Anda di halaman 1dari 15

LAPORAN KASUS

PANDANGAN HUKUM PIDANA TERKAIT TEKNIK INTEROGASI


DALAM PENYIDIKAN PADA PERLAKUAN KEKERASAN
TERHADAP PEMBANTU RUMAH TANGGA SERTA DITINJAU
DARI SUDUT PANDANG ISLAM

Hendris Utama Citra Wahyudin


1102011117
Tutor : dr. Yenni Zulhamidah, M.Sc
KELOMPOK 4

BIDANG KEPEMINATAN KDRT


(KEKERASAN DALAM RUMAH TANGGA)
POLRES METRO JAKARTA SELATAN
BLOK ELEKTIF

SEMESTER VII
TAHUN AKADEMIK 2014/2015
UNIVERSITAS YARSI

ABSTRAK
Latar Belakang: Kekerasan dalam rumah tangga kerap sekali dilakukan terutama yang
berhubungan dengan tanpa adanya ikatan darah diantaranya, yakni salahsatunya
kekerasan terhadap pembantu rumah tangga yang termasuk ruang lingkuprumah tangga
dan berakhir kepada penganiayaan.Deskripsi Kasus:Seorangpembantu rumah tangga
yang ditemukan dan dilaporkan ke Polres Pamulang,Tangerang Selatan oleh masyarakat
setempat yang mengalami penganiayaanoleh majikannya dalam keadaan memar sekujur
tubuh karena tidak mengerjakanperintah majikan dengan benar. Diskusi:Pandangan
hukum pidana terkaitteknik interogasi dalam penyidikan terhadap tindak pidana
dalamproses

pelaksanaan

hukum

pidana

serta

dilihat

dalam

hukum

pidana

Islam.Kesimpulan:Baik Hukum pidana Islam maupun Hukum pidana Nasional dalam


penyidikan suatu tindak pidana mengedepankan pembuktian sebagai penentu
dijatuhkannya hukuman karena dari sini terlihat niat yang mencerminkan adanya
pengetahuan dan pilihan pada pelaku utnuk melakukan tindak pidana.

Keyword : Hukum Pidana, Islam, Teknik Interogasi dalam penyidikan.

PENDAHULUAN
Kekerasan dalam rumah tangga (Domestic Violence) kerap sekali dilakukan
olehseseorang atau lebih kepada seorang yang bukan berasal dari lingkup keluarganya
yakni kepada pembantu rumah tangga. Pemicu terjadinya kekerasan ini beragam dan
sering sekali karena pembantu tidak dapat mengerjakan sesuai dengan apa yang
diinginkan oleh majikan. Hal ini sering luput dalam perhatian hukum di Indonesia karena
di satu sisi pembantu memerlukan pekerjaan dan mendapatakan upah kerjanya, tetapi
disisi yang lain jika terjadinya tindak kekerasan banyak pembantu yang tidak melaporkan
diri bahkan terlihat biasa saja atas apa yang dilakukan oleh majikannya. Tindak
kekerasan ini dapat terjadi dalam dua bentuk, yaitu kekerasan terhadap verbal (ancaman
kekerasan) dan kekerasan terhadap fisik yang mana diatur didalam Hukum Pidana.
MenurutMuljanto (1982), Hukumpidanaadalahbagiandaripadakeseluruhanhukum
yang berlaku di suatu Negara, yang mengadakandasar-dasardanaturan-aturanuntuk : 1.
Menentukanperbuatan-perbuatanmana

yang

tidakbolehdilakukan,

yang

dilarang,

dengandisertaiancamanatausanksiberupapidanatertentubagibarangsiapamelanggarlaranga
ntersebut

2.

Menentukankapandandalamhal-halapakepadamereka

yang

telahmelanggarlarangan-laranganitudapatdikenakanataudijatuhipidanasebagaimana yang
telahdiancamkan

3.

Menentukandengancarabagaimanapengenaanpidanaitudapatdilaksanakanapabilaada
orang yang disangkatelahmelanggarlarangantersebut.
LalumenurutAdamiChazawi (2002), Hukumpidanaadalahbagiandarihukum public
yang memuatatauberisiketentuan-ketentuan, tentang : 1. Aturanumumhukumpidanadan
(yang

dikaitkanatauberhubungandengan)

laranganmelakukanperbuatan-perbuatan

(aktifataupositifmaupupasifataunegatif)
disertaidenganancamansanksiberupapidana
laranganitu

2.

tertentu
(straf)

bagi

Syarat-syarattertentu

yang

yang
melanggarlarangan-

(kapankah)

yang

harusdipenuhiatauharusadabagisipelanggaruntukdapatdijatuhkansanksipidana

yang

diancamkanpadalaranganperbuatan yang dilanggarnya ; 3. Tindakandanupaya-upaya


yang bolehatauharusdilakukan Negara melaluialat-alatperlengkapannya (misalnyaPolisi,
Jaksa,

Hakim),terhadap

disangkadandidakwasebagaipelanggarhukumpidanadalamrangkausaha
menentukan,
sertatindakandanupaya-upaya

yang
Negara

menjatuhkandanmelaksanakansanksipidanaterhadapdirinya,
yang

bolehdanharusdilakukanolehtersangkaatauterdakwapelanggarhukumtersebutdalamusaha

melindungidanmempertahankanhakhaknyadaritindakannegaradalamupayanegaramenegakkanhukumpidanatersebut.
Dalamhalinisangatdiperlukanteknikinterogasidalampenyidikan

yang

berupayauntukmencarikepentinganmateriilsebagaisuatukepentinganpenyidik

yang

ditentukandidalamundangundang.Pemeriksaanmerupakansalahsatuteknikmencaridanmendapatkanketerangansaksi
maupuntersangkadalamrangkapenyidikantindakpidanadengancaramengajukanpertanyaan
baiklisanmaupuntertuliskepadatersangkaatausaksi,

gunamendapatkanketerangan,

petunjukpetunjukdanketeranganalatbuktilainnyadankebenaranketerlibatantersangkadalamrangkam
embuatberitaacarapemeriksaan
undangNomor

(BAP).

Tahun

undangHukumAcaraPidana)

UpayapenyidikaninimengacupadaUndang-

1981

tentang

lembarnegaratahun

KUHAP
1981

(KitabUndangNo.3209

yang

mengubahsistempenyidikansecara fundamental.
DESKRIPSI KASUS
SeorangnonabernamaNuryati

(N)

20

tahunpembanturumahtanggadilaporkankePolsekPamulangolehjajaran

RT

dan

RW

sertatetangganyakarenaditemukanterkapartidakberdayadiluarteraskediamanmajikannyaIb
uHj.Aidiar

(AI)

danIbuAfriantie

(AF)padaharikamis

November

2014.

Didugamengalamitindakpenganiayaan yang terjadi di jalan Reni Jaya Blok Y7/19


Rt.02/12, PondokBambu, Pamulang, Tangerang Selatan.
Saatditemui

Nona

(N)

sudahmengalamiberbagaitindakkekerasan,

yakniterlihatdariberbagaimemarditubuhnyadanmatanya yang memerahsertaberbagailukalukadisekujurtubuhsepertilukabekassudutanrokok,


bendaberapiataujejaskarenajeratansuatubenda.
LalusetelahdilaporkankePolsekPamulang,
dibawaolehpolisiPolsekPamulangkePolres
untukditindaklebihlanjut.

Metropolitan

Selatan,
Jakarta

Tetapipadaawalnyasaudari

tetaptidakmengakuiketikaditanyaperihalkekerasan
setelahkurangkebihsatu

Tangerang

jam

dengandibujukakandibelikansarapanakhirnyasaudari

yang

Nona

(N)

Selatan
(N)

terjadipadadirinya,
polisimengintrogasinya,
(N)

mengakuitelahmengalamipenganiayaanolehmajikandansaudaramajikannya.
Metropolitan

Jakarta

Selatan

saudari

(N)melaluilaporan

Di

Polres

model

A,

langsungditerimadandibawakeRumahSakitPusatPertaminauntukmelakukanserangkaianpe
meriksaanfisikataspenganiayaanpadadirinya.
(selakudokterumumsaatitu)

Menurutdr.YanHardiLuthan

menerangkandalamselembarsuratpengantar

sakitsementara

orang

(keterangankesehatandarimedissementara)

untukkepentinganpenyidikansementara.

Dari

hasil

yang

didapatkanpadapemeriksaanklinispadasaudari (N) 20 tahunialah, Index Massa Tubuh 14,


keadaanumumkurusdan

marasmus,

terdapathifemamatakiri,

terasanyeripadaperutkanansejak 5 hari, sertabelumdidapatisaudari (N) inihaid.


Selanjutnyapadapenyidikandanwawancara yang kami lakukankepadasaudari (N)
secaralangsung,
iamengakuisudahseringmengalamipenganiayaanselamamenjadipembanturumahtanggadik
ediamanIbuHj.Aidiar

(AI)

danIbuAfriantie

dialaminyasepertidipukuli,

diinjakperutnya,

(AF).

Diantaranyakekerasan

yang

dipukulidengangagangsapurumah,

dilecutmatadantubuhnyadengansabukpinggang,

di

jeratlehernyadengansabukpinggangsertadisudutisekujurtubuhnyadenganrokokdanlemtem
bakkepadanya.
Dalamintrogasi kami kepadasaudari (N), mengakuibahwaadaseorang yang
turutikutsertauntukmelakukankekerasanyakniIbuAriyati

(AR)

yang

merupakankakakpelaku

yang

kiniturutmenjaditersangkakarenaikutsertadalammelakukanpeganiayaanpadadirinya.
Saudari (N) jugamengakuigajinyabelumdibayarselama 5 bulaniakerjaditempattersangka,
yaknisebesar

Rp.350.000,-

(tigaratuis

Selamabekerjadirumahtersangka,
dicampurgaramselamatiga

kali

lima

puluhribu

rupiah)

per

bulan.

korbanhanyadiberikanmakandengannasi
sehari.Korbanjugamengakuisemulaberatnya

yang
45

kg

(empatpuluhlima kilogram) menjadi 25 kg (duapuluh lima kilogram).


Kini,
PolisiselakupenyidikmenetapkanketigasaudaratersebutmenjaditersangkayakniIbuHj.Aidi
ar (AI), IbuAfriantie (AF) danIbuAriyati (AR) sertadiancamjeratanpasal 170 KUHP dan
44

UU

RI

No.23/2004

tentang

PKDRT

merupakantindakpenganiayaandandilakukansecarabersama (pengeroyokan).

yang

Foto : Bersama korban saudari (N) berseta rekan.


DISKUSI
Pemeriksaan memegang peranan penting dalam dalam kegiatan penyidikan atau
interogasi untuk mencari kebenaran. Pemeriksaan adalah kegiatan untuk mendapatkan
keterangan, kejelasan dan keidentikan tersangka, saksi ahli, dan atau barang bukti
maupun tentang unsur-unsur tindak pidana yang telah terjadi, sehingga kedudukan atau
peranan seseorang maupun barang bukti di dalam tindak pidana tersebut menjadi jelas
dan dituangkan di dalam berita acara pemeriksaan.(Terdapat di dalam Bujuklak,
Bujukmin Proses Penyidikan Tindak Pidana, Mabes Polri, Jakarta, September
2000,hal.230). Berita acara pemeriksaan (BAP) adalah catatan atau tulisan yang bersifat
otentik dan dibuat oleh penyidik atau penyidik pembantu memuat uraian tindak pidana
yang mencangkup unsur-unsur tindak pidana pidana yang dipersangkakan yaitu waktu,
tempat dan keadaan pada waktu tindak pidana dilakukan, identitas penyidik atau penyidik
pembantu dan yang diperiksa dan keterangan yang diperiksa.(Ibid, hal.231). BAP dikenal
sebagai Criminal Justis System dengan Polri sebagai penyidik, Jaksa sebagai penuntut
umum, dan Hakim sebagai pemutus dalam persidangan.

Dalam pembuatan berita acara pemeriksaan diperlukan adanya syarat formil dan
materiil, yaitu formil dengan menulis kata-kata Pro-Justitia yang bermaksud atas dasar
keadilan, serta syarat materiil yaitu keseluruhan isi atau materi menyangkut orang dari
peristiwa tindak pidana yang terjadi dan dapat memenuhi unsur-unsur pasal yang
dilanggar

atau

yang

disangkakan

kepada

pelaku

tindak

pidana.(Terdapat

di

dalamHimpunan Bujuklak, Bujukmin, dan Proses Penyidikan Tindak Pidana, Op.Cit,


hal.235).
Suatu proses untuk mencari kebenaran dalam menyelesaikan suatu sengketa atau
perselisihan kepentingan adalah dengan pembuktian. Menurut M. Yahya Harahap,
menyatakan bahwa pembuktian merupakan titik sentral pemeriksaan perkara dalam
sidang pengadilan. Dimana pembuktian memegang peranana penting dalam proses
pemeriksaan di sidang pengadilan, apabila pembuktian tidak cukup maka seorang
terdakwa wajib dibebaskan apabila sebaliknya aka diberikan sanksi. Maka itu, proses
pembuktian merupakan inti dari penentuan salah atau tidaknya seseorang yang didakwa
dan melalui proses pembuktian dengan alat-alat bukti yang ditentukan. Dalam pasal 148
KUHAP ayat (1) menyatakan, bahwa macam-macam alat-alat bukti sebagai berikut: 1.
Keterangan saksi; 2. Keterangan ahli; 3. Surat; 4. Petunjuk; 5. Keterangan terdakwa.
Alat bukti sebagai keterangan Saksi merupakan alat bukti yang paling utama
dalam perkara pidana, dengan syarat-syarat sebagai berikut: 1. Harus mengucapkan
sumpah atau janji (pasal 160 ayat (3) KUHAP) yang diberikan sebelum memberi
kesaksian; 2. Keterangan saksi yang bernilai sebagai bukti: Yang didengar sendiri oleh
saksi, yang dilihat sendiri oleh saksi, yang dialami sendiri oleh saksi, dan menyebut
alasan dari pengetahuannya; 3. Testimonium de auditu (mendengar orang lain tidak
bernilai sebagai alat bukti) yang merupakan pendapat atau rekaan dari hasil pemikiran
saksi; 4. Keterangan saksi dalam penyidikan yang tercantum didalam BAP sebagai
keterangan saksi di sidang pengadilan oleh Jaksa Penuntut Umum; 5. Keterangan saksi
yang tidak cukup dapat didukung dengan alat bukti lain untuk membuktikan kesalahan
terdakwa atau tersangka.
Alat bukti sebagai keterangan Ahli merupakan keterangan yang diberikan oleh
seorang yang memiliki keahlian khusus, misalnya seorang dokter yang memberikan
kesaksian terkait pemeriksaan pada korban. Dalam pasal 120 KUHAP bahwa, dalam hal
penyidikan menganggap perlu, ia dapat meminta pendapat orang ahli atau orang yang

memiliki keahlian khusus. Pada pasal 133 KUHAP, dalm hal penyidikan untun
kepentingan peradilan menangani seorang korban baik luka, keracunan ataupun mati
yang diduga karena peristiwa yang merupakan tindak pidana, ia berwenang mengajukan
permintaan keterangan ahli kedokteran kehakiman atau dokter dan ahlinya. Dalam ayat
(1) melalui surat tertulis dan disebutkan dengan tegas. Dalam pasal 179 KUHAP, setiap
orang yang diminta pendapatnya sebagai ahli kedokteran kehakiman atau dokter ahli
lainnya wajib memberikan keterangan ahli demi keadilan.
Alat bukti sebagai surat diatur dalam pasal 187 KUHAP yang mana dibuat atas
sumpah jabatan atau dikuatkan dengan sumpah yakni surat dalam bentuk resmi yang
dibuat oleh penjabat umum berwenang atau dibuat dihadapannya; surat yang dibuat
menurut perundang-undangan mengenai hal yang termasuk tatalaksana; surat yang
memuat dari keterangan ahli berdasarkan keahliannya; surat lain yang berhubungan
dengan alat pembuktian yang lain. Surat ini merupakan alat bukti yang sempurna dan
mempunyai nilai pembuktian kekuatan yang kuat dimata hakim.
Alat bukti sebagai petunjuk dalam pasal 188 KUHAP adalah merupakan suatu
perbuatan, kejadian atau keadaan antara satu dengan yang lainnya dengan tindak pidana
itu sendiri, menandakan bahwa telah terjadi suatu tindak pidana dan siapa pelakunya.
Petunjuk tersebut diperoleh dari keterangan saksi, surat, dan keterangan ahli yang mana
penilaian dan kekuatan pembuktian tersebut dilakukan oleh hakim dengan arif lagi
bijaksana. Alat bukti ini diperlukan bila alat bukti yang lain belum mencukupi batas
minimun pembuktian yan ditentukan dalam pasal 183 KUHAP selama bergantung pada
alat bukti yang lain.
Alat bukti sebagai keterangan terdakwa merupakan hal yang disampaikan
dalam sidang pengadilan. Keterangan terdakwa lebih luas dari pengakuan terdakwa.
Proses pembuktian tetap dijalankan sekalipun terdakwa mengakui, dan jaksa penuntut
umum tetap berkewajiban membuktikan kesalahan terdakwa dengan alat bukti yang lain.
Menurut pasal 189 ayat (4) KUHAP, keterangan terdakwa dinyatakan disidang tentang
perbuatan yang dialaminya sendiri dan diketahuinya, serta hanya dapat digunakan
terhadap diri.
Tidakluputbahwapembuktianjugasangatpentingdalam

proses

mencarikebenarandalammenyelesaikanberbagaiperselisihankepentingandalampenyidikan.
Teoripembuktiandikenaldenganempat

system;

1.Convection

in

Timeyaitu

system

pembuktiandalammenentukankesalahanterdakwasemata-mataolehpenilaiankeyakinan
hakim;

2.Conviction

in

Raisoneyaitumasihberdasarkanpada

tetapibersifatterbatasterutamapada

alas

an

yang

keyakinan
bersifatrasional;

hakim
3.

Sistempembuktiansecarapositifyaituberdasarkanundangundangdanalatbuktitanpamenyertakankeyakinan

hakim;

4.Sistempembuktiannegatif

(negatifwettwlijk) yaitugabungansistempembuktianpostifdankeyakinan hakim.nya sendiri.


Dilakukannya

penghentian

penyidikan

adalah

merupakan

suatu

tindak

penghentian dilakukannya salah satu kegiatan penyelesaian perkara apabila: 1. Tidak


terdapat cukup butki; 2. Peristiwa tersebut bukan merupakan tindak pidana; 3. Demi
hukum karena: a. tersangka meninggal dunia, b. tuntutan pidana telah kadaluarsa, c.
Nebis en idem (tindak pidana tersebut telah peroleh putusan hakimyang mempunyai
kekuatan hukum tetap) dengan mengeluarkan Surat Perintah Penghentian Penyidikan
(SP3).
Dalam perspektif Hukum Islam, ternyata hukum Islam sudah menjadi pionir sejak
14 abad yang lalu dalam menerapkan hukum yang berlandaskan kepada sumber yang
valid dan akurat, yaitu Al-Quran dan Sunnah Nabi Muhammad SAW yang merupakan
sumber asli agama Islam. Tetapi berjalannya waktu dengan pemikiran-pemikiran baru
beranggapan bahwa hukum Islam sudah ketinggalan zaman dan beralih kepada hukum
modern. Anggapan ini merupakan kesalahan yang sangat besar karena telah
membandingkan dengan syariat Islam dengan hukum modern dan mengklaim tidak
selaras lagi. Padahal hukum Islam hadir sebagai penyempurna hukum-hukum lain.
Sebagai bukti keberlakuan hukum Islam di Indonesia memiliki 2 alasan, yaitu pertama,
berlakunya hukum Islam secara normatif, artinya hukum Islam yang mempunyai sanksi
kepada masyarakat apabila di langgar, terutama yang mengatur hubungan anatar manusia
dengan Tuhan dan sangat bergantung kepada keimanan ummat Islam itu sendiri. Kedua,
bentuk hukum Islam seacara yuridis formal, yaitu bagian hukum yang mengatur
hubungan antara manusia dan hubungan manusia dengan mahluk lainnya. Di Indonesia
hukum Islam dijadikan sebagai hukum positif.
Dalam Hukum Islam turut mengenal berbagai asas, pertama adalah Asas
Legalitas dalam hukum pidana Islam (Fiqh Jinayah) berbunyi: Tidak ada tindakan
pidana dan tidak ada sanksi hukuman atas segala sesuatu tindakan tanpa ada aturannya
atau Tidak ada pelanggaran dan tidak ada hukuman sebelum ada undang-undang yang

mengaturnya. (Muhammad Daud Ali, Hukum Islam; Pengantar Ilmu Hukum dan tata
Hukum Islam di Indonesia, (Jakarta:Raja Grafindo Persada, 2005), hal.131). Asas ini
didasarkan pada Al-Quran surat Al-Isra ayat 15,(penggalan ayat)

Artinya

Kami tidak

dan
akan

mengazab sebelum Kami mengutus seorang Rasul. (Surat Al-Isra : 15).


Lalu pada surat Al-Qashsash ayat 59, (arti hanya penggalan ayat)

Artinya : Dan tidak adalah Tuhanmu mebinasakan kota-kota, sebelum Dia mengutus di
ibukota itu seorang Rasul yang membacakan ayat-ayat Kami kepada mereka (Surat
Al-Qashash : 59)
Kedua ayat diatas menerangkan bahwa Allah SWT tidak akan mengazab kepada siapapun
kecuali telah diutusnya para Rasul sebagai pembawa kebenaran. Menurut Mazhab
Syafii: Hukum yang pokok dari segala sesuatu itu adalah boleh, sehingga terdapat dalil
yang mengharamkannya. Lalu yang kedua dalam Islam adalah Asas tidak berlaku
surut (the principal of non retro activity) yang dalam hukum pidana umum juga tidak
mengenal asas retroaktif. Asas ini yang berarti bahwa Undang-undang harus berlaku
hanya bagi perbuatan yang dilakukan setelah diundangkannya ketentuam tersebut. Dalam
Hukum Islam juga demikian dimana hanya dikenakan hukuman menurut aturan pidana
yang berlaku pada waktu terjadinya jarimah. Rasul berpidato do haji perpisahan yang
berisi: Setiap kesalahan darah yang terjadi di masa jahiliyah harus dihapuskan dan aku
mulai dengan tuntutan dari Al Hirath Ibnu Abd Al-Muthalib, riba yang dilakukan selama
periode itu juga dihapuskan mulai dari riba pamanku, Al Abbas ibnu Abd Al-Muthlaib.

(Topo Santoso, Op.Cit., hal.118). Kecuali pada dua hal dapat berlaku surut yaitu
pertamaQidzaf (perzinaan) diterangkan didalam surat An-Nur ayat 4:

Artinya: Dan orang-orang yang menuduhwanita-wanita yang baik-baik (berbuatzina)


danmerekatidakmendatangkanempat
menuduhitu)

orang

saksi,

makaderalahmereka

delapanpuluh

kali

danjanganlahkamuterimakesaksianmerekabuatselama-lamanya.

(yang
dera,

Dan

merekaitulah

orang-orang yang fasik.(Surat An-Nur : 4).


KeduaHirabah (pemberontakan atau perampokan) diterangkan didalam surat AlMaidah ayat 33:

Artinya: Sesungguhnyapembalasanterhadap orang-orang yang memerangi Allah


danRasul-Nyadanmembuatkerusakan
hanyalahmerekadibunuhataudisalib,

di

mukabumi,

ataudipotongtangandan

kaki

merekadenganbertimbalbalik, ataudibuangdarinegeri (tempatkediamannya). Yang


demikianitu

(sebagai)

suatupenghinaanuntukmerekadidunia,

dan

di

akhiratmerekaberolehsiksaan yang besar (Surat Al-Maidah : 33).


Berikutnya Asas yang ketiga adalah Asas praduga tak bersalah, sudah jauh lebih
dulu diterapkan dalam hukum pidana Islam sebelum hukum pidana positif karena Islam
mengajarkan ummatnya untuk tidak dihukum tanpa butki yang kuat. Setiap orang

dianggap tidak bersalah untuk suatu perbuatan jahat, sebelum dibuktikan kesalahan atau
kejahatannya tanpa ada keraguan, jika suatu keraguan yang beralasan muncul, seseorang
tertuduh harus dibebaskan. Dalam hal ini lebih baik seorang hakim menghukum bebas
daripada salah dalam menetapkan hukuman bagi tersangka. (Nagaty Sanad, The Theory
of Crime and Criminal responsibility in Islamic, dalam Topo Santoso, Op.Cit,.hal.14)
Asas yang terakhir adalah Tidak sahnya hukuman karena keraguan, yaitu
batalnya keraguan karena ada keraguan didalamnya. Hal ini dijelaskan hadist Nabi
Muhammad SAW, yaitu: Hindarkan hudud dalam keadaan ragu, lebih baik salah
dalam

membebaskan

dari

pada

salah

dalam

menghukum.(Topo

Santoso,

Op.Ciy.,hal.120). Menurut Mazhab Syafii keraguan muncul karena tiga hal: 1. Keraguan
terkait tempat, 2. Keraguan disebabkan oleh pelakunya, 3. Keraguan formal (muncul
karena tidak sepakat antara fuqaha untuk suatu masalah).
Hukum Islam mengharuskan adanya perbuatan maksiat atau perbuatan melawan
hukum untuk menjadikannya sebagai suatu sebab adanya pertanggung jawaban pidana.
Karena sebab (faktor) dijadikannya oleh syari sebagai pertanda menentukan atau
menghasilkan musabab (sebab dari timbulnya suatu sebab). Dengan demikian perbuatan
maksiat atau melanggar hukum harus memiliki pertanggungjawaban karena merupakan
melanggar perintah agama atau mengerjakan sesuatu yang dilanggar didalam agama.
(Topo Santoso, Menggagas hukum pidana Islam, Op.Cit hal.166). Sebagai syarat
dijatuhkannya hukuman yaitu dengan adanya pengetahuan dan pilihan pada pelaku.
Dalam hukum Islam term kemaksiatan atau melanggar hukum dapat disamakan dengan
term tersalah dan pelanggaran yang ada dalam istilah hukum konvesioanal. Dan memiliki
makna yang sementik dengan menyalahi perintah syari.(Alie Yafie, Umar Shihab,
Ahmad Sukaraja dkk, Ensiklopedi Hukum Pidana Islam, Op.Cit.hal.75)
Perbuatan melawan hukum atau kemaksiatan merupakan prinsip untuk
pertanggungjawaban pidana, dan perbuatan tersebut memiliki tingkatan sesuai dengan
niat, karena dari niat menujukan bahwa pelaku memiliki pengetahuan dan pilihan.
Diantara terdapat 4 tingkatan, yaitu: 1. Adakalanya disengaja (Al-Amdu), 2. Adakalanya
menyerupai disengaja ( Syibhu amdi), 3. Adakalanya keliru (Al-Khata), 4. Adakalanya
menyerupai kekeliruan. Satu riwayat menyebutkan bahwa ketika Ali bin Abi Thalib
berkata kepada Umar bin Khatab : Tahukah engkau terhadap siapa kebaika dan
kejahatan itu tidak dicatat dan mereka tidak bertanggungjawab terhadap apa yang

dilakukannya, yaitu orang yang gila sampai dia waras, anak-anak sampai dia
baligh(puber), dan orang yang tidur sampai dia bangun. Syariat Islam menolak
pengujian untuk menentukan masalah abnormalitas dan kriminalaitas yang bermaksud
tidak ada tindakan yang dikatan kriminal jika pelaku mengalami kehilangan mental atau
adanya dorongan yang membuat orang tersebut tidak terkendali.(Shetan, Jehangir M.J,
Mental Abnormality and Crime is Contributon to Synthetic Jurisprudence, dalam
A.Rahman I, Doi, Penjelasan lengkap hukum-hukum Allah (syariah), Ibid, hal.286.)
Unsur yang mengakibatkan pertanggungjawaban pidana adalah adanya unsur
melawan hukum dan adanya kesalahan.
KESIMPULAN
Hukum Islam hadir sebagai penyempurna hukum-hukum lain. Sebagai bukti
keberlakuan hukum Islam di Indonesia memiliki 2 alasan, yaitu secara normatif
(Ketuhanan) dan yuridis formal (sesama manusia) dan dituangkan kedalam hukum positif
(Hukum pidana) Indonesia. Dalam Islam segala sesuatu adalah hukumnya boleh sampai
ada nash yang mengatur keharamnya. Pembuktian dalam Hukum pidana Islam dan
Hukum pidana Nasional sama-sama mengedepankan adanya butki tindak kejahatan yang
mana jika tidak cukup bukti kuat, lebih baik terdakwa dibebaskan dari hukum daripada
salah dalam memberi hukuman serta melihat motif dilakukannya tindak kejahatan
tersebut dari niat karena niat menejelaskan bahwa pelaku memiliki pengetahuan dan
pilihan dalam melakukan suatu tindak pidana.

UCAPAN TERIMA KASIH


Assalamualaikum Wr Wb.
Saya panjatkan puji serta syukur atas kehadirat Allah SWT Tuhan semesta alam, atas
berkat rahmat dan taufik-Nya kita dapat merasakan manisnya iman dan kesehatan walafiat
serta saya dapat menyelesaikan tugas laporan kasus ini dengan baik. Shalawat dan salam juga
semoga selalu tercurah kepada baginda Nabi Muhammad SAW atas hijrah beliau yang
membukakan suatu pintu zaman dengan ilmu pengetahuan.
Saya ucapkan terima kasih kepada tutor kami dr.Yenni Zulhamidah,Msc, yang rela
membagi kesibukannya untuk membimbing tugas kami dari awal sampai selesai. Saya juga
ucapkan terima kasih kepada dr. Ferryal Basbeth, Sp.F DFM dan DR.Zuhroni M.Ag, yang
turut memberikan pengantar serta kuliah pengampu untuk dilakukannya laporan kasus ini.
Ucapan terima kasih juga saya berikan kepada IPTU Nunu Suparni selaku Kepala Unit
PPA (Pelayanan Perempuan dan Anak) Polres Metro Jakarta Selatan, atas kesediannya
memberikan ilmu serta membimbing kami untuk menyelesaikan tugas kami dilapangan.
Dan terima kasih saya ucapkan kepada teman-teman kelompok 4 kepeminatan
Domestic Violence (KDRT) atas kerjasamanya selama kegiatan untuk [enyusunan laporan
kasus ini berlangsung.
Saya menyadari betul bahwa tulisan saya ini masih banyak sekali kekurangan dalam
penyajiannya, maka itu sangat sekali dibutuhkan masukan dari Ibu/Bapak serta rekan sekalian
untuk dapat memberikan masukan kepada saya. Saya ucapkan terima kasih.
Wassalamualaikum Wr Wb.

Salam kami,

Hendris Utama Citra Wahyudin

DAFTAR PUSTAKA
http://www.alquran-indonesia.com/. Al-Quran. Dikutip pada Minggu, 15 Novenber 2014.
Kitab Undang-undang Hukum Pidana (KUHP)
http://repository.usu.ac.id/handle/123456789/5296, Usammah, Pertanggungjawaban Pidana
Dalam Perspektif Islam, Thesis, 2009. Dikutip pada Sabtu, 14 November 2014.
http://usupress.usu.ac.id, Dasar-dasar Hukum Pidana. Dikutip pada Sabtu, 14 November
2014.
http://yahmanaldi.blogspot.com, Teknik Interogasi Dalam Penyidikan, 2013, Dr.Yahman,
SH,MH. Dikutip pada Sabtu, 14 November 2014.