Anda di halaman 1dari 9

Buka: https://www.ncbi.nlm.nih.gov.

CARI BLAST

1 DATABASE SEARCHING
Tentukanlah nama gen dan jenis penyakit pada kromosom X dengan OMIM id 305100

2 BLAST
>Protein_1
MIHFSINKNLFLQALNITKRAISSKNAIPILSTVKIDVTNEGVTLIGSNGQItIENFISQ
KNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQkVLTSGKSEITLKGK
DSEQYPRIQEISASTPLILETKLLKKIINETAFAASThESRPILTGVHFVLSQKELKTV
ATDSHRLSQKKLaLEKNSDDFDVVIPSRSLREFSAVFTDDITVEIFFANNQILdRSE
NISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNnTVKL
EIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNtTYLIDSLKALNSEKVTIS
FISAVRPFTLVPADTDEDFMQLITPVRTN

Petunjuk pengerjaan:
Gunakan sekuen Protein_1 sebagai query untuk BLASTP
Sekuen yang diperbandingkan hanya dari asam amino no 31 sampai dengan 330 saja
Database yang digunakan sebagai acuan: Swissprot

Pada bagian choose filter, aturlah agar BLASTP tidak mengubah daerah sekuen
dengan kompleksitas rendah menjadi sekuen XXXXXXX... (multiple X) secara otomatis
Batasi pencarian pada organisme BACTERIA saja
Berikan nilai Expect 0.0001
Pada bagian FORMAT, jangan tampilkan linkout
Jumlah deskripsi yang ditampilkan 50, sedangkan alignmentnya 10

Pertanyaan:
I. DOMAIN
1. Apa lambang dan nama domain yang paling conserve?
2. Berapa accession number-nya?
3. Apa fungsi domain yang paling conserve tersebut?
4. Berapa E-value-nya?

II. HASIL BLASTP


5. Berapa panjang sekuen yang disubmit?
6. Berapa panjang sekuen query yang diperbandingkan dengan database?
7. Ada berapa hasil pencarian yang memiliki bit score di atas 200?
8. Berapa jumlah description yang muncul?
9. Sebutkan accession number hasil pencarian urutan ke 10! Diantara nomor-nomor
tersebut, mana yang merupakan accession number pada Swissprot database?
10. Berdasarkan hasil pencarian yang paling conserve:
a.

Apa nama proteinnya?

b. Berapa panjang sekuen protein tersebut pada database?


c.

Berapa score; bit score; dan E-value?

d. Berapa jumlah asam amino yang sesuai (match) antara query dan database?

e.

Berapa jumlah asam amino yang memiliki nilai positive antara query dan
database?

f.

Berapa banyak gap? Sebutkan asam-asam amino yang seharusnya mengisi posisi
tersebut!

g.

Apa nama organisme pemilik sekuen tersebut?

3 PAIRWISE ALIGNMENT
3.1 Dengan mempergunakan data B. amyloliquefaciens levansucrase (AC number X52988)
dan B.subtilis levansucrase (AC number X02730) lakukan global pairwise alignment dengan
bioedit.
a Berapa skor Identities dari alignment tersebut.
b Sebutkan 10 buah basa secara berturutan dari kiri ke kanan pada B. amyloliquefaciens
yang tidak sama (non conserve) dengan sekuens dari B.subtilis. (contoh a,t,g,g,g,g,t,a,c)

3.2 Dengan mempergunakan data B. subtilis levansucrase AC number X02730) dan data C.
acetobutyliticum levansucrase buatlah local pairwise alignment dengan mempergunakan
program Lalign.
a Sebutkan masing-masing skor alignment dari fragmen yang terbentuk? Jawaban 52.4, 54.5,
64.2
b Mengapa menurut anda terbentuk tiga fragmen? Jawaban karena local alignment mencari
segmen-segmen yang conserve antar dua sekuens yang dibandingkan.

>C. acetobutyliticum levansucrase


ttgaaaacaagaaaaacttataaaatgatatcttcgctaatggttattttggcaatactaacaattccatttttaatacttagacataaca
caggctatactagtatttggtcacgccagcaggcgcaaaatttcaaatgtacaaaagaaaacacagcacctaatatcaatccgaat
tttaaacttactgcccctaatctttgggtttgggatacttggccgcttgtaaaaaaagatggatctttagcagtagttaatggatacaa
ggttatttttgctttgactgcatctagaaatgtaggctggaataaacgtcatgatgttgcaggtataagttatttttgctcaacggacgg

tgaaaattgggtatacaaaggactagcttacaatgtggaagatgctcttggatctagacaatgggcaggttcggcaatactcgatg
aaaatggaatggttcaatttttttatactgccacaggtagaaaaggagaagcggttagaacctttgagcagaggttagttaaaacta
aatttagtataaacgttgataaaggtggagttcatattacgaattgtagtaaacatcaagttattcttgagccagatggtgtatactatc
aaacaatgcaacaagcaaaaggacccataatatattcttttcgtgatccatatttttttgaagatcctaaaaccaaaaaggactactta
atattcgaaggaaataagggcggaaaaattgaaaaaatgaaacctgaaaatataggtgataaattatttcgaaaaaatcatatagc
accacgaggagtagaaaattttaatgggaatgttggtatcgctgttgcccaaaataaagatttgacaagatttaaattgctaccacc
actacttgaagcagttggcgttaaccagcagcttgaacgcccacaaattgtaatgaaaaaaaataaatactatttatttactataagt
cacaaatttacttatgctcaaggattaaatggtgtagacggtttatatggtttttgtggcaattctttgcgtagtaattacaaacccttaa
acggaaatggtcttgtaataaccaacccaactaatgatccatatcaaacatactcatggtatttagtatccggacatgatgtcttaagt
tttataaatgagtatcattttaatgggcagcttagatatggtggcacctttgcaccaaccttgcaaattagtttaaagggatacaaatc
aaaaattataggaaggcttggggaaggagtagttacgcctgcacattag

4 MULTIPLE ALIGNMENT
Buatlah multiple alignment dari sekuen berikut dengan menggunakan Tcoffee,
a.Berapakah score aligmentnya ?
b Adakah daerah konservatif dengan basa lebih dari 3?
c Berapakah panjang basa yang di aligment?

/organism="Vibrio cholerae"
1 aaattgccct gatgtggggg ataaccattg gaaacgatgg ctaataccgc atgatgccta
61 cgggccaaag agggggacct tcgggcctct cgcgtcagga tatgcccagg tgggattagc
121 tagttggtga ggtaatggct caccaaggcg acgatcccta gctggtctga gaggatgatc

/organism="Enterococcus hirae"
1 acgcttcttt ttccaccgga gcttgctcca ccggaaaaag aggagtggcg aacgggtgag
61 taacacgtgg gtaacctgcc catcagaagg ggataacact tggaaacagg tgctaatacc
121 gtataacaat cgaaaccgca tggttttgat ttgaaaggcg ctttcgggtg tcgctgatgg

/organism="Zymomonas mobilis subsp. mobilis"


1 gcttcggcct tagtggcgca cgggtgcgta acgcgctggg aatctgcctt caggtacgga
61 ataactaggg gaaactcgag ctaataccgt atgatatcga gagatcaaag atttatcgcc
121 tgaagatgag cccgcgttgg attagctagt tggtagggta aaggcttacc aaggcgacga
181 tccatagctg gtctgagagg atgatcagcc acactgggac tgagacacgg cccagactcc

/organism="Streptococcus mutans"
1 agttaactca tgttaactgt ttaaaagaag caatggcttc actatcagat ggacctgcgt
61 tgtattagct agtaggtagg gtaacggcct acctaggcaa cgatacatag ccgacctgag
121 agggtgaacg gccacactgg gactgagaca cggcccagac tcctacggga ggcagcagta

/organism="Geobacillus stearothermophilus"
1 taacacgtgg gcaacctgcc cgcaagaccg ggataactcc gggaaaccgg agctaatacc
61 ggataacacc gaagaccgca tggtcttcgg ttgaaaggcg gcctttgggc tgtcacttgc
121 ggatgggccc gcggcgcatt agctagttgg tgaggtaacg gctcaccaag gcgacgatgc

5 ORF
Petunjuk Pengerjaan

Pencarian ORF

Bukalah halaman web ORF Finder di NCBI

Lakukan input dengan memasukkan accession number NC_002929

Sekuen yang dicari ORF-nya berada di antara posisi 24300 sampai dengan 25600
pada genome

Gunakan Bacterial Code sebagai kode genetiknya

Pada saat melakukan BLASTP untuk verifikasi kandidat ORF:

Tampilkan Graphical Overview pada hasil pencarian

Tampilkan deskripsi dan alignment masing-masing 10 saja

Gunakan database SWISSPROT sebagai acuan

Pertanyaan
Dari hasil pencarian yang didapat:
1. Pada frame berapa ditemukan kandidat ORF terpanjang?
2. Pada posisi berapa kandidat ORF tersebut pada genome?
3. Berapa panjang nukleotida dan asam amino kandidat ORF tersebut?
4. Diantara 2 hasil teratas, mana yang merupakan ORF yang paling mungkin?
5. Apa nama protein yang disandikan oleh ORF tersebut?
6. Apa nama organisme pemilik sekuen tersebut?
7. Berapa accession number hasil pencarian terbaik?
8. Tampilkan sekuen protein yang disandikan ORF tersebut dalam format FASTA:
(Jawaban pertanyaan ini cukup ditampilkan di layer computer saja, tidak perlu ditulis
di lembar jawaban)

6 DESAIN PRIMER
Dengan mempergunakan data B. subtilis levansucrase (AC number X02730) buatlah dan
tuliskan pada lembar jawaban sepasang primer yang besar amplikonnya antara 300 bp sampai
dengan 500 bp.

7 POHON FILOGENETIK

Di bawah ini adalah 6 sekuen asam amino dari 6 spesies dalam group Rhizobiaceae. (bila
Anda merasa perlu, anda bisa mengecek accession number masing-masing sekuen untuk
mengetahui nama dan keterangan lengkapnya).
>AAK86409
SKSYHGPGTCTFYGTANSNQMLMEIMGFHMPGSSFINPGTPLRDALTREAANRALAI
TA
>AAK87678
RSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLATHSDRKRLFVEAGHLIVDL
ARR
>AAK88451
LESAPSVGHCNTMGTASTMNAIAEALGMSLTGCGAIPAAYRERGQMAYRTGRRAVEL
VIE
>AAK89455
GGIARSAGVCMTMGTASTMTAIADALGITLPGASSIPAVDSEHQRMSAACGRRIVEM
VSE
>AAK90170
ASSAPSTGYCNTMGTATTMNSLAEALGMQLPGSAAIPAPYRDRQEVSYLTGLRIVDM
VRE
>Q44327
AKSYHSPGTCTFYGTANSNQMLMEIMGLHIPGSSFVNANTPLRDALTREATRRALSLT
A

Lakukan langkah-langkah dibawah ini:


1 Lakukan multiple alignment pada keenam sikuens diatas pada situs:
www.ebi.ac.uk/clustalw
2 Buka situs: http://bioweb.pasteur.fr/seqanal/phylogeny/phylip-uk.html dan aktifkan link
protdist
3 Paste-kan hasil alignment dalam format clustalw pada box, dan jalankan program dengan
menekan run protdist
4 Jalankan neighbor pada menu drop down
5 Buka file out tree dalam format newick
Pertanyaan:
Gambarkan pohon filogenetik yang anda dapatkan dalam format newick tersebut, dan
jabarkan hubungan kekerabatan yang ditunjukkan oleh pohon Anda!

8 ANALISA STRUKTUR RNA


Accession: AY459586 : Lactobacillus sanfranciscensis strain CIP 103252
a Tentukan 2 tRNA sekuens dari mikroorganisme di atas.
b Untuk menyelesaikan soal-soal berikut, gunakan program Mfold dari bioinfo. Dari kedua
struktur itu, struktur manakah yang paling stabil? Berikan penjelasan yang lengkap.
c Jelaskan tentang hasil yang didapatkan dari energi dot plot.

9 ANALISA STRUKTUR PROTEIN


Parkinson disease
a Apa yang anda ketahui tentang penyakit ini?
b Untuk menyelesaikan soal-soal selanjutnya, sebutkan accession number yang anda pakai.
c Sifat-sifat fisiko kimia protein

d Untuk menentukan domain protein dapat digunakan berbagai program. Untuk


menyelesaikan soal ini, bandingkan hasil dari TMHMM dengan ProtScale, berikan
penjelasannya.
e Tentukan jumlah transmembran protein, gunakan dua program untuk menganalisanya.