Anda di halaman 1dari 6

Berikut ini adalah versi HTML dari file http://jks.fkik.unsoed.ac.id/index.php/jks/article/download/524/319.

Google membuat versi HTML dari dokumen tersebut secara otomatis pada saat menelusuri web.
Kata kunci yang dipakai untuk penelusuran sudah distabilo efektifitas pemberian jus kurma

Page 1
JurnalKeperawatanSoedirman(TheSoedirmanJournalofNursing),Volume8,No.1,Maret2013

32
EFEKTIFITASPEMBERIANJUSKURMADALAMMENINGKATKANTROMBOSIT
PADA
PASIENDEMAMBERDARAHDENGUEDIRSUBUNDAPURWOKERTO
Giyatmo
JurusanKeperawatanSTIKESMuhammadiyahGombong
ABSTRACT
Denguefeverreducedthelevelsoftrombocytesuntil100.000/ulonday3today7whick
causedabnormalbleedingtodeath.Datescontainedsubstancesthatformedbloodcellssuchas
vitaminB12,Iron,cobalt,magnesium,Cu,Zn,aminoacids,vitaminC,andBComplek.This
researchistoanalyzetheeffectivenessPhoenixDactyliferaJuicetoImproveTrombocytesof
DengueHemorrhagicFeverpatientsatBundaPublicHospitalPurwokerto.Thisresearchused
experimentalinvitrodesignwithpreandposttestdesignandcontrolgroup.Randomsample,the
independentvariables:GivePhoenixDactyliferaJuicetoDengueHemorrhagicFever(DHF)
patients,dependentvariable:TrombocytesofDengueHemorrhagicFever(DHF)patients.The
resultofttest2ndindependent,thatobtainedbythedifferenceofthrombocyteslevelbetween
treatmentgroupand control groupforpost 3days with p=0.039.Thedetails show thatthe
Phoenix Dactylifera Juice to Improve Trombocytes of Dengue Hemorrhagic Fever patients
meaningfully.
Keywords:PhoenixDactyliferajuice,improvethrombocytes,DenguehemorrhagicFever
ABSTRAK
Demam Berdarah Dengue dapat mengakibatkan penurunan trombosit pada hari ke3
sampaike7denganpenurunantrombosithinggakurangdariatausamadengan100.000/ulyang
dapatmenyebabkanperdarahanamnormalataubahkankematian.Buahkurmamengandungzat
zatpembentukselseldarahyaituvitaminB12,Besi,Kobalt,magnesium,Cu,Zn,asamamino,
Vitamin C, dan vitamin B komplek. Penelitian ini menganalisaefektifitaspemberianjus
kurmadalam meningkatkan trombosit pada pasien demam berdarah dengue di RSU Bunda
Purwokerto.Penelitianinimerupakanpenelitianeksperimentalinvitrodenganrancanganpretest
danposttestwithcontrolgroupdesign,Pengambilansampeldengancararandomsamplingyang
berjumlah 30 orang kelompok perlakuan dan 30 orang kelompok kontrol. Analisis yang
digunakan dengan ujipaired ttest dan ttest 2nd independent.Berdasarkan ujit test 2nd
independentterdapatperbedaankadartrombositdarahantarakelompokperlakuandankelompok
kontrol selama post 3 hari dengan nilai p = 0.039.Pemberianjuskurmaefektif dalam
peningkatankadartrombositdarahpasiendemamberdarahdenguediRSUBunda
Purwokerto.
Katakunci:Pemberianjuskurma,Peningkatantrombosit,DemamBerdarahDengue

Page 2
JurnalKeperawatanSoedirman(TheSoedirmanJournalofNursing),Volume8,No.1,Maret2013

33
PENDAHULUAN
Angkakejadiandemamberdarahdenguedi
Indonesiacenderungmengalamikenaikan
dan penyebarannyapun semakin meluas.
Peningkatan jumlah penderita terjadi
periodiksetiap5tahun.Semuladiperkirakan
bahwa penyakit DBD hanya terjadi di
daerah perkotaan saja tetapi ternyata juga
ditemukan dipelosok pedesaan. Kejadian
demam berdarah dengue di Kabupaten
Banyumaspada7(tujuh)tahunterakhir72
orangtahun2002,97orangtahun2003,175
orangtahun2004dan135orangtahun2005,
329orangpadatahun2006,228orangtahun
2007 dan 620 orang tahun 2008 dimana
terdapat 5 diantaranya meninggal dunia. `
Angkakejadiantersebutmenyebardi
berbagai kecamatan dan 27 kelurahan.
Penyakit Demam Berdarah (DBD) adalah
penyakityangdisebabkanolehvirusdengue
yang ditularkan melalui gigitan nyamuk
AidesaegyptidanAidesalbopictus(Fathi&
Wahyuni,2005).TandadangejalaPenyakit
DBD, demam mendadak 2 sampai 7 hari
tanpa penyebab yang jelas, lemah/lesu,
gelisah, nyeri ulu hati disertai tanda
perdarahandikulitberupabintikperdarahan,
lebam/ruam (Hadinegoro, 2001). Kadang
kadangmimisan,berakdarah,muntahdarah,
kesadaran menurun atau shock. DBD
menyebabkanTrombositopenipadaharike
3 sampai ke7 dan ditemukan penurunan
trombosit hingga 100.000 /mmHg dan
hemokonsentrasi, meningkatnya hematrokit
sebanyak 20% atau lebih (Deiana, 2007).
Pada beberapa manajemen trombositopeni
banyak sekali yang menganjurkan di
masyarakatdenganpeningkatannutrisiyang
adekuatdenganmemberikandietTKTPdan
penambahancairandanelektrolityangbaik
dengan rasional bahwa nutrisi yang baik

akan meningkatan pertahanan tubuh dalam


melawanketidakseimbanganmetabolisme
darah dalam hal ini hemopoesis dan
pembentukanselmegakarositsehingga
pembentukan trombosit dapat cepat terjadi
dengan hasil yang benarbenar maturasi.
Salah satu pemberiannya ada yang
menganjurkandenganjusjambu,fermentasi
beras dan jugapemberianjus kurma.
Khasiat buahkurmaantara lain untuk
mempercepat pemulihan kondisi saat sakit
demamberdarah(Djunaedi,2006).
Kurma(phoenix

dactylifera)
pohonnyasemacampalmyangtumbuhdan
berbuahdinegeriarab,irakdansekitarnya.
Banyakditemukandipadangpasir(kering)
dan bisa mencapai tinggi 30 35 meter,
mulai berbunga setelah umur 6 16 tahun,
ada dua jenis jantan dan betina dengan
bentuk bunga lebih besar untuk yang
berjenis jantan. Buahkurma berbentuk
lonjong dengan ukuran 27.5 cm dengan
warnayangbermacammacamantaracoklat
gelap,kemerahan,kuningmudadanberbiji.
BuahkurmamelikimenzatzatberikutGula
(campuranglukosa,sukrosa,danfruktosa),
protein, lemak, serat, vitamin A, B1, B2,
B12, C, potasium, kalsium, besi, klorin,
tembaga, magnesium, sulfur, fosfor, dan
beberapaenzimyangdapatberperandalam
penyembuhan berbagai penyakit
(Rahmawan,2006).Penelitianinibertujuan
mengetahuiefektifitaspemberianjuskurm
adalam meningkatkan trombosit pasien
DBDdiRSUBundaPurwokerto.
Page 3
JurnalKeperawatanSoedirman(TheSoedirmanJournalof
Nursing),Volume8,No.1,Maret2013

34
METODEPENELITIAN

Penelitian ini merupakan penelitian


eksperimentalinvitrodenganrancangan pre
test and post test with control group
designmelaluipemeriksaankadartrombosit
darahPredanPostharike3padakelompok
perlakuan dan kelompok control
setelahpemberianjuskurma. Menilai
seberapa besar kenaikan angka trombosit
setelahpemberianjuskurma padaharike
3padakelompokperlakuandankelompok
kontrol (yang tidak diberikan juskurma)
pada pasien DBD di Rumah Sakit Umum
Bunda. Pengambilan sampel dengan
cararandom samplingyang berjumlah 60
orangyangterdiridari30orangkelompok
perlakuandan30orangkelompokkontrol.
Variabel

bebas

adalah
pemberianjuskurmapadapasienDBDdan
variabelterikattrombositdalamdarah
Analisisyangdigunakanadalahdeskriptif
denganujipairedttestdanttest2nd
independent
HASILDANBAHASAN
Tabel 1. Distribusi Kelompok Umur pada
Kelompok Perlakuan (juskurma) pada
PasienDBD diRuangDahliaRSU Bunda
Purwokerto
KelompokUmur(th)
Jumlah(n)
Prosentase(%)
1530
3145
4660
20
26
14
33,3
43,3
23,3
Jumlah
60
100,0
Berdasarkantabeldistribusi

frekuensirespondenpadakelompok
perlakuanberumur1530tahunadalah20
orang(33,3%),kelompokumur3145
tahunsebanyak26orang(43,3%)dan
kelompokumur4660tahunadalah
sebanyak14orang(23,3%).
Tabel2.Karakteristikrespondenbedasarkan
jenis kelamin pada Pasien DBD di Ruang
Dahlia
RSUBundaPurwokerto
KelompokUmur(th)
Jumlah(n)
Prosentase(%)
Lakilaki
perempuan
22
38
36,6
63,4
Jumlah
60
100,0
BerdasarkanTabel2jeniskelamin
lakilakiberjumlah22orang(36,6%)dan
perempuansebanyak38orang(63,4%).
Hasilujihomogenitasdidapatkandata
basedonmeanp(sig)0.361>0.05,yang
memilikiartibahwadatayangdiolah
adalahdatahomogen.Ujinormalitas
didapatkandatabasedonmeanp(sig)
Page 4
JurnalKeperawatanSoedirman(TheSoedirmanJournalof
Nursing),Volume8,No.1,Maret2013

35
0.861>0.05,yangmemilikiartibahwadata
yangdiolahadalahdataberdistribusi
normal.
Table 3. Kadar trombosit darahprepada
kelompokperlakuandankelompokkontrol
pada
pasienDBDdiRSUBundaPurwokerto
Perlakuan
Kontrol
Trombosit/ul

JumlahRatarataTrombosit/ul
JumlahRatarata
1000070000
70000100000
100000200000
12org
13org
5org
75433.331000070000
70000100000
100000200000
9org
11org
10org
88933.33
Hasilujihomogenitasdidapatkan
datadenganberdistribusinormal.Kadar
trombositdarahsesudahharike3pada
kelompokperlakuan(sesudahdiberikan
juskurma)memilikinilairatarata
115200.00/ul,sedangkanpadakelompok
kontrol(yangtidakdiberikanjuskurma)
memilikinilairatarata92300.00/ul
sepertiterlihatpadaTabel4.Hasiluji
statisticmenunjukkannilaip=0.039yang
berartiHoditolakdanHaditerima.
Table 4. Kadar trombosit darahpost hari
3pada kelompok perlakuan dan kelompok
kontrol
pada pasien DBD di RSU Bunda
Purwokerto
Mean
Std.
deviation
T
P
KadartrombositPost3hari
Kadartrombosit3harikontrol
115200.00
92300.00
42209.167
41838.895
2.110
6190

0.039
0,541
Pemberianjuskurmadapat
meningkatkankadartrombositdarah
dibandingkanhanyadiberikanasupan
nutrisidarirumahsakitsajapadapasien
DBDyangmemilikiselisih22900.00/ul,
walaupunkeduanyamemberikanefek
yangsamaterhadappeningkatankadar
trombositdarah(Deiana,2007).
Dianjurkanpemberiancairandanelektrolit
peroral,jusbuah,sirup,susu,disamping
airputih,dianjurkanpalingsedikitdiberikan
selama2hari(Kawthalkar,2006).Bahan
bahanutamayangdiperlukanuntuk
pembentukandarahadalahAsamfolat,
vitaminB12,besi,kobalt,magnesium,Cu,
Zn,Asamamino,vitaminC,Bkompleks,
danlainlain.Untukitupemberianjus
kurmadapatmeningkatkankadar
trombositdarahMenurutRakhmawan
(2006)buahkurmayangmengandungzat
zatgula(campuranglukosa,sukrosa,dan
fruktosa),protein,lemak,serat,vitaminA,
B1,B2,B12,C,potasium,kalsium,besi,
klorin,tembaga,magnesium,sulfur,fosfor,
danbeberapaenzimyangcukuplengkap
nutrisinyadanmudahdimetabolismeoleh
tubuh.
Asupannutrisidanenergiselamadi
rumahsakitmerupakanfaktorpenting
dalampenatalaksanaanpengobatandi
JurnalKeperawatanSoedirman(TheSoedirmanJournalof
Nursing),Volume8,No.1,Maret2013

36
rumahsakit.Juskurmadandiitrumah
sakitmerupakanmakananyangmampu
meningkatkanstatusnutrisipasienyang
mengalamikekurangankadartrombosit
darah(Duma,Darmawansyah&Arsin,
2007).Dukungangiziyangtidakadekuat
selamadirumahsakitakan

mengakibatkanmeningkatnyamorbiditas
danmortalitassertamemperpanjanglama
rawatinap(Keele,Neil&Joels,2004).
Kurmamengandungnutrisiyang
bergunabagitubuhdankandungan
glukosanyalebihbesardaribuahbuahan
lainnya(Handita,2010).Kandunganzat
besinyayangtinggimembantu
pembentukanhaemoglobinyangdapat
membantumengangkutoksigenlebih
besarsehinggamembantumempercepat
metabolismedalamsel.Peningkatan
metabolisminiakanmeningkatkan
produksienergiyangbergunauntuk
memperhankanselagartidakrusakdan
membangunkembaliselyangrusak
(Cahyo,2010).
SIMPULANDANSARAN
Hasilpenelitianmenunjukkan:nilai
rataratakadartrombositdarahprepada
kelompokperlakuanadalahlebihkecil
denganrataratakadartrombositdarahpre
padakelompokcontrol,nilairatarata
kadartrombositdarahprepadakelompok
perlakuanlebihkecildarikadartrombosit
darahpost3hari,nilairataratakadar
trombositdarahprekelompokkontrollebih
kecildarinilairataratakadartrombosit
darahpost3haridanPemberianjus
kurmaefektifdalammeningkatkan
trombositdarahpasienDBDpada
kelompokperlakuandengankelompok
kontrol(p=0,039).
Pemberianjuskurmamerupakan
salahsatutambahandietalternatifdalam
meningkatkankadartrombositdarah
pasienDemamBerdarah.Pasienberhak
mengetahuidanmendapatkanalternative
diityangrelatiftidakmahalyangdapat
meningkatkankadartrombositdarah.Hasil
penelitianinidapatdikembangkansebagai
wawasanilmupengetahuandilingkungan
akademisdalampemenuhankebutuhan
nutrisipasien,sehinggamenjadiacuan

sebagaialternatifuntukmeningkatkan
statusnutrisipasienyangmengalami
penyakitDBD.Hasilpenelitianinidapat
dikembangkanlebihlanjutuntuk
membuktikankeefektifanjuskurma
dengandiityangdiberikandarirumahsakit
dengancaramenilaiasupanmakanandari
pasiendenganmetodefoodrecallatau
denganmetodeComstocksehinggadapat
meminimalkanfaktorbiaspenelitian.Perlu
dilakukanpenelitiankadargizipada
berbagaijeniskurmasehinggabisa
menentukankurmajenisaayanglebih
tepatuntukmeningkatkantrombositpada
pasienDemamBerdarahDengue
DAFTARPUSTAKA
Cahyo.A.(2010).SejutaKhasiatSusu
Unta&SariKurma.Sabil,
Semarang.
Deiana.M.(2007).Korelasi
antara
Trombositopenia
dengan
HemokonsentrasisebagaiFaktor
PredisposisiterjadinyaSyokpada
PasienDemamBerdarahDengue
.SkripsiS1Kedokteran.Fakultas
Kedokteran
Universitas
diponegoroSemarang
DinasKesehatanBanyumas.(2005).Profil
KesehatanBanyumas.
Departemen
Kesehatan
Republik
Indonesia.(2005).Pencegahandan
PemberantasanDemamBerdarah
Page 6
JurnalKeperawatanSoedirman(TheSoedirmanJournalof
Nursing),Volume8,No.1,Maret2013

37
DenguediIndonesia.Dep.Kes.RI.
Jakarta
Djunaedi.D.(2006).Demam

Berdarah
dengue[DBD]Epidemiologi,
Imunopatologi,Patogenesis,
DiagnosisdanPenatalaksanaan.
UMMPress.Malang
Duma.N.,Darmawansyah
&
Arsin.AA.(2007).AnalisisFaktor
yangBerhubungandengan
KejadianDemamBerdarah
DenguediKecamatanBaruga
KotaKendari.4(2):91100
Fathi.K.S.&Wahyuni
CU.(2005).Peran
FaktorLingkungandanPerilaku
terhadapPenularanDemam
BerdarahDenguediKota
Mataram,JurnalKesehatan
Lingkungan;2(1):110
HadinegoroS.,SoegijantoS.,Wuryadi
S.,&SerosoT.,(2001).Tatalaksana
DemamBerdarahDenguedi
Indonesia.Dep.KesRI.Jakarta.
HanditaLK.(2010).Manfaat
kurma.

http://yulieee.wordpress.com/2010
/05/07manfaatkurma/.Diakses:20
Oktober2012
Hoffbrand,AV.,Pettit,J.E.,&Moss,P.A.H.(20
05).Kapita
Selekta
Hematologi.Edisi4.EGC.Jakarta
Kandun.(2000).ManualPemberantasan
Penyakit
Menular.Infomedika.Jakarta
Kawthalkar,S.(2006).Essentialof
Haematology.JaepeeBrother
MedicalPublisher(P)LTD.New
Delhi.
Keele.A.Neil.E.&JoelsN.(2004).Samson
WrightsAppliedPhysiology,13th
edition.Oxford
University
Press.NewDelhi.
RahmawanZ.(2006).KupasTuntasKurma
Berdasarkan
AlQuran,As
SunahAshShahihahdanTinjauan
MedisModern.PenerbitMedia
Tarbiyah,Bogor