Anda di halaman 1dari 15

Menggagas pembelajaran anatomi pada

kurikulum berbasis kompetensi untuk


pendidikan kedokteran dasar
MENGAPA ANATOMI PERLU DIAJARKAN?
Ada beberapa hal perlu dibahas mengapa
anatomi perlu dipelajari:

1. Pengetahuan tentang struktur tubuh manusia dari apa yang terlihat dengan mata
telanjang
(makro anatomi) sampai ke tingkat molekular merupakan hal mendasar untuk
memahami fungsi tubuh dan bagaimana struktur maupun fungsi berubah karena
penyakit. Di dalam praktek kedokteran, peran anatomi sangat luas. Palpasi,
auskultasi, perkusi, akses arteri dan vena, laparoskopi, arthroskopi, pemblokiran
saraf, drainase cairan dari rongga-rongga tubuh, serta pemahaman terhadap
berbagai macam manifestasi trauma,merupakan beberapa dari praktek kedokteran
yang saat inimembutuhkan pengetahuan tentang anatomi.

2. Beberapa dasa warsa terakhir ini terjadi perkembangan yang luar biasa berupa
teknikteknik untuk pencitraan anatomi pada pasien hidup. Contohnya mulai dari
endoskopi dan laparaskopi sampai ke computed tomography (CT) danmagnetic
resonance imaging (MRI), serta pengembangan teknologi baru untuk visualisasi
tiga-dimensi. Perkembangan teknik pencitraan yang canggih ini disertai pula
1

dengan pengembangan terapi invasif minimal yang ditujukan pada organ-organ


dan/atau tempat tempat tetentu didalamnya. Oleh karena itu, pengetahuan tentang
makroanatomi menjadi semakin penting, tidak hanya untuk menginterpretasi citra
hasil teknik yang canggih tersebut, tetapi juga untuk memahami jalan yang
ditempuh untuk mencapai target terapi pada tempat yang spesifik

3. Pendidikan anatomi untuk undergraduate di fakultas kedokteranmempunyai


banyak

faset:

mengenalkan

kematian;mengembangkan

kepada

ketrampilan

mahasiswa
psikomotor;

terhadap

realitas

menegaskan

konsep

variabilitas biologis dan memperlihatkan perubahanperubahan patologis yang


umum;mengajarkan
komunikasi;

terminologi

danmemberi

Anatomimerupakan

medis;

petunjuk

membantu

interaksi

sosial

bagaimanamengakses

ilmu

pengetahuan

dan

informasi.
deskriptif

yangmengenalkanmahasiswakepada bahasamedis.Diperkirakan bahasa ini terdiri


tidak

kurang

dari

10.000

istilah.

Istilah

tersebut,

majoritas

dijumpai

dimakroanatomi.

4. Pengurangan waktu pembelajaran anatomi di


dalam kurikulum diduga menyebabkan generasi baru ahli bedah.Hal ini
didasarkan pada laporan bahwa antara tahun 1995 dan 2000 ada peningkatan tujuh
kali lipat tuntutan hukum yang berhubungan dengan kesalahan anatomis yang
ditujukan padaMedical Defence Union di Inggris. Juga di Amerika Serikat
diungkapkan oleh Cahill et al. (2000)1 bahwa dari 80.000 kematian yang dapat

dicegah per tahun, setidaktidaknya sebagian dapat digolongkan karena ketidakkompetenan anatomis.

KURIKULUMINTIANATOMI
Monkhouse (1992)4 berpendapat bahwa pembelajaran anatomi di tingkat
undergraduate

seharusnya

ditujukan

untuk

disiplin

yang

pendidikan

postgraduatenya tidakmenyertakan pembelajaran anatomi di dalamya misalnya


dokter umum. Setelah lulus menjadi doktermereka secara formal tidak akan
belajar anatomi lagi. Untukmereka itulah basis yang diberikan di kurikulum
anatomi undergraduate harus relevan dan terjamin. Oleh karena itu, para pengajar
anatomi harus mengidentifikasi kurikulum inti anatomi yang seharusnya diketahui
olehmahasiswa kedokteran. AACA (American Association ofClinical Anatomists)
telah membuat dokumen kurikulum yang menjamin tercapainya dasar anatomis
yang kuat untuk praktek kedokteran saat ini dan di masa mendatang.
AACAmengajukan konsep anatomis dan subyek bahasan kurikulumanatomi klinis
guna mempersiapkan mahasiswa untuk kelak menjadi dokter yang tidak saja
paham rasional dan keterbatasan dari prosedur klinik berdasar anatomi, tetapi
yang lebih penting lagi paham akan prosedur klinik yang dapat dibangun di atas
landasan tersebut Dokumen tersebut menekankan pentingnya terminologi
anatomi, variasi normal,hubungan-hubungan tiga dimensi, anatomi fungsional dan
living anatomy, dan teknologi pencitraan yang digunakan untuk pelayanan pasien.
Netherlands Association of Anatomists (NAA) pada tahun 1999 mempublikasikan

General Plan Anatomy: Objectives of the teaching of anatomy/ embryology


inmedical curricula in the Netherlands. Appendix 1 dari General Plan Anatomi
berisi Discipline-related objectives Anatomy yang sangat terinspirasi oleh AACA.
Berbeda dengan konsep AACA,subyek bahasan di appendix 1General Plan
Anatomy dimulai dengan bab Anatomi Terapan untukmenunjukkan bahwa bab
berikutnya Anatomi Sistematik menyajikan kondisi yang diperlukan untuk
membuat anatomi praktis pada basis kausal. Anatomi terapan dibagi menjadi dua
paragraf: Anatomi Fungsional dengan contoh proses dan situasi yang
membutuhkan pemahaman anatomi yang kuat, dan Anatomi Radiologis
yangmenyajikan contoh citra kondisi normal dan abnormal dimana pengetahuan
anatomiwajib diketahui. Isi appendix 1 General Plan Anatomi mirip dengan
Clinical Anatomynya AACA tetapi sudah disesuaikan dengan kondisi setempat di
Belanda. Menurut mereka General Plan Anatomy lebih sedikit daripada Clinical
Anatomynya AACA dalam hal struktur yang dibahas.12 Gambar 1. Konsep
anatomi yang mengikat subyek didalam kurikulum makroanatomi menjadi suatu
bentuk yang dapat diterapkan secara klinis digambarkan di dalam bentuk hirarki
piramidal11. NAA telah melangkah lebih jauh lagi dengan mengadakan
simposium Teaching of Anatomy/Embryology untuk implementasi General Plan
Anatomy. Perhatian khusus ditujukan untuk menjaring pendapat para klinisi
mengenai kegunaan praktis dokumen tersebut. Van Engelshoven danWilmink
(2001) .keduanya klinisi, memandang bahwa di dalam General Plan Anatomy
pengurangan materi tidak terealisasi.Mereka berpendapat bahwa daftar obyektif
terkait disiplin sangat komprehensif.Mereka paham bahwa akan sangat sulit bagi

para ahli anatomi untuk mengurangi bahan ajar merekasendiri. Menurut mereka
diskusi dengan klinisidiperlukan untuk mendefinisikan apa yang relevan secara
klinik, karena relevansi ini akan sangat berbeda bagi seorang dokter umum
dibanding dengan ahli bedah ortopedi, ahli tumor, atau radiolog. Dyball et al.
(2003)14 melalui The Anatomical Society of Great Britain and Ireland (ASGBI)
mempublikasikan:Setting a benchmark for anatomical knowledge and its
assessment (A core corriculum for teaching anatomy to medical students).
Dokumen tersebut meskipun lebih pendek dibandingkan dengan General Plan
Anatomy, mencakup landasan yang sama. Merespon berlakunya KIPDI III,
dengan belajar dari perhimpunan-perhimpunan anatomi di berbagai negara,maka
seharusnya PAAI (Perhimpunan Ahli Anatomi Indonesia), dengan bekerja sama
dengan para klinisi, mulai memikirkan untuk membuat dokumen kurikulum inti
anatomi pendidikan dokterdi Indonesia

BAGAIMANA ANATOMI DI AJARKAN ?


Isu pokok mengenai bagaimana dan kapan anatomi diajarkan berkisar pada
keuntungan dan kerugian penggunaan cadaver dan teknologi komputer, serta
apakah anatomi diberikan secara terintegrasi atau non-integrasi. Keuntungan
pemakaian cadaver antara lain adalah1,6:Proses diseksimemberikan kepada
mahasiswa pandangan 3 dimensi anatomi manusia; diseksi memperkuat dan
mengelaborasi pengetahuan yang diperoleh pada waktu mengikuti kuliah dan
tutorial; integrasi anatomi pada organisme secara keseluruhan juga dianggap
keunggulan dari pembelajaran secara tradisional; studi pada cadavermemberikan

kesempatan untukmengapresiasi rentang variabilitas yang terdapat pada


materialmanusia yang sesungguhnya dibandingkan dengan apa yang diuraikan
dalamtextbook dan pada peraga plastik; belajar di ruang diseksi merupakan
pengenalan terhadap self-directed learning dan teamworking; penggunaan cadaver
dapat dipakai sebagai media untuk pembelajaran terhadap isueisue moral dan
etikal. Sedangkan kerugiannya dikemukakan olehMcLachlan et al. (2004) sebagai
berikut.17 Sehari-hari seorang dokter umum berhadapan dengan anatomimelalui
duamodalitas: living anatomy dan pencitraan medis. Diseksi dan proseksimungkin
bukanmerupakan penggambaran yang baik untuk living anatomy. Berhubung
keadaannya, cadaver tidak responsif terhadap gerak dan investigasi interaktif
misalnya palpasi dan perkusi. Informasi yang didapat dari diseksi tidak siap untuk
diterjemahkan ke dalamgambaran crosssectional yang dihasilkan melalui berbagai
pencitraan. Proses fiksasi secara bermakna juga merubah warna dan tekstur
jaringanmanusia, yang tentu sangat berbeda keadaannya dengan apa yang terlihat
pada pembedahan.Terlepas dari pro dan kontra penggunaan cadaver, berbagai
penelitian telah dilakukan terhadap kegunaan diseksi dalam pembelajaran
anatomi.Ternyata waktu yang dihabiskan di meja diseksi bukan merupakan cara
paling efisien untuk belajar. Penggunaan proseksi dan berbagaimedia bantu lain
untukmengajarmemberi hasil yang sama bagusnya di dalam pembelajaran
pengetahuan anatomi. Diseksimempunyai keterbatasan.Diseksi tidak baik untuk
pembelajaran beberapa area pentingmisalnya osteologi, sistem saraf (terutama
saraf yang kecilkecil), anatomi permukaan, anatomi organ kecil atau yang tidak
jelas batasnya (misalnya glandula parathyroidea, suprarenal, epiphyse, atau

pancreas, sistem limfe dan lain-lain). Untuk itu dibutuhkan media alternatif,
misalnya

skeleton

yang

sudah

lepas/model

skeleton,

filmradiologis,

proseksi,model plastinasi, simulasi komputer dan lain-lainnya. Di Inggris pada


tahun 2002 didirikan fakultas kedokteran yang tidakmenggunakan cadaver untuk
pembelajaran anatominya.18Sebagai ganti cadaver mereka menggunakan
kombinasi antara living anatomy,model plastik, contoh-contoh pencintraan medis
dilengkapi dengan portable ultrasound scanners, pencitraan tiga-dimensi dan
animasi, serta penggunaan simulator. General Medical Council (GMC), yang
bertanggung jawab menyusun standard untuk pendidikan undergraduate
mengatakan bahwa perhatian utama mereka pada outcome, bukan pada
proses.Namun demikian, personelGMC akan memvisitasi fakultas kedokteran
tersebut apakah standardnya dijaga. Bagaimanapun juga, perbandingan hasil
pembelajaran anatomi antara yang didapat melalui diseksi cadaver dan yang
didapatmelaluimedia ajar yang lain sampai saat ini belum bisa dilakukan. Dari
uraian di atas dapat disimpulkan bahwa diseksi anatomi nampaknya akan tetap
ada, tetapi tidak untuk undergraduate. Diseksi hanya untuk postgraduate,
misalnya untuk mendidik calon ahli bedah. Sebaliknya penggantian cadaver
seluruhnya dengan media ajar lain membutuhkan teknologi tinggi dan biaya yang
tidak sedikit. Metode pengajaran anatomi dapat dibedakan menjadi integratif dan
non-integratif. Pembelajaran anatomi secara non-integrasi dilakukan pada
pendidikan tradisional, dan umumnya diberikan pada tahun pertama, dilanjutkan
pada tahun kedua, setelah itu anatomi tidak diberikan lagi. Sedangkan yang
terintegrasi antara lain terdapat pada institusi-institusi pendidikan dokter

yangmenggunakan
diberikan

baik

sistemProblem-based
bersama-sama

dengan

learning

(PBL).Di

ilmu-ilmu

dasar

sini
lain

anatomi
(integrasi

horisontal)maupun dengan ilmu-ilmu klinik (integrasi vertikal). Berbeda dengan


cara yang nonintegratif, pembelajaran anatomi secara terintegrasi diberikan mulai
dari awal sampai akhir pendidikan dokter. Prince et al.(2003)melakukan survey
terhadap mahasiswa tahun ke empat dari berbagai fakultas kedokteran di Belanda.
Hasilnya menunjukkan bahwa pengetahuan anatomi mahasiswa dengan sistem
PBL tidak lebih rendah dari pengetahuan anatomi dari mahasiswa yang berasal
dari

fakultas

yangmelakukan

pendekatan

pendidikan

yang

lebih

tradisional.Namun McKeown et al. (2003) melaporkan hasil yang berbeda.


Mereka melaporkan bahwa kurikulum anatomi terintegrasi mempunyai dampak
negatif terhadap pengetahuan mahasiswa mengenai anatomi permukaan.

SIAPA YANG MENGAJAR?

Dokumen kurikulum inti anatomi, baik yang di kemukakan oleh AACA (1996)11 ,
NAA (1999)12 maupun ASGBI (2003)14, mengisyaratkan bahwa pengajar
anatomi adalah orang yang memahami masalah-masalah kedokteran. Dengan
demikian, idealnya seorang ahli anatomi juga seorang dokter. Beberapa isu pokok
tentang pengajar anatomi yang ada perlu dikemukakan yaitu kecenderungan untuk
semakin turunnya jumlah dan kualitas pengajar anatomi serta kecenderungan
semakin populernya PBL didalam sistem pendidikan dokter, yang mengisyaratkan

bahwa tugas utama pengajar adalah sebagai fasilitator sehingga penguasaan ilmu
pada disiplin tertentu tidak perlu dikuasai.Ada berbagai penyebab berkurangnya
ahli anatomi. Survey di Amerika Serikat dan Kanada menunjukkan bahwa peran
dan kebutuhan akan ahli anatomi yang terlatih dalam pendidikan dokter menurun
sejalan

dengan

reformasi

kurikulum

ke

arah

yang

lebih

student-

centered.Menurunnya ahli anatomi yang terlatih jugamenggambarkan praktek


umum bahwa kemampuan anatomi lebih di hargai oleh karena riset yang
dilakukannya dibandingkan dengan waktu yang dihabiskannya untukmengajar.
Situasi ini ironisnya mengarah kepada pengertian bahwa ahli anatomi akan bisa
meningkat karirnya dengan cepat hanya apabila mereka mereka meminimalkan
keterlibatan mereka pada disiplin akademik yang tradisional. Tekanan untuk dapat
melakukan

riset

menyebabkan

perubahan-perubahan

di

sebagian

besar

departemen anatomi di Amerika Serikat dan program-program graduate


mereka.Nama departemen diubah untukmenunjukkan perluasan aktivitas riset
mereka serta untuk menarikmahasiswa graduate. Di Amerika Serikat dan Kanada
pemotongan kurikulum menyebabkan mahasiswa kedokteran yangmengambil
kursus-kursus

anatomi

berkurang.

Demikian

pulamahasiswa

kedokteran

yangmemilih karir akademik di bidang anatomi berkurang. Akibatnya, pos-pos di


departemen anatomi banya diisi oleh mereka yang non-dokter bahkan yang
pendidikan undergraduatenya jauh dari anatomi. Karena kekurangan personel
kadang-kadang mahasiswa graduate yang berlatar belakang non anatomi di
departemen anatomi, di latih anatomi sekedarnya kemudian diberi tugas mengajar
atau sebagai demonstrator. Apabila hal ini tidak dicegah, McCuskey et al.(2005)

mengkhawatirkan timbulnya risiko untuk mencetak generasi para profesional


kesehatan ahli bedah, radiologis, internis, ners, dokter gigi, ahli rehabilitasi, ahli
farmasi dan lain-lain yang pengetahuan mengenai struktur dan fungsi tubuh
terutama datang dari para instruktur yang belajar anatomi sejenak sebelum mereka
mengajar hari itu. Solusi-solusi yang diajukan untuk mengatasi kelangkaan
pengajar adalah sebagai berikut.5,7 Di tingkat institusi adalah memberikan kepada
mereka yang menunjukkan kompetensi pada disiplin ilmuini, kompensasi yang
sebanding dengan waktu yang digunakannya untuk memperoleh pengetahuan
yang menyeluruh mengenai anatomi dan kemudian mengajarkannya secara efektif
kepadamahasiswa. Di tingkat nasional,masalah ini bisa diatasi dengan pemberian
dana-dana pelatihan termasuk pelatihan untuk pengajaran anatomi. Meskipun
belum ada survei, dari pembicaraan-pembicaraan dengan Sejawat dari bagian
anatomidari berbagai fakultas kedokteran kelangkaan tenaga pengajar anatomi
juga terjadi di Indonesia. Terlebihlebih bagi yang akan menganut PBL, rekrutmen
mahasiswa pembantu, yang sangat penting perannya sebagai demonstrator dalam
pendidikan anatomi, kemungkinan akan menjadi lebih sulit. Oleh karena itu
solusi-solusi seperti yang dikemukakan oleh Collins et al. (1994)5 danMcCuskey
et al. (2005)7 tersebut di atas juga relevan untuk dikemukakan di sini.Sementara
itu dengan bagian-bagian klinik yang membutuhkan dasar anatomi yang kuat
diadakan pembicaraan-pembicaraan untuk memasukkan kewajiban sebagai
demonstrator anatomi dalam kurikulum mereka, atau untukmemprioritaskan calon
yang pernah bekerja di anatomi sebagai input.

10

Pengaruh Pemberian Etanol Secara


Kronik Terhadap Jumlah Sel
Piramidal di Ca1 Hippocampus
Tikus (Rattus Norvegicus) Remaja
PENGANTAR
Etanol atau alkohol termasuk dalam kelompok NAPZA (narkotika, alkohol,
psikotropika, dan zat

adiktif lainnya). Diprediksi sekitar 1,5%dari seluruh

populasi penduduk Indonesiamerupakan penyalahguna NAPZA, dengan estimasi


terakhir mencapai lima juta jiwa.Di Indonesia pengungkapan kasusnya meningkat
rata-rata 28,9%per tahun1. Usia remajamerupakan usia bagi banyak orang
mulaimencobamengkonsumsi etanol. Usia remaja adalah saat terjadinya
neuromaturasi, hal ini menyebabkan otak lebih rentan terhadap kerusakan akibat
etanol dibanding dengan otak pada usia dewasa yang relatif stabil2,3. Komplikasi
fisik yang ditimbulkan setelah beberapa tahun mengkonsumsi etanol dapat
mengenai sistem saraf pusat4. Perubahan morfologis, neurofisiologis, dan
biokimiawi pada sistem saraf pusat akan berakibat penurunan fungsi
kognisi5.Salah satu kerusakan pada sistem saraf pusat akibat mengkonsumsi
etanol

ditandai

dengan

berkurangnya

neuron-neurondihippocampus6.

Hippocampus (cornu ammonis) terlibat dalampembentukanmemori kerja bersama


dengan komponen cortex prefrontalis. Informasi spasial dikonsolidasikan di
hippocampus dan selanjutnya digunakan oleh cortex prefrontalis ketika dipakai
untuk perencanaan respon mencari makan. Bagian hippocampus yangmenyokong
terjadinya long-term potentiation (substrat biologi memori) adalah CA1,
11

sedangkan jalur-jalur saraf yang mendukung terjadinya LTP diantaranya adalah


kolateral Schaffer yang berasal dari CA3 menuju CA111. Kerusakan pada otak
akibat mengkonsumsi etanol diduga disebabkan oleh efek langsung etanol
terhadap jaringan saraf atau efek tidak langsung, yaitu melalui defisiensi vitamin
B112. Efek langsung etanol menyebabkan peningkatan fluiditas membran dan
mengganggu reseptormembran, terutama terkait ion klorida dan kalsium yang
menimbulkan respon eksitotoksik (neurotoksik), selanjutnya meningkatkan
apoptosis. Selain itu, diduga efek etanol juga dapatmengganggu neurogenesis.
Karena alasan etika dan kesulitan teknik penelitian dalam mempelajari
alkoholisme pada manusia, terutama masalah intoksikasi dan ketergantungan pada
etanol, maka digunakan hewan sebagai model penelitian. Tikus sebagai hewan
coba dirasa sangat berpotensi dalammenerangkan dasar neurobiologi akibat
mengkonsumsi etanol dan menguatkan proses yang terjadi padamanusia15,16.
Penelitian ini bertujuan untukmengungkapkan pengaruh pemberian etanol secara
kronik terhadap jumlah sel piramidal di CA1 hippocampus tikus (Rattus
novergicus) remaja.
CARAPENELITIAN
Penelitian ini menggunakan hewan coba tikus (Rattus novergicus) jantan remaja,
berumur 30 hari17, galur Spraque-Dawley, berat badan 50-75 gram, diperoleh
dariUPHPUGMsebanyak 25 ekor. Pakan tikus berupa pellet dan air minum
diberikan setiap hari secara ad libitum.Bahan-bahan yang diperlukan dalam
penelitian ini adalah etanol absolut, cairan fisiologis, dan bahan untuk pembuatan
preparat histologis, dengan teknik blok parafin dengan pewarnaan Cresyl violet.

12

Alat-alat yang digunakan adalah mikroskop cahaya, kamera digital, alat bedah
minor, dan alat pembuatan sediaan histologis. Rancangan penelitian ini adalah
eksperimental

sederhana

posttest-only-control

group

design.

Subjek

dibagimenjadi lima kelompok dipilih secara random, yaitu kelompok kontrol


tanpa perlakuan (K1), kelompok kontrol perlakuan (K2), kelompokperlakuan 1
(P1), kelompok perlakuan 2 (P2), dan kelompok perlakuan 3 (P3)masing-masing
sebanyak 5 ekor tikus. Selama 30 hari semua kelompok perlakuan diberikan
injeksi intraperitonel etanol satu kali sehari dengan dosis masing-masing untuk
kelompok perlakuan 1, 2, dan 3 adalah 1, 2, dan 3 g/kgbb/hari. Kelompok kontrol
perlakuan diberikan pelarut etanol (cairan fisiologis) secara intraperitoneal,
sedang kelompok kontrol tanpa perlakuan tidak diberi perlakuan apapun. Setelah
pemberian etanol selesai, semua kelompok dibebaskan dari pemberian etanol
selama 12 hari. Selanjutnya semua tikus dikorbankan dandiambil otaknya. Otak
tikus dimasukkan dalam larutan formalin 10% selam 2 hari, selanjutnya dipotong
bagian otak yangmengandung hippocampus yaitu 3,8 mm di posterior
bregma18. Setelah itu dilakukan proses pembuatan preparat histologis dengan
pewarnaan Cresyl violet dengan ketebalan irisan 4 m, inti sel terwarnai birutransparan, sedangkan substansiaNissl dan nucleolus berwarna ungu tua-biru.
Setiap otak tikus dibuat 3 preparat, masing-masing preparat diamati dan dihitung
jumlah sel piramidal dalam10 lapang pandang. Jumlah sel piramidal dihitung
berdasarkan terlihatnya inti sel. Sediaan dilihat menggunakan mikroskop cahaya
pembesaran 400x, dan dinyatakan dalam jumlah rerata perlapang pandang.
Perbedaan jumlah sel piramidal antar kelima kelompok (skala rasio) diuji

13

denganANAVAsatu jalur dilanjutkan uji post hoc dengan Tukey HSD.


Pengambilan keputusan adanya perbedaan bermakna jika nilai probabilitas
p<0,05.
Pembahasan
Pada penelilitan ini didapat hasil terdapat perbedaan bermakna jumlah sel
piramidal

di

CA1

antara

kelompok

kontrol

(K1

dan

K2)

dengan

kelompokP3.Penelitian padamanusia dengan teknik magnetic resonance image


(MRI)menunjukkan adanya pengurangan volume hippocampus pada remaja
dengan penyalahguna etanol20. Hasil penelitian ini sesuai dengan beberapa
penelitian sebelumnya, dengan hasil terdapat pengurangan jumlah sel piramidal di
CA1 hippocampus sebanyak 5%-18% setelah pemberian etanol peroral selama 9
bulan diikuti 3 bulan withdrawal6.Hasil penelitian yang lain jugamengungkapkan
adanya pengurangan jumlah sel granuler gyrus dentatus dan sel piramidal
hippocampus sebanyak 20%setelah 5 bulan pemberian etanol peroral diikuti 2
bulan withdrawal21. Mekanisme yangmendasari terjadinya kerusakan struktur
otak akibat pengaruh etanol belum diketahui secara pasti, namun ada beberapa
kemungkinan

yang

berusaha

untukmenerangkan.

Terdapat

penelitian

yangmengungkapkan adanya peningkatan bentuk protein karbonil (protein


oksidatif) di hippocampus tikus neonatal setelah pemberian etanol peroral selama
3 hari22. Pemberian etanol secara akut pada tikus remajamenghambat
neurogenesis terutama pada fase proliferasi sel neuroprogenitor23. Penelitian
lainmenyebutkan pemberian etanol pada tikus dewasa menurunkan neurogenesis
melalui penghambatan proliferasi sel neuroprogenitor dan mengganggu ketahanan

14

hidup sel tersebut24. Kematian sel piramidal anak tikus setelah terpapar etanol
dalam kandungan induknya dan selama 18 hari post natal diduga melalui jalur
apoptosis25. Peningkatan apoptosis kemungkinan besarmelalui mitochondrial
pathway ( jalur intrinsik).
KESIMPULAN
Berdasarkan hasil penelitian ini dapat diambil kesimpulan bahwa pemberian
etanol dengan dosis semakin tinggi secara kronik saat usia remaja menurunkan
jumlah sel piramidal di CA1 hippocampus tikus.

15