leluasa.
9. Ketika sedang haid dianjurkan sering mengganti pembalut terutama pada hari hari
pertama haid. Pembalut perlu diganti 4-5 kali dalam sehari untuk menghindari
pertumbuhan bakteri pada pembalut yang digunakan dan mencegah masuknya bakteri

kedalam vagina. Pembalut yang baik yaitu pembalut yang berdaya serap baik dan tidak
berparfum.
10. Gunakan panty liner disaat perlu dan jangan terlalu lama. Misalnya saat berpergian keluar
rumah dan lepaskan sekembalinya dirumah.
11. Dianjurkan untuk mencukur rambut kemaluan karena rambut kemaluan dapat ditumbuhi
sejenis jamur atau kutu.
12. Hindari pemakaian barang barang yang dapat memudahkan penularan seperti meminjam
perlengkapan mandi. Dianjurkan tidak duduk diatas kloset di wc umum atau biasakan
mengelap dudukan kloset sebelum menggunakannya.
13. Pola hidup sehat yaitu diet yang seimbang, olahraga rutin, istirahat yang cukup , hindari
rokok, dan alkohol serta hindari stress yang berkepanjangan.
2.9 Komplikasi
Infertilitas/masalah kesuburan atau gangguan haid dan penyakit radang panggul, pelvic
inflamatori disease, eczema dan condylomata acuminata sekitar vulva, vulvovaginitis,
uretritis, pada wanita hamil dapat menyebabkan bayi prematur, gangguan perkembangan
dan berat badan lahir rendah (BBLR) terutama akibat bacterial vaginosis dan infeksi
Trichomonas, serta dapat memfasilitasi terjadinya HIV.
Komplikasi yang sering adalah bila kuman telah menaiki panggul sehingga terjadi
penyakit yang dikenal dengan radang panggul.
Komplikasi jangka panjang yang lenih mengerikan, yaitu kemungkinan wanita tersebut
akan mandul akibat rusak dan lengketnya organ-organ dalam kemaluan terutama tuba
falopi dan juga dapat menyebabkan infertilitas.Komplikasi juga dapat terdapat pada pria
yaitu komplikasi non spesifikndapat menjalar ke prostat dan menimbulkan infeksi buah
zakar dan saluran kemih
Terinfeksinya kelenjar yang ada di dalam bibir vagina. Bisul kelenjar tersebut harus
disedot keluar karena tidak dapat disembukan dengan obat. Komplikasi pada wanita
sering menimbulkan radang saluran telur. Infeksi nonspesifik pada wanita sering tanpa
keluhan maupun gejala
2.10 Prognosis
Biasanya kondisi-kondisi yang menyebabkan fluor albus memberikan respon terhadap
pengobatan dalam beberapa hari. Kadang-kadang infeksi akan berulang. Dengan
perawatan kesehatan akan menentukan pengobatan yang lebih efektif
Vaginosis bakterial mengalami kesembuhan rata rata 70 80% dengan regimen
pengobatan
Kandidiasis mengalami kesembuhan rata rata 80 -95 %
Trikomoniasis mengalami kesembuhan rata rata 95 %

3. Memahami dan menjelaskan keputihan dalam pandangan islam


Keputihan ini umum dialami oleh wanita. Dalam kitab shahih Bukhari disebutkan, suatu
ketika ada beberapa sahabat perempuan datang bertanya kepada Aisyah radhiallahu anha
tentang batasan berakhirnya haidh. Beliau menjawab :

Jangan kalian tergesa-gesa (menetapkan akhir haidh) hingga kalian melihat cairan putih
Ibnu Hajar al-Asqolani dalam kitabnya fathul bari menjelaskan bahwa cairan putih
sebagaimana di sebut hadits di atas menjadi salah satu tanda akhir masa haidh.
Selain jenis keputihan di atas, ada pula keputihan yang terjadi dalam keadaan tidak normal,
yang umumnya dipicu kuman penyakit dan menyebabkan infeksi. Akibatnya, timbul gejalagejala yang sangat mengganggu, seperti berubahnya warna cairan menjadi kekuningan
hingga kehijauan, jumlah berlebih, kental, lengket, berbau tidak sedap, terasa sangat gatal
atau panas. Dalam khazanah Islam, keputihan jenis ini biasa disebut dengan cairan putih
kekuningan (sufrah )atau cairan putih kekeruhan (kudrah ). Terkait dengan kedua
hal ini, di kitab shahih Bukhari disebutkan bahwa Sahabat bernama Ummu Athiyyah
radhiallahuanha berkata:


Kami tidak menganggap al-kudrah (cairan keruh) dan as-sufrah (cairan kekuningan) sama
dengan haidh
Berdasarkan kedua hadis tersebut dapat disimpulkan :
1. Hukum orang yang mengalami keputihan tidak sama dengan hukum orang yang
mengalami menstruasi. Orang yang sedang keputihan tetap mempunyai kewajiban
melaksanakan shalat dan puasa, serta tidak wajib mandi.
2. Cairan keputihan tersebut hukumnya najis, sama dengan hukumnya air kencing. Oleh
karenanya, apabila ingin melaksanakan shalat, sebelum mengambil wudhu, harus istinjak
(cebok), dan membersihkan badan atau pakaian yang terkena cairan keputihan terlebih
dahulu.
Sedangkan apabila cairan keputihan keluar terus-menerus, maka orang yang mengalaminya
dihukumi dharurah/terpaksa, artinya orang tersebut tetap wajib melaksanakan shalat
walaupun salah satu syarat sahnya shalat tidak terpenuhi, yakni sucinya badan dan pakaian
dari najis. Menurut ulama Syafiiyah, ketentuan tersebut bisa dilaksanakan dengan syarat
diawali dengan proses membersihkan, istinjak, wudhu dan kemudian shalat dilakukan secara
simultan setelah waktu shalat masuk.