Anda di halaman 1dari 46

MANAJEMENPAKANPADAPERUSAHAANPETERNAKANSAPIPOTONG

CV.SUMBERBAJAPERKASAKABUPATENKLATEN

TUGASAKHIR

Oleh:

NanangSulaiman
H.3406019

PROGRAMDIPLOMAIIIAGRIBISNISPETERNAKAN
FAKULTASPERTANIAN
UNIVERSITASSEBELASMARET
SURAKARTA
2009

MANAJEMENPAKANPADAPERUSAHAANPETERNAKAN
SAPIPOTONGCV.SUMBERBAJAPERKASA
KABUPATENKLATEN
TUGASAKHIR
UntukMemenuhiSebagianPersyaratanGunaMemperoleh
DerajatAhliMadyaPeternakanDiFakultasPertanian
UniversitasSebelasMaretSurakarta
ProgramStudiAgribisnisPeternakan

Oleh:

NanangSulaiman
H3406019
PROGRAMDIPLOMAIIIAGRIBISNISPETERNAKAN
FAKULTASPERTANIAN
UNIVERSITASSEBELASMARET
SURAKARTA
2009

ii

MANAJEMENPAKANPADAPERUSAHAANPETERNAKAN
SAPIPOTONGCV.SUMBERBAJAPERKASA
KABUPATENKLATEN

TUGASAKHIR

Disusunoleh:
NanangSulaiman
H3406019

Telahdipertahankandidepandewanpenguji
Padatanggal:29Juni2009
Dandinyatakantelahmemenuhisyarat
Susunantimpenguji

iii

PengujiI

PengujiII

Ir.EkaHandanyanta,MP

NIP.131863780

Ir.Lutojo,MP

NIP.131694834
Surakarta,Juni2009
UniversitasSebelasMaret
FakultasPertanian
Dekan

Prof.Dr.Ir.H.Suntoro,MS
NIP.131124609

iv

KATAPENGANTAR
Puji syukur penulis panjatkan kehadirat Allah SWT yang telah
melimpahkan rahmat dan hidayahNya sehingga penulis dapat menyelesaikan
TugasAkhirini,denganjudulManajemenpakansapipotong,TugasAkhirini
merupakanlaporandarihasilmagangdiperusahaanCV.SumberBajaPerkasa
yangdisusunsebagaisalahsatusyaratmendapatkangelarAhliMadyaAgribisnis
PeternakanFakultasPertanianUniversitasSebelasMaretSurakarta.
DalampenyusunanTugasAkhirinitidaklepasakanadanyabantuandari
berbagaipihak.Padakesempataninipenulismengucapkanterimakasihkepada
yangterhormat:
1. DekanFakultasPertanianUNSSurakarta.
2. Ketua Program Studi D III Agribisnis Peternakan Fakultas Pertanian UNS
Surakarta.
3. BapakIr.EkaHandayanta,MPselakuDosenPembimbingMagang.
4. Keduaorangtuayangselalumendukungsetiapsaatdengandoadanmateri.
5. PemilikbesertakaryawanCV.SumberBajaPerkasayangtelahmemberikan
kesempatan untuk praktek magang serta pengarahannya selama kegiatan
magang.
6. Semuapihakyangtidakdapatpenyusunsebutkansatupersatu.
Penulismenyadarimasihbanyakkekurangandalampenyusunanlaporan
tugasakhirini,olehkarenaitupenulismengharapkansarandanmasukanuntuk
memperbaikiTugasAkhirini.DanpadaakhirnyapenulisberharapsemogaTugas
Akhir ini bermanfaat bagi penulis khususnya, dan bagi para pembaca pada
umumnya.
Surakarta,Juni2009

Penulis

DAFTARISI

Halaman
HALAMANJUDUL..................................................................................

HALAMANPENGESAHAN.....................................................................

iii

KATAPENGANTAR.................................................................................

iv

DAFTARISI...............................................................................................

DAFTARTABEL.......................................................................................

vii

DAFTARGAMBAR...................................................................................

viii

DAFTARLAMPIRAN...............................................................................

ix

BABIPENDAHULUAN
A.LatarBelakang..........................................................................

B.TujuanMagangPerusahaan.......................................................

a.TujuanUmum.......................................................................

b.TujuanKhusus......................................................................

BABIITINJAUANPUSTAKA
A.SapiPotong...............................................................................

B.Pakan.........................................................................................

C.ManajemenPemberianPakan...................................................

1.

Jumlahpemberian................................................7

2.

ImbanganHijauandanKonsentrat.................................8

3.

FrekuensiPemberian...........................................8

4.

Sistem Pemberian...........................................................................9

BABIIITATALAKSANAPELAKSANAAN
A. WaktudanTempatMagangPerusahaa.................................................11
B. CaraPengambilanData.................................................................12
C. SumberData.................................................................................13
BABIVHASILDANPEMBAHASAN

vi

A. KondisiUmumLokasi..................................................................14
1.

SejarahPerusahaan........................................................14

2.

StrukturOrganisasi.........................................................15

3.

LokasiPeternakan.............................................................17

4.

LuasArealPeternakan.....................................................18

5.

PopulasiTernak..............................................................19

6.

Pakan...............................................................................24

7.

Perkandangan.....................................................................24

8.

PenangananKesehatan.....................................................26

9.

Pergudangan..................................................................27

10.

PenangananLimbah........................................................27

B.UraianKegiatanMagangPerusahaan.......................................

28

1.

JenisPakan..............................................................................28

2.

CaraMemperolehPakan.........................................................29

3.

JumlahPemberianPakan........................................................31

4.

FrekuensiPemberianPakan..................................................33

5.

SistemPemberianPakan.........................................................34

6.

PemberianAirMinum..........................................................34

7.

PertambahanBeratBadanHarian........................................35

8.

KonversiPakan................................................................36

9.

FeedCostPerGain..........................................................37

BABVKESIMPULANDANSARAN
A.Kesimpulan...............................................................................

38

B.Saran..........................................................................................

38

DAFTARPUSTAKA..................................................................................

40

LAMPIRAN................................................................................................

41

vii

DAFTARTABEL
Tabel
1.

Judul

Halaman

BangunanbangunandiCV.SumberBajaPerkasa.....................................
18

2.

PopulasiTernak..........................................................................................
20

3.

DatabobotbadansapikandangA..............................................................
19

4.

DatabobotbadansapikandangB..............................................................
22

5.

DatabobotbadansapikandangC..............................................................
23

6.

KandunganNutrienBahanPakanPenyusunRansum(%BK)..................
29

7.

Daftarhargabahanpakan..........................................................................
30

8.

PemberianpakanCV.SumberBajaPerkasa..............................................
32

9.

Pemberianpakanberdasarkanbobotbadansapi(%BB)diCV.
Sumber

Baja

Perkasa
33

10. Pertambahan bobot badan harian sapi di CV. Sumber Baja


Perkasa
35
11. Konversi

Pakan

36
12. Feed

Cost

37

vii

Per

Gain

DAFTARGAMBAR
Gambar

Judul

Halaman

1.StrukturOrganisasi............................................................................

viii

16

DAFTARLAMPIRAN

LaivmpiranI.FotoJenisjenisSapidiCV.SumberBajaPerkasa.. 41
LampiranII.FotoDokumentasiKegiatanMagang 42
LampiranIII.LayOutCV.SumberBajaPerkasa. 46
LampiranIV.LayOutKandangSapiPotongCV.SumberBajaPerkasa.. 47

ix

I.PENDAHULUAN
LatarBelakang
Usahapenggemukansapipotongsaatinimempunyaikencenderungan
makinberkembang.Haliniditandaidengansemakinbanyaknyamasyarakatdi
daerahyangmengusahakanpenggemukansapi.Prospekusahapenggemukan
sapi sangat menjanjikan terbukti dari beberapa hasil kajian menunjukkan
keuntunganusahayangcukupmemadaibagipeternak.Usahapenggemukan
sapidapatdilakukansecaraperseoranganmaupunsecaraperusahaandalam
skalabesar.Namunadapulayangmengusahakansecarakelompokpula.
Seiring semakin berkembangnya perusahaan peternakan dan juga
kesadaran masyarakat akan pentingnya gizi demi kesehatan dan diimbangi
dengandayabelimasyarakatyangmeningkatpula,permintaanakandaging
sapiuntukkonsumsisehariharipunjugameningkatdaritahunketahun.Itu
ditandai dengan makin banyaknya perusahaan peternakan khususnya
perusahaan yang bergerak dalam bidang feedlot (penggemukan). Hal ini
disebabkanprospekusahapenggemukansapipotongcukupmenguntungkan
terbukti dari kebutuhan akan konsumsi daging sapi setiap tahun selalu
meningkat. Sementaraitupemenuhanakankebutuhandagingselalukurang,
dengankatalainpermintaandagingsebagaikonsumsiterusbertambah.
Tigahalpokokyangperludiperhatikanagardapatmenjadipeternak
suksessehinggakelangsunganusahaternaktersebutdapatberjalan.Ketigahal
tersebut yaitu breeding (bibit/bakalan), feeding (pakan), dan management
(manajemen),yangsalingterkaitsatusamalaindansalingmelengkapi.
Usaha untuk meningkatkan pengadaan daging sapi dapat dilakukan
dalam usaha feedlot. Feedlot adalah pemeliharaan sapi di dalam kandang
tertentu,tidakdiperkerjakantetapihanyadiberipakandengannutrienyang
optimaluntukmenaikkanberatbadandankesehatansapi(Darmono,1993).
Usahaternaksapipotongakanberhasilapabilafaktorpenunjangnya(pakan)

memperolehperhatianpenuh,disampingfaktorgenetis.Olehkarenaitubibitsapiyangbaikharus
diimbangidenganpemberianpakanyangbaikpuladancukupmemenuhikebutuhannutriennya.
Adapunfungsilaindaripakanadalahuntukmempertahankandayatahantubuhdankesehatan.
Produktivitasternaksapipotongsangatpekaatausensitifterhadapperubahanpemberian
pakan, olehkarenaitupakanyangdiberikanharus sesuaidenganketersediaan,kesinambungan
mutu maupun jumlahnya. Disamping itu perlu diketahui bahwa biaya pakan dalam usaha
penggemukan memberikan konstribusi yang cukup besar. Oleh karena itu dalam usaha
penggemukan, peternak harus dapat memberikan pakan yang murah namun bermanfaat bagi
peningkatanproduksidaging(Siregar,2003).
Padadasarnya,sumberpakansapidapatdisediakandalambentukhijauandankonsentrat,
dan yang terpenting adalah pakan harus memenuhi kebutuhan protein, karbohidrat, lemak, dan
vitaminsertamineral.Secaraalamiahpakanutamaternaksapibaikpotongmaupunperahadalah
hijauan, dapat berasal dari rumput alam atau lapang, rumput unggul, leguminosa dan limbah
pertaniansertatanamanhijauanlainnya.Dalampemberiannyaharusdiperhatikanhijauantersebut
disukai ternak dan tidak mengandung racun atau toxin sehingga dapat membahayakan
perkembanganternakyangmengkonsumsi.Namunpermasalahanyangadabahwahijauandidaerah
tropissepertidiwilayahIndonesiamempunyaikualitasyangkurangbaiksehinggauntukmemenuhi
kebutuhangiziternaktersebut,perluditambahdenganpemberianpakankonsentrat(Siregar,1996).
Dalam pemberian pakan di kandang atau di palungan, yang perlu diperhatikan adalah
mengetahuiberapajumlahpakandanbagaimanaransumyangdiberikanpadaternaksapi.Untuk
itu,telahdibuat feedingstandard.Akantetapi,dalampemberiannyaadayangdilakukandengan
caraadlibitum,yaitudiberikandalamjumlahyangselalutersedia.Adajugayangdiberikandalam
bentukrestrictedataudibatasi(Santosa,2002).
Mengingat pentingnya memperhatikan manajemen pemberian pakan sapi potong dalam
usahafeedlot,makakegiatanMagangPerusahaandenganjudulManajemenPemberianPakanSapi
PotongpadaCV.SumberBajaPerkasayangberalamatkandiDukuhSentono,DesaNgawonggoRt.
35,Rw14,Kecamatan Ceper,KabupatenKlatendilaksanakansebagaisyaratuntukmenyusun
tugasakhir.
TujuanMagangPerusahaan
1.

TujuanUmum
MagangPerusahaaninidilaksanakanolehmahasiswadengantujuan:

a.

Untukmemperolehpengalamanyangberhargadenganmengenalikegiatankegiatandi
lapangankerjayangadadibidangpeternakansecaraumum.

b.

Meningkatkan pemahaman mengenai hubungan antara teori dan penerapannya serta


faktorfaktor yang mempengaruhi sehingga dapat sebagai bekal bagi mahasiswa dalam
terjunkemasyarakatsetelahlulus.

c.

Untukmemperolehketrampilankerjadanpengalamankerjayangpraktisyaknisecara
langsungdapatmenjumpai,merumuskansertamemecahkanpermasalahanyangadadalam
kegiatandibidangpeternakan.

d.

Meningkatkan hubungan antara perguruan tinggi, pemerintah, instansi, terkait dan


masyarakatsehinggadapatmeningkatkanmutupelaksananTriDharmaPerguruanTinggi.

2.

TujuanKhusus
TujuankhususkegiatanMagangperusahaanadalah:
a. MengetahuikondisiumumPeternakanSapiCV.SumberBajaPerkasa.
a. MengetahuikegiatankegiatanyangdilaksanakandiperusahaanpeternakansapipotongCV.
SumberBajaPerkasa
b. MengetahuimenejemenpemberianpakanpadapeternakansapipotongdiCV.SumberBaja
PerkasaDukuhSentono

II.TINJAUANPUSTAKA
A.

SapiPotong
Setiap proses penggemukan sapi, pada akhirnya sapi akan menjadi
penghasildaging.Sapisapiyangdipekerjakansebagaipembajaksawahatau
ternakternak perah yang tidak produktif lagi biasanya akan digemukan
sebagaiternakpotong.Umumnya,mutudagingyangberasaldarisapisapi
afkiraninitidakterlalubaik.Meskipundemikianadabeberapajenissapiyang
memang khusus dipelihara untuk digemukkan karena karakteristik yang
dimilikinya,sepertitingkatpertumbuhannyacepatdankualitasdagingcukup
baik.Sapisapiinilahyangumumnyadijadikansebagaisapibakalan,yang
dipelihara secara intensif selama beberapa bulan sehingga diperoleh
pertambahanberatbadanyangidealuntukdipotong(Abidin,2002).
Menurutparaahli,ternaksapiyangdipeliharaberasaldarisapisapi
liaryangtelahdijinakkan.Adapungolongansapisapitersebutdiklasifikasikan
menjaditigakelompokbesarsapiyaitu:
1.

Bos Sondaicus atau Bos Banteng, sampai sekarang masih dapat


ditemuihidupliardidaerahmargasatwayangdilindungidiPulauJawa,
sepertidiPandanarandanUjungKulon.

2.

Bos Indicus atau Sapi Zebu, sampai sekarang mengalami


perkembangandiIndiadanAsia.

3.

Bos Taurus atau Sapi Eropa, sampai sekarang mengalami


perkembangandiEropa.
BangsasapipotongAsiadiantaranyaadalah:SapiBali,SapiOngole,

Sapi Madura, dan Sapi Brahman. Bangsa sapi potong Eropa diantaranya
adalah:Sapi Hereford,Sapi Shorthorn,Sapi Limousin danSapi Charolais
(Murtidjo,2001).
SapipotongyangberkembangdiIndonesia,merupakanbangsasapi
tropis,terdiridarisapilokal,dansapiimpor(SarwonodanArianto,2002).

MenurutSugeng(2002),ciriciribangsasapitropisyaitumemilikigelambir,kepalapanjang,dahi
sempit,ujungtelingaruncing,bahupendek,garispunggungberbentukcekung,kakipanjang,tubuh
relatifkecil,denganbobotbadan250650kg,tahanterhadapsuhutinggi,tahanterhadapcaplak.
JenissapiyangbanyakdipeliharapeternakIndonesiaadalahOngole,sapiBali,sapiMadura,sapi
Angus,sapiBrahman,sapiBrangus(BrahmanAberdeenAngus),sapiPeranakanOngole(PO)dan
sapiSimmental(Djarijah,1996).
MenurutMurtijo(1990)penilaianterhadapkeadaanindividualsapipotongpadaprinsipnya
didasarkan pada umur, bentuk tubuh, luas tubuh, pertambahan berat badan dan temperamen.
Dianjurkanpulamengetahuisejarahyangberkaitandenganpenyakit.Namunsecarapraktispada
umumnyapenilaianindividualsapidilakukandenganmengamatibentukluarsapisepertibentuk
tubuhnormal,ukurannormaldaribagianbagiantubuh,danorgankelamin.Prioritasutamauntuk
memilihsapibakalanadalahberbadankurus,berumurmuda(sapidara)dansepasanggiginyatelah
tanggal(SarwonodanArianto,2002).MenurutSantoso(2002)sapiyangpalingbaikdigemukan
adalahsapijantan,karenapertambahanbobothariannyayangtinggi.

B.

PakanSapiPotonng
Bahan pakan adalah segala sesuatu yang diberikan kepada ternak yang sebagian atau
keseluruhannnyadapatdicernatetapitidakmengganggukesehatanternaktersebut.Sebagiancontoh
pakanhijaun(rumput,daundaunan),limbahpertanian(jeramipadi,jeramijagung,jeramikedelai,
pucuktebu),leguminosa(daunLamtoro,Gliricida,Kaliandra,Turi,danKacangkacangan)limbah
industripertanian(dedak,bekatul,pollard,onggok,bungkilbungkilan)danlainlain(Anonimus,
2001).
Padadasarnya,sumberpakansapidapatdisediakandalambentukhijauandankonsentrat,
dan yang terpenting adalah pakan yang memenuhi kebutuhan protein, karbohidrat, lemak, dan
vitaminsertamineral(Sarwono,2002).
Secaraalamiahpakanutamaternaksapiadalahhijauan,yangdapatberuparumputalam
ataulapangan,rumputunggul,leguminosa,limbahpertaniansertatanamanhijauanlainnya.Dalam
pemilihanhijauanpakanternak harusdiperhatikandisukaiternakatautidak,mengandung toxin
(racun)atautidakyangdapatmembahayakanperkembanganternakyangmengkonsumsi.Namun
permasalahan yang ada bahwa hijauan di daerah tropis mempunyai kualitas yang kurang baik
sehinggauntukmemenuhikebutuhannutrienperluditambahdenganpemberianpakankonsentrat

(Siregar,1996).
.Pemberianpakanyangbaikuntukmemenuhibeberapakebutuhanternaksebagaiberikut:
1. Kebutuhan hidup pokok, yaitu kebutuhan pakan yang mutlak dibutuhkan dalam jumlah
minimal.Padahakekatnyakebutuhanhiduppokokadalahkebutuhansejumlahminimalnutrien
untukmenjagakeseimbangandanmempertahankankondisitubuhternak.Kebutuhantersebut
digunakanuntukbernapas,bergerak,danpencernaanmakanan.
2. Kebutuhan untuk pertumbuhan, yaitu kebutuhan pakan yang diperlukan ternak sapi untuk
prosespembentukanjaringantubuhdanmenambahberatbadan.
3. Kebutuhanuntukreproduksi,yaitukebutuhanpakanyangdiperlukanternaksapiuntukproses
reproduksi,misalnyakebuntingan.
Untuk kebutuhan nutrien sapi potong dalam praktek penyusunan diperlukan pedoman standart
berdasarkanberatbadandanpertambahanberatbadan(Murtidjo,1990).
Mutu, jumlah pakan dan caracara pemberiannya sangat mempengaruhi kemampuan
produksisapipedaging.Untukmempercepatpenggemukan,selaindarirumput,perlujugadiberi
pakanpenguatberupakonsentratyangmerupakancampuranberbagaibahanpakanumbiumbian,
sisahasilpertanian,sisahasilpabrikdanlainlainyangmempunyainilainutriencukupdanmudah
dicerna(Setiadi,2001).
Pemberianpakandimaksudkanagarsapidapatmemenuhikebutuhanhidupnyasekaligus
untuk pertumbuhan dan reproduksi. Pada umumnya, setiap sapi membutuhkan pakan berupa
hijauan.Sapidalammasapertumbuhan,sedangmenyusuidansedangdigunakansebagaitenaga
kerjamemerlukanpakanyangmemadaibaikdarisegikualitasmaupunkuantitasnya(Djarijah,
1996).
Dalammenyusunransumharusdiusahakanagarkandungannutriendidalamransumsesuai
dengannutrienyangdibutuhkanternakuntukmemenuhikebutuhanhiduppokok,pertumbuhandan
bereproduksi(Santoso,2002).
Ransumadalahsatuataucampuranbeberapajenisbahanpakanyangdisusunsedemikian
rupasehinggamampumemenuhikebutuhanternakselama24jam.Ransumyangdiberikanpada
sapisapiyangdigemukantergantungpadasistempenggemukanyangdigunakan.Penggemukan
sapi dengansistem pasture hanyaterdiridarihijauanyangdiperolehdenganmelepas sapisapi
untuk meruputdipadangpenggembalaan.Demikianpuladengansistemkeremanyangterdapat
dibeberapadaerahdiIndonesia,adadiantaranyayanghanyamemberikanhijauansajatanpapakan
tambahanberupakonsentrat(Siregar,2003).

Pakan suplemen merupakan bahan yang mengandung jasad renik (mikroba) hidup yang
sengajaditambahkandalampakansapiatauruminansialainya.Dengandiberikansedikitpakan
tambahan, kebutuhan pakan persatuan ternak dapat dikurangi. Apabila setiap hari ternak
membutuhkan1011kgbahankering(BK)untukmenaikkan1kgberatbadanmaka,penggunaan
pakantambahanmampumengurangijumlahpakan(Sarwono,2002).
C.

ManajemenPemberianPakan
II.

Jumlahpemberian
Pemberianpakan padasapi potongdapat dilakukan secara adlibitum dan restricted
(dibatasi). Pemberian secara ad libitum sering kali tidak efisien karena akan menyebabkan
bahanpakanbanyakterbuangdanpakanyangtersisamenjadibusuksehinggaditumbuhijamur
dansebagainyayangakanmembahayakanternakbilatermakan(Santosa,2002).
Tingkatkonsumsiternakruminansiaumumnyadidasarkanpadakonsumsibahankering
pakan, baik dalam bentuk hijauan maupun konsentrat, persentase konsumsi bahan kering
memilikigrafikmeningkatsejalandenganpertambahanberatbadansampaitingkattertentu,
kemudian mengalami penurunan. Ratarata kemampuan konsumsi bahan kering bagi
ruminansiaadalah23%dariberatbadan(Mc.Cullough,1973).Atau2,53,2%menurut
(Sugeng,2002).

III.

ImbanganHijauandanKonsentrat
Ransum ternak ruminansia pada umumnya terdiri dari hijauan dan konsentrat.
Pemberian ransum berupa kombinasi kedua bahan itu akan memberi peluang terpenuhinya
nutrien dan biayanya relatif murah. Namun bisa juga ransum terdiri dari hijauan ataupun
konsentratsaja.Apabilaransumterdiridarihijauansajamakabiayanyarelatifmurahdanlebih
ekonomis,tetapiproduksiyangtinggisulittercapai,sedangkanpemberianransumhanyaterdiri
dari konsentrat saja akan memungkinkan tercapainya produksi yang tinggi, tetapi biaya
ransumnyarelatifmahaldankemungkinanbisaterjadigangguanpencernaan(Siregar,1996).
Pakan ternak untuk penggemukan sapi merupakan faktor yang penting untuk
meningkatkan produksinya. Pakan yang baik adalah pakan yang mengandung protein,
karbohidrat, lemak, vitamin dan mineral. Protein adalah unsur utama dalam pemeliharaan
organtubuhdanpertumbuhan,sedangkankarbohidratbergunasebagaisumberenergiyangakan
digunakanuntukprosesmetabolisme(Darmono,1993)

Pada usaha penggemukan sapi, pemberiaan pakan konsentrat lebih banyak daripada
hijauan, hal ini bertujuan untuk meningkatkan pertambahan berat badan yang cepat.
Perbandinganjumlahkonsentratdanhijauandalamransumpenggemukansapiatasdasarbahan
keringadalah70%dan30%(Anonimus2001).
IV.

FrekuensiPemberian
Pemberian konsentrat dapat dilakukan dua atau tiga kali dalam sehari semalam.
Pemberiankonsentratduakalidalamseharisemalamdapatdilakukanpadapagiharisekitar
pukul 08.00dansekitarpukul15.00.Lainlagidenganpemberianyangdilakukan tiga kali
dalamsehari
semalampadasaatpukul08.00,sekitarpukul12.00,dansekitarpukul16.00.Sedangkan
pemberiaanhijauandilakukansekitar2jamsetelahpemberiankonsentrat.Pemberianhijauan
inidilakukansecarabertahapdanminimal4kalidalamseharisemalam.Frekuensipemberian
hijauan yang lebih sering dilakukan dapat meningkatkan kemampuan sapi itu untuk
mengonsumsiransumdanjugameningkatkankencernaanbahankeringhijauan(Siregar,2003).
Teknik pemberian pakan yang baik untuk mencapai pertambahan bobot badan yang
lebih tinggi pada penggemukan sapi potong adalah dengan mengatur jarak waktu antara
pemberiankonsentratdenganhijauan.Pemberiankonsentratdapatdilakukanduaatautigakali
dalamseharisemalam.Hijauandiberikansekitarduajamsetelahpemberiankonsentratpada
pagiharidandilakukansecarabertahapminimalempatkalidalamseharisemalam (Siregar,
2003).

4.Sistempemberian
Dalam pemberian konsentrat sebaiknya dalam bentuk kering (tidak dicampur air),
namunpemberianbentukbasahjugabisadilakukan.Yangperludiperhatikanbilapemberian
bentuk basahadalahkonsentrattersebutharushabisdalamsekalipemberiansehinggatidak
terbuang.Perubahanjenispakan,yangsecaramendadakdapatberakibatternakstress,sehingga
tidakmaumakan.Olehkarenaitucarapemberiannyadilakukansedikitdemisedikitagarternak
beradaptasi dahulu, selanjutnya pemberian ditambah sampai jumlah pakan yang sesuai
kebutuhannya,sedangkanairminumdiberikansecaraadlibitum(Anonimus,2001).
Teknik pemberian pakan yang baik untuk mencapai pertambahan bobot badan yang
lebih tinggi pada penggemukan sapi potong adalah dengan mengatur jarak waktu antara
pemberian konsentrat dengan hijauan. Hijauan diberikan sekitar dua jam setelah pemberian

konsentrat pada pagi hari dan dilakukan secara bertahap minimal empat kali dalam sehari
semalam. Frekuensi pemberian hijauan yang lebih sering dilakukan dapat meningkatkan
kemampuansapiuntukmengkonsumsiransumdanjugameningkatkankecernaanbahankering
hijauanitusendiri(Cullough,1973).

III.TATALAKSANAPELAKSANAAN
A.

WaktudanTempatMagangPerusahaan
Kegiatan Magang Perusahaan ini dimulai dari tanggal 16 Februari
sampaidengan16Maret2009diPeternakansapipotongCV.SumberBaja
PerkasayangberalamatkandiDukuhSentono,DesaNgawonggoRt.35,Rw
14,KecamatanCeper,KabupatenKlaten.
Kegiatan magang perusahaan ini dipilih di Peternakan CV. Sumber
BajaPerkasa.AlasandipilihnyalokasiinidenganpertimbanganbahwaCV.
Sumber Baja Perkasa merupakan salah satu perusahaan peternakan yang
memilikisumberdayayangcukupbaik,baikdarisegipermodalan,sumber
dayamanusiadanpengelolaanusahanya.
KegiatanmagangyangdilaksanakandipeternakanCV.Sumber Baja
Perkasa mengenai manajemen pemberian pakan sapi potong. Dalam
pelaksanaankegiatanmaganginimengamatitentangmanajemenpemberian
pakanyangmeliputijenis pakanyangdiberikan,pencampuranpakan,cara
memperolehpakan,jumlahpemberianpakan,frekuensipemberianpakan,cara
pemberianpakandanpemberianairminum.

B.

MateridanMetode
1. Materi
Materidalampelaksanaankegiatanmagangperusahaaniniadalah
sebagaiberikut:
a. Sapi potong yang dipelihara adalah jenis sapi Simmental,
Peranakan Frisien Holstein (PFH), Peranakan Ongole (PO),
BrangusdansapiLimousin.
b. Pakan yang meliputi pakan konsentrat dan hijauan. Konsentrat
dicampur sendiri dengan beberapa bahan pakan seperti white
brand,kulitkedelai,bungkilkelapa,amppaskecap,bekatul,kulit
kacang,singkongdantretes.Pakanhijauanyangdigunakanadalah
rumputGajahdanjeramipadi.

11

2. Metode
Dalam pelaksanaan kegiatan magang ini mengamati tentang manajemen pemberian
pakanmeliputijenispakanyangdiberikan,pencampuranbahanpakan,caramemperolehpakan,
jumlahpemberianpakan,frekuensipemberianpakan,carapemberianpakandanpemberianair
minum.
C.

CaraPengambilanData
Carapengambilandatayangdigunakanuntukmemperolehdatayangdiperlukanadalah:
1.

Pengamatan(observasi)
Pengamatan dilakukan secara langsung terhadap kegiatan yang berhubungan dengan
pelaksanaanoperasionalperusahaanyangberhubungandenganpelaksanaankegiatanMagang
Perusahaangunamemperolehinformasidanpengalamanlangsung.

2.

Wawancara
Wawancara dilakukan dengan mengadakan tanya jawab secara langsung dengan
responden.RespondenyangdimaksuddalamkegiatanMagangPerusahaaniniadalahmanajer
farm,supervisorproduksi,stafperusahaandankaryawankandang.

3.

Magang
Kegiatanmaganginimerupakankeikutsertaanmahasiswadalampelaksanaanaktivitas
perusahaansehinggamahasiswamemperolehpengalamankerjasecaralangsungdarikegiatan
tersebut.

4.

Studipustaka
Studipustakadilakukandenganmencariinformasipendukungyangberkaitandengan
kegiatan perusahaan dengan cara memanfaatkan data pustaka yang tersedia misalnya buku,
jurnaldanmajalahilmiah.

D.

SumberData
Sumberdatayangdiperolehberdasarkansifatdatayangdikumpulkanadaduajenisdata
yaitu:
1.

Data primer adalah data yang diperoleh melalui wawancara secara langsung dari
responden seperti manajer perusahaan, staf, karyawan, dan masyarakat sekitar perusahaan
denganmenggunakanalatbantuberupakuisioner.

2.

Datasekunderadalahdatayangdiperolehsecaratidaklangsungdarisumber.Dalam
kegiatanMagangPerusahaaniniyangmenjadidatasekunderadalahdatayangdiambildari
buku,catatanyangdiperolehselamaberadadiperusahaandanjurnalyangberhubungandengan
kegiatanMagangPerusahaan.

IV.HASILDANPEMBAHASAN
A. KondisiUmumLokasi
1.

SejarahPerusahaan
CV. Sumber Baja Perkasa adalah perusahaan yang bergerak di
bidang peternakan sapi potong (Feedlot) yang berdiri pada tanggal 1
Oktober2005yangberalamatkandiDukuhSentonoDesaNgawonggoRT.
35 RW. 14 Kecamatan Ceper Kabupaten Klaten. Peternakan ini milik
bapakH.ZainalFanani.Padaawalnyapeternakaninimemelihara25ekor
sapidariberbagaimacamjenis,antaralain Sapi Simmental,Peranakan
Ongole(PO),Limousin,BrangusdanPeranakanFrisienHolstein(PFH).
SampaisekarangjenisSapiyangdipeliharamasihsama,dimanabakalan
bakalansapitersebutdidatangkandaripasar,pedagangsapi(blantik)dan
warga didaerahsekitar.Untukmendapatkanbakalanbakalantersebut,
Supervisor sekaligus pengelola peternakan yaitu bapak Parto terjun
langsungkelapangan.Pengadaanbakalanmasihterussajadidatangkan
denganpembelianbakalanmenggunakansistemjogrokanatautafsiran.
Halhalyangmelatarbelakangiberdirinyapeternakanadalah:
a. Kabupaten Klaten khususnya sekitar Kecamatan Ceper merupakan
daerahyangmempunyaitopografidanklimatologiyangcukupbaik
untukpengembanganusahaternakkhususnyapeternakansapipotong.
Karenadaerahinimempunyaisuhusekitar280Cdengancurahhujan
dansinarmatahariyangcukup,sehinggasangatcocokuntuklokasi
peternakan. Apalagi daerahnya yang datar sehingga mempermudah
akseskegiatanpeternakan.
b. Ketersediaan bahan pakan yang cukup banyak untuk sapi potong.
Pakanhijauanberasaldarisisaproduksipertanianyangberupajerami
padi. PakanhijauanjugamudahdidapatyaiturumputGajah,karena
rumputinisudahdipersiapkanolehperusahaandariawalsebelumya,

14

yaitu dengan menanam rumput ini di areal kandang milik perusahaan, yang didukung
dengansuburnyatanahdidaerahini.
c. Tersedianya tenaga kerja lokal yang cukup banyak dan potensial, sehingga dengan
peningkatan pengetahuan dan ketrampilan cara pemeliharaan ternak sapi, maka dapat
menyeraptenagakerjalokalsebagaitenagakejalapangan.
Disampinguntukmendapatkanlabaataukeuntunganyangdiperolehdariusahapenggemukan
sapipotong.Usahapeternakanjugadapatmenciptakanlapangankerjabagimasyarakatsekitar
sehinggadapatmembantuperekonomiandenganmenyeraptenagakerja.Memanfaatkanlimbah
yangdiperolehuntukdijadikanpupukkomposdanpestisidacair.Untuklimbahcairsekarang
sudahdiolahmenjadiPestisidacairyangdapatdigunakanuntukmembasmiataumelindungi
tanamanpertaniandariseranganhama.Untuklimbahpadatdisinijugasudahdiolahmenjadi
pupukorganikdansudahdipasarkanmeskipunmasihdidaerahKlatenkhususnyaCeperagar
petanidisekitarCV.SumberBajaPerkasatidaktergantungdenganpupukkimiayangsekarang
inisusahdiperolehdipasaran.
Perusahaaninididirikandenganmelihatpeluangpasaryangcukupluasyaitudengan
melihatkebutuhanataukonsumsidagingmasyarakatIndonesiayangsemakinmeningkatdari
tiap tahunnya. Mengenai konsumsi produk produk peternakan khususnya daging, dengan
melihat hal tersebut peternakan ini mempunyai rencana untuk pengembangan usaha yaitu
denganmendirikanRumahPotongHewan(RPH)danpengolahandagingmenjadibakso.
2.

Strukturorganisasi
Keberhasilansuatuperusahaantidakterlepasdarisuatuperencanaanyangterorganisasi.
Maka untuk menunjang suatu kegiatan operasional perusahaan sangat dibutuhkan struktur
organisasi.Fungsidaristrukturorganisasiadalahuntukmenentukanseorangtenagakerjayang
bertanggungjawabterhadappekerjaandankepadasiapaiaharusmelaporkanhasilkegiatannya.
Halinisangatdiperlukanagarsetiaptenagamengetahuihakdankewajibannya.
BaganstrukturorganisasidipeternakanCV.SumberBajaPerkasasepertiterlihatpada
gambar1berikut:

Pemilik
Bpk.HZainalFanani

Manajer
Gunawan

Supervisor
Parto

Pakan
Murwito
Safari
Sugeng

Pemeliharaan
Andri
Sugeng
Ujang

Penanganan
limbah
Yani
Karimin

Gambar1.StrukturOrganisasiCV.SumberBajaPerkasa
Pemimpin perusahaan tertinggi dari CV. Sumber Baja Perkasa dipegang pemilik
sekaligus sebagaidirekturyaituBapakZainalFanani.Direkturdibantuolehseorangmanajer
yang dipegang oleh Bapak Gunawan. Dalam menjalankan tugas sebagai direktur seorang
direkturmembawahi:
a.

Manajeryangmempunyaitugasdantanggungjawabsebagaiberikut:
Mengelolausahapenggemukansapisecaraintensifagarmencapaitujuanyangdiinginkan

b.

Supervisoryangmempunyaitugasdantanggungjawabsebagaiberikut:
1) Mengawasidanmelakukanpencatatanterhadapsapiyangmasukmaupunyangkeluar
pternakan.
2) Melakukantransaksidenganpembeli.

c.

Pekerjakandang,yangmempunyaitugasdantanggungjawabsebagaiberikut:
1) Melaksanakansemuaaktifitasyangadadipeternakantersebut
2)

Membantubagianpemasarandalamprosespemasaran.
PelaksanaansertapembagiantugasdiCV.SumberBajaPerkasasudahterlaksanacukup

baikwalaupunperusahaanbelumberdirilama.Untuksetiaptugassertamengontroljalannya
peternakansudahjelasyangbertanggungjawab.sehinggadiharapkankelancarankerjadapat
berjalanbaiksesuaiyangdiharapkan.
3.

LokasiPeternakan
Peternakan sapi ini berlokasi di Dukuh Sentono RT 35 RW 14 Desa Ngawonggo
KecamatanCeper,KabupatenKlaten,yangmerupakandaerahdataranrendahdengantopografi

datar dan landai. Sekitar areal kandang merupakan area persawahan yang cukup luas yang
mempunyaitemperatur280Cdengancurahhujanyangsedang,arahanginbergerakdariselatan
keutaradansinarmatahariyangcukup.Ketersediaanairdanpakanyangmelimpahdanmudah
didapatsangatmendukungusahapeternakansapikhususnyasapipotong.
Lokasipeternakansebaiknyajauhdaripemukimanpendudukagarbauyangdihasilkan
oleh ternak yang berupa limbah tidak mengganggu pemukiman penduduk sekitar. Jarak
peternakanataukandangdaritempatpemukimanpendudukminimal50meter(Sarwantodan
Arianto,2000).MenurutpernyataanSantoso(2000)bahwalokasipeternakansebaiknyajauh
darilokasipemukimanpenduduksertadekatdengansaranatransportasi,dekatdengansumber
airdandekatdengansumberpakan.Pemilihanlokasipeternakansapitergantungdiantaranya
padageografidantopografi,ketersediaantenagakerja,ketersediaanbahanpakan,ketersediaan
air,transportasidanketersediaanbakalanyangbaik.
Batas wilayah sebelah utara adalah pemukiman penduduk yang cukup padat yaitu
DukuhCandi,sebelahSelatanDesaSentono,sebelahbaratarealpersawahandanDesaPandean,
batastimurDesaTegalRejo.
4.

LuasArealPeternakan
Luas arealpeternakansapipotongCV.SumberBajaPerkasasekitar3340m 2 yang
terdiridari bangunan penunjang,bangunankandang,mesdanlahanuntukmenanamrumput
Gajah.Jenisjenisbangunanyangadadilokasitersebutantaralainsepertiterlihattabel1:
Tabel1.BangunanbangunandiCV.SumberBajaPerkasa.
JenisPenggunaan
1.

Bangunan

Penunjang
a.
Gudangpakan
b.
Tempatpakanjerami
c.
Kamarkecil/WC
d.
Bangunan pengolahan
pupuk
e.
Bakpenampunganair

Luasbangunan
M2
38,57
126,83
4,12
206,09
4,71

2,77
14,6

Keterangan

pakan

Menyimpan

Tempat
fermentasi

Tempatuntuk
mandi

Tempatuntuk
mengolahpupuk

Tempatuntuk
menampungair
kotor

Tempatuntuk
menampunglimbah

cair
f.
LimbahCair
g.
Pencampurankonsentrat
2.

300
300
300

Untuk
mencampur
konsentrat

Bangunan
KandangTernak
a.UkurankandangA
b.UkurankandangB
c.UkurankandangC

3.Luasbangunanmes
4.lahanuntukmenanam
rumputGajah
Luasarealseluruhnyayang
dimiliki

51
1983,95

Tempatistirahat

3340

Sumber:DataSekunderCV.SumberBajaPerkasa(2009).
5.

PopulasiTernak
JenisternakyangdipeliharadiCV.SumberBajaPerkasaadalahbangsasapiSimmental,
PeranakanOngole(PO),PeranakanFrisienHolstein(PFH),Brangus,danLimousin.Pembelian
bakalanbakalan tersebut dilakukan dengan sistem jogrokan atau tafsiran bukan dengan
timbangan. Orang yang diberi kepercayaan untuk mencari bakalan adalah bapak Suparto
bekerjasamadenganrekannyayangberprofesisebagaipedagangsapi(blantik).
Kebanyakansapisapibakalandidatangkanataudiperolehdaripendudukdandaripasar
sapi,yaitudaripasarSungginganBoyolali,pasarGemolong,pasarSumberLawang.Sapiyang
bagusuntukdigemukanselama6bulanmemilikikriteriakriteriaantaralain,dipilihbakalan
yangmemilikibadantinggi,agakkurus,badanpanjang,tulangtulangbesardansehattanpaada
cacat sedikit pun.Apabilasapi memenuhikriteriabakalan yangbaik selanjutnyadilakukan
transaksi.
Umursapiyangdipelihararatarata11,5tahunyangmempunyaibobotbadansekitar
259kg313kgdariberbagaijenisternakyangada,sedangkanuntukternakyangbobotbadan
sekitar370kg430kgumurrataratanya1,52tahun.Jumlahdanjenisternakyangada
selamakegiatanmagangadalahsepertiterlihatpadatabel2:

Tabel2.PopulasiTernak
Bangsasapi
Simmental
PO
PFH
Brangus

Jumlah(ekor)
64
11
10
5

Keterangan
Jantan
jantan
jantan
jantan

Limousin

15

4betina
4jantan

Jumlah

105

Sumber:DataSekunderCV.SumberBajaPerkasa(2009)
SemuakandangdipeternakansapiCV.SumberBajaPerkasamemilikikapasitasyang
sama,yaitudapatdapatmenampung40ekorsapisetiapkandangnya,dantidakadapembedaan
tempatuntukjenissapitertentuataumenurutbobotbadannya.Selamakegiatanmagangkami
mendapatkandatasapisapidiCV.SumberBajaPerkasamulaidarijenissapi,beratbadanawal,
beratbadanakhirdanpertambahanbobotbadanhariannya,sepertiterlihatpadatabel3,4,5.
Tabel3.DatabobotbadansapipadakandangA
No

Jenissapi

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23

Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental

No.
Sapi
1
2
3
7
8
9
10
11
15
18
21
22
23
24
26
27
28
29
31
32
33
34
35

BB.Awal
(Kg)
413
415
393
406
389
400
416
350
396
430
412
472
431
445
433
389
447
418
450
400
412
425
433

BB.Akhir
(Kg)
444
443
425
428
434
423
428
374
425
454
432
491
453
474
460
412
478
440
479
414
435
439
454

PBBH
(Kg)
1,03
0,93
1,07
O,93
0,83
0,77
0,4
0,80
0,97
0,80
0,67
0,63
0,73
0,97
0,90
0,77
1,03
0,73
0,97
0,46
0,77
0,46
0,70

24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40

Limousin
Limousin
Limousin
Limousin
Limousin
Limousin
PO
PO
PO
PO
PO
PO
PO
PO
PO
Brangus
Brangus
Ratarata

4
36
37
38
39
40
5
6
12
13
14
16
17
19
20
25
30

386
321
375
446
449
429
376
360
364
367
346
406
366
324
419
412
352

411
347
400
360
473
450
391
377
378
386
364
420
385
333
432
435
379

0,83
0,80
0,83
0,46
0,80
0,70
0,50
0,57
0,47
0,63
0,60
0,47
0,63
0,30
0,43
0,77
0,80
0,72

Sumber:dataprimerCV.SumberBajaPerkasa(2009)
Tabel4.DatabobotbadansapipadakandangB
No

Jenissapi

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23

Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental

No.
Sapi
1
2
3
4
5
6
10
11
12
13
14
15
16
17
18
20
21
22
23
24
26
27
28

BB.Awal
(Kg)
782
723
751
711
690
626
413
385
393
432
384
434
432
398
427
449
447
395
456
425
458
460
437

BB.Akhir
(Kg)
807
751
783
745
719
659
437
399
281
455
410
463
446
424
451
362
478
414
478
454
469
476
463

PBBH
(Kg)
0,83
0,93
1,07
1,13
0,96
1,10
0,80
0,47
0,67
0,77
0,87
0,96
0,47
0,87
0,80
0,43
1,03
0,63
0,73
0,96
0,37
0,53
0,87

24
25
26
27
28
29
30
31
32
33
34
35
36
37
38

Simental
Limousin
Limousin
Limousin
Limousin
PFH
PFH
PFH
PFH
PFH
PFH
PFH
Brangus
Brangus
Brangus
Ratarata

29
7
8
9
25
30
31
32
33
34
35
36
19
37
38

416
403
391
411
415
391
440
437
418
416
430
475
347
414
483

431
431
416
434
444
415
471
461
450
430
445
499
368
346
501

0,50
0,93
0,83
0,77
0,96
0,80
1,03
0,80
1,07
0,47
0,83
0,80
0.70
0,73
0,60
0,80

Sumber:dataprimerCV.SumberBajaPerkasa(2009)

Tabel5.DatabobotbadansapipadakandangC
No

Jenissapi

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Simental
Limousin
Limousin
Limousin
Limousin
Limousin

No.
Sapi
1
2
3
9
10
11
12
16
17
18
20
23
24
25
26
27
28
4
5
6
7
8

BB.Awal
(Kg)
433
352
365
419
413
385
393
324
350
427
449
456
425
415
458
460
437
321
307
329
352
314

BB.Akhir
(Kg)
468
380
397
434
437
399
281
338
376
451
362
478
454
427
469
476
484
321
307
329
352
314

PBBH
(Kg)
1,17
0,93
1,07
0,77
0,80
0,47
0,63
0,47
0,87
0,80
0,43
0,73
0,57
0,40
0,37
0,53
0,30
0,50
0,20
0,43
0,30
0,33

23
24
25
26
27
28

Limousin
PO
PO
PFH
PFH
PFH
Ratarata

13
14
15
19
21
22

432
413
310
347
447
395

432
413
310
347
447
395

0,77
0,50
0,30
0,70
1,03
O,63
0,62

Sumber:dataprimerCV.SumberBajaPerkasa(2009)
PenimbanganberatbadansapidipeternakansapiCV.SumberBajaPerkasadilakukan
denganmenggunakantimbanganelectrik.Penimbanganpadasaatsapidatangdanpadasaat
sapi akan dijual. Penimbangan juga dilakukan setiap sebulan sekali untuk mengetahui
pertambahanberatbadanhariannya.
Sapiyangbarusajadatanglangsungmasukkedalamkandang

bersamaan dengan

sapi lain tidak dikarantina lebih dahulu karena disana tidak ada kandang karantina hanya
dibiasakan dengan kondisi kandang atau lingkungan setempat dan pakan yang diberikan.
Padahalsebaiknyasapiyangbarusajadatangditempatkandikandangkarantinaterlebihdahulu
hal ini untukmengantisipasi terjadinyapenularan bibit penyakit yang dibawa sapiini. Sapi
bakalanyangtelahsampaidipeternakankemudiandiberikanvitaminBkomplek untukmenambah
nafsumakandanobatcacing,pemberiantersebutjugadilakukansetiapsatubulansekali.
6. Pakan
Pada dasarnya, sumber pakan sapi dapat disediakan dalam bentuk hijauan dan
konsentrat. Sumber pakan di peternakan CV. Sumber Baja Perkasa sudah memenuhi untuk
usahapenggemukansapipotong.PakanhijauanyangdiberikanberuparumputGajahdanjerami
padi, sedangkan konsentrat berupa campuran dari beberapa bahan pakan seperti Singkong
fermentasi(sigkong,bekatul,kulitkacang,tetes tebu), wheatbrand,kulitkedelai, bungkil
kelapa,ampaskecap,bekatuldantetestebu.
Dalamusahapenggemukansapipotong,pemberianpakanditujukanuntukmemenuhi
kebutuhanhiduppokokdanproduksi.Kebutuhanhiduppokoksangattergantungdaribobot
badanternak,yaitusemakinberatbobotbadanternakmakasemakintinggijumlahkebutuhan
pakannya,sedangkankebutuhanproduksisangattergantungdaripertambahanbobotbadanyang
dicapai,yaitumakintinggipertambahanbobotbadanyangdicapaimakamakinbanyakpula
jumlahkebutuhanpakannya.
7. Perkandangan

Lokasikandangcukupstrategiskarenadekatdenganjalanrayasehinggamempermudah
transportasi.Lokasikandangmembujurdariarahutarakeselatandenganbentukatapkandang
tertutupyangmenggunakanbahanseng.Karenahargarelatifmurah,mudahdidapat,tahanlama
danpanasmataharidapatditahandenganbaik,sehinggatidaklangsungmempengaruhipanas
ruangankandang.Sebagiankandangyangterbukayaitupadabagianventilasi.Sehinggasinar
mataharitetapdapatmasukkekandangdanventilasiudaratidakterhambat.Halini sesuai
denganpernyataanAbidin(2002)bahwasinarmatahari,terutamapadapagihari,harusdapat
masuk secara langsung ke dalam kandang. Karena sinar ultraviolet sangat baik untuk
membunuhkumankumanpenyakityanghidupdidalamkandang.
Bangunan kandang ada 3 buah yang masingmasing kandang berkapasitas 20 ekor.
Kandang kandang tersebut semuanya dipakai, yang terdiri dari kandang A, B, dan C.
Kapasitas tiap kandang semuanya sama, yaitu setiap kandangnya terdiri dari 40 ekor sapi,
sehinggasapiakandapatbergerakbebas.
Dinding kandang terbuat dari tembok. Konstruksi dinding kandang dibuat setengah
terbukasehinggapertukaranudaralancar.Kandangsudahbersifatpermanensehinggasangat
layakdipakaidalamjangkapanjang.Lantaidarisemendengankemiringan 30,dimaksudkan
agar feses atau urine dapat mengalir mudah ke tempat pembuangan limbah. Setiap petak
kandang dilengkapi dengan tempat pakan dan tempat minum. Kandang yang ada termasuk
kandangindividu,dengansistemheadtoheadatausalingberhadapan.
Tempatpakanditempatkanpadasisidepankandangdanberdampingandengantempat
minum memanjang dari kandang dalam bentuk bakbak. Tempat pakan dipakai untuk dua
macam pakan yaitu pakan konsentrat dan pakan hijauan. Keduanya terbuat dari semen
sehingggamudahdibersihkandantahanlamaataupermanen.Tempatminumberadaditengah
dantempatpakanberadadisampingkiridankanansehinggamemudahkansapiuntukminum.
Peralatanyangdigunakandalamkandangantaralaingerobakdorong,sapulidi,serokan,
garu,sikat,selangair,gancu,sekop,ember.Saranapenunjanglainnyaadalahgudangtempat
pembuatandanpenyimpananpakan,tempatpengolahanpupukkompos,tempatpenampungan
air,loadingarea(tempatmenurunkandanmenaikkansapi),truk,mess,dantoilet.
Pembersihan kandang dilakukan setiap hari secara bergiliran. Biasanya pembersihan
kandang dilakukan setelah pemberian pakan konsentrat pada pagi hari. Limbah padat
dibersihkan menggunakan garu dan diangkut dengan gerobak dorong untuk ditampung di

tempatpenampunganlimbahpadatuntukdijadikanpupukkompos.Pembersihanselanjutnya
disiramairagarsisafeseslangsungmengalirkesaluranpembuanganlimbahcairyangnantinya
dialirkankesawah.
8.

PenangananKesehatan
Kesehatanmerupakanfaktoryangsangatberpengaruhpadakondisiternak.Kesehatan
mutlakdiperlukankarenadapatmencegahkerugianbilaterjangkitpenyakit.Dengandemikian
diperlukanpencegahan,penanganandanpenanggulanganpenyakit.Penggemukansapipotong
kemungkinanterjangkitnyapenyakittidakterlalubesarkarenalamapenggemukantidakterlalu
lama.
PenyakityangseringmenyerangsapidipeternakanCV.SumberBajaPerkasaadalah
pilekataufluyangditandaidengankeluarcairanataulendirdarihidungdannafsumakanturun.
Halinidisebabkankarenagangguansistempernapasanternak,perubahancuaca.Pengobatan
yangdilakukandenganpemberianvitaminBkomplek untukmeningkatkannafsumakan,dengan
dosispemberian1020mldengancaradisuntikan intramaskular padabagianpunggungsapi
dandiberikandalamsatubulansekali.
UsahapencegahansapiyangcacingandenganpemberianKalbazenCdengandosis
pemakaian10ccsetiapbulansekaliuntukjenissapibesarmaupunsapikecilmelaluimulut(per
oral).Apabilaterjadilukapadasapiyangdiakibatkangesekandenganbendasekitarkandang,
penanganannyayaitudengandiberikanobatGusanexdengancaradisemprotkanjaraksemprot
kuranglebih10cm.SedangkanuntuksapiyangterkenakudisdiberikanobatdenganIvervet
dengandosis6ccuntukjenissapibesarmaupunkecil,dengancaradisuntikanpadabagian
punggung(intramaskular).
Penanganan yang dilakukan selain dengan menggunakan obatobat medis sebaiknya
dilakukanpencegahanagarbibitpenyakittidakmudahberkembangsepertikebersihankandang,
penyemprotankandangdengandesinfektandalamjangkawaktutertentu,pemberianpakandan
minum yang terpisah dengan tempat lain, pemeliharaan ternak yang sakit dalam kandang
karantina.
Sanitasi dilakukan sebagai upaya untuk menjaga kebersihan lingkungan, agar ternak
terbebasdariseranganpenyakit.MenurutSugeng(2005)sanitasilingkungandilakukanuntuk
menciptakanrasaamandannyaman,bagipeternakmaupunternakyangdipelihara,sertabebas
darigangguaninfeksipenyakityangdapatmerugikanternak

9.Pergudangan
Gudang merupakan tempat untuk menyimpan bahan pakan maupun tempat
pencampuran bahan pakan. Dinding tempat penyimpanan bahan pakan terbuat dari tembok
semen sedangkan atapnya terbuat dari seng bergelombang dan lantainya dari disemen,
sedangkan untuk tempat pencampuran bahan pakan dindingnya terbuat dari tembok dan
lantainyadarisemen.
10.PenangananLimbah
Limbahternakmerupakansisahasilpencernaandanmetabolismepakanyangberupa
limbahpadatberupafesesdanlimbahcairnyaberupaurine.Limbahpadatyangberupafeces
diolahmenjadipupukorganikyangkemudiandigunakansendiriuntukpemupukanperkebunan
sendiri dan untuk sementara ini belum dipasarkan. Sedangkan untuk limbah cairnya yang
berupaurienbelumdiolahdanhanyadialirkankepersawahansekitarmelaluisaluranirigasi.

B. UraianKegiatanMagangPerusahaan
1. JenisPakan
Perusahaan peternakan penggemukan sapi potong CV. Sumber Baja Perkasa dalam
memenuhikebutuhanpakanyangdiberikanpadaternakmemanfaatkanlimbahpertanianatau
limbahindustripertanianyangtidakdikonsumsiolehmanusia.Pakanyangdigunakanberupa
hijauandankonsentrat.Hijauanyangdigunakanberupahijauansegardankering.Hijauansegar
yangdiberikanberuparumputGajahkarenahijauansegarmempunyaikandunganvitamindan
mineralyangdiperlukantubuhternak.Sedangkanhijauankeringberupajeramipadi.Jerami
padi diberikan dalam bentuk jerami fermentasi. Karena pemberian pakan jerami padi
dimaksudkanuntukmemenuhikebutuhanpakansumberseratdanmenimbulkanrasakenyang.
Jeramipadimerupakanlimbahpertanianyangcukuppotensialsebagaipakanternakkarena
tersediacukupbanyakdanmudahdiperolehdisekitardaerahpeternakan.
PemberianjeramipadidiCV.SumberBajaPerkasadiberikandalambentukjeramipadi
fermentasi.Prosespembuatanjeramipadifermentasidenganmenggunakanstarterurea dan
starbio,dandiinkubasikanselama21hari.Ureaberfungsiuntukmemperbaikinilaigizijerami

padi. Pemberian urea pada proses fermentasi dapat meningkatkan kandungan nitrogen pada
jerami, jumlah jerami yang dikonsumsi, dan daya cerna jerami. Urea yang masuk rumen
dihidrolisadengancepatolehenzimureasedanmikrobiarumenmenjadiamoniak,yangakan
digunakan oleh mikrobia rumen untuk aktifitas sintesis protein. Starbio digunakan untuk
meningkatkanpalatabilitas(tingkatkesukaan)ternakterhadapjeramitersebut.Setelahdiproses
denganmenggunakanstarbioakandihasilkanjeramiyangberaromasepertikarameldanmudah
dicernasehinggasangatdisukaisapi.Dayacernasapiterhadapjeramipadifermentasidapat
meningkatsampai40%(Sarwono,2004).
Pakankonsentratyangdigunakanberupakonsentratcampuranyangterdiridarisingkong
fermentasiyangterbuatdaribeberapabahanpakan(sepertikulitkacangdigilingkasar,bekatul,
singkongdantetestebu),wheatbrand,bungkilkelapa,kulitkedelai,ampaskecap,bekatuldan
tetes.Semuabahantersebutdicampurjadisatuhinggahomogen.Pencampuranbahanpakan
lebihmurahpenggunaannyalebihbanyak,halinibertujuanuntukmenghematbiayapakantanpa
harus mengurangi nutrien yang dibutuhkan oleh ternak. Kandungan nutrien bahan pakan
penyusunransumpadatabel6adalahsebagaiberikut:
Tabel6.KandunganNutrienBahanPakanPenyusunRansum(%BK)
Bahan
BK
PK
SK
LK
Ca
P
Beta TDN
Pakan
(%)
(%)
(%) (%) (%)
(%)
N
(%)
1)
fermentasi
86,00 4,8
10,9 1,8
0,9
0,5

70
singkong3)
32,3
3,3
4,3
3,3

87,7 81,8
Bungkil
87,9
21,2 13,1 17,3

41,1
81
3)
kelapa
bekatul3)
89,6 15,9
8,5
9,1

67
3)
Tetes
87,5
3,1

2,7
1,0
0,41 85,6 70,7
Ampas
63,7 23,5 16,0 24,

22,1
87
3)
kecap
2
Kulit
88,6
41,3
8,6 15,0

21,9 83,2
kedelai3)
Wheat
88,4
17,0
8,8
5,1 0,08 1,23

69,9
2)
brand
Jerami
87,5
4,1
32,5 1,5 0,41 0,29

43,2
2)
padi
Sumber:1)DataCV.SumberBajaPerkasa
Siregar,2003.

2)

3)

Parakasi,1998.

2. CaraMemperolehPakan
PakanhijauanberuparumputGajahdiperolehdariarealperkebunansendiri,sedangkan
untukjeramipadidiperolehdarilokasipersawahanyangberadadisekitarpeternakandengan
hargaRp.235.000,/trukdengancaramemesanterlebihdahulu.Jeramipadiyangdiberikan
adalahjeramipadifermentasiyangmenggunakanstarbiodanureasebagai fermentornya,dan
bahantersebutdidapatdariagentokoyangadadidaerah Klaten.Konsentratyangdiberikan
adalahkonsentratcampurandaribeberapabahanpakanyangdiperolehdarisekitarceperdan
beberapadaerahlainsepertikulitkedelaidariBantul,whitebranddariSemarang,ampaskecap
dari Karanganyar, bungkil kelapa dari Lampung, bekatul dari Jogjakarta, singkong dari
Tawangmangu,kulitkacangdariWonosaridanTetesdidapatdariagentokodisekitarCeper.
Sirkulasipengadaanbahanpakandilakukandenganmemperhatikan:
a.

Aspekpenyimpananbahanpakan
Penyimpananbahanpakanyangbaikdidasarkanpadasifatsifatnya,apakah bahan
pakantersebuttahanlamaatautidak.Penyimpananbahanpakanbiasanyadalamjangka
waktuyanglama,sehinggabahanpakanyangdisimpantersebuttidakcepatrusakdantidak
menimbulkan bau tengik. Sedangkan bahan pakan yang tidak tahan lama, maka
pembeliannya lebih sedikit untuk mengurangi resiko kerugian. Syarat syarat untuk
menyimpanbahanpakanyangbaikantaralain,tempatpenyimpanan(gudang)sebaiknya
dibuat alas model panggung yang tingginya 15 cm, bahan pakan yang baru dibeli
sebaiknyadiletakkanpalingbawahkarenabahanpakanyanglamabiarlebihduluhabisdan
untukmenghindarikerusakankarenaterlalulamadalampenyimpanan.

b.

Hargabahanpakan
Hargabahanpakanuntukformulakonsentratdapatdilihatpadatabel7adalahsebagai
berikut:
Tabel7.Daftarhargabahanpakanpenyusunransum(asfed)
No
1
2
3
4
5
6
7

JenisPakan

Harga

Bekatul
Kulitkedelai
Whitebrand
Ampaskecap
Bungkilkelapa
Tetes
SingkongFermentasi

Rp.1500/Kg
Rp.2200/Kg
Rp.2200/Kg
Rp.1000/Kg
Rp.2500/Kg
Rp.1000/Ltr
Rp.1140/Kg

Sumber:datasekunderCV.SumberBajaPerkasa(2009)
DaridatatabeldiatasdapatdiketahuihargakonsentratperkilogramadalahRp.1.486.
Singkong fermentasi tersusun dari beberapa bahan pakan ( seperti bekatul, singkong, kulit
kcangdantetes).SedangkanuntukjeramifermentasiadalahRp.200/Kgdenganrincian400
kgjeramibasahdenganhargaRp.180/kgdicampurdenganstarbiohargaRp.8.750/kgdan
urea0,50kgdenganhargaRp.1.200/kg.
Bahan pakan yang berharga mahal penggunaannya sedikit, sedangkan bahan yang
harganyalebihmurahmakapenggunaannyaakanlebihbanyak.Halinibertujuanmenghemat
biaya pakan dan bahan yang harganya murah belum tentu kualitasnya rendah sehingga
kebutuhanzatzatmakananyangdibutuhkanternakdapattercukupi.
Penggunaanpakankonsentratjadi(buatanpabrik)dapatmenambahbiayapakandan
kurangekonomis.HalinisesuaiyangdiungkapkanSantosa(1999),bahwaapabilakonsentrat
dibelidalambentuksudahjadimakabiayauntukpembeliankonsentratmenjadisangatmahal.
Olehkarenanyasedapatmungkindisusunkonsentratsendirisehinggabiayapakandapatditekan
tanpamengabaikankebutuhannutrienternak.
3. JumlahPemberianPakan
PemberianpakandiCV.SumberBajaPerkasaberupakonsentratdanhijauan.Untuksapi
yangukuran kecildenganbobotratarata380kgjenisPO, simmental,PFH, Brangus dan
sapiLimousinpemberiankonsentratnyasamayaitu8kg/ekorsetiapharinya.Sedangkanuntuk
sapiukuranbesardenganbobotratarata380kgjenis Simmental,PFHdanSapiLimousin
pemberiannyasamayaitudiberikankonsentratsebanyak12kg/ekorsetiapharinya.Danuntuk
sapibobot>600kgderikankonsentratsebanyak16kg/ekorsetiapharinya.
PemberianpakanhijauanberuparumputGajahdanjeramipadijugadidasarkanberat
badan sapi. Untuk sapi ukuran kecil dengan bobot badan ratarata 380 jenis PO, PFH,
Simmental, Brangus, dan Limousin diberikan jerami padi fermentasi sebanyak 4,5
kg/ekor/hari.Untuksapiukuranbesardenganbobotbadanratarata380 jenis Simmental,
PFH,dan Limousin diberikanjeramipadifermentasisebanyak7,5kg/ekor/hari.Pemberian
hijauandanjeramipadifermentasidimaksudkanuntukmemenuhikebutuhanpakansumber
seratdanmenimbulkanrasakenyang,sertamerangsangmikrobaselulitikuntukmencernaserat
kasar.Perbandingankonsentratdanhijauanuntukransumsapi70:30%.

TotalpemberianpakanuntukmasingmasingjenissapidiCV.SumberBajaPerkasadapat
dilihatpadatabel8sebagaiberikut:
Tabel8.PemberianpakanCV.SumberBajaPerkasa
Jenissapi/BBsapi

Pakan

PO
(413Kg)

Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi
Konsentrat
Jerami
fermentasi

PFH
(347Kg)
PFH
(447)
Simmental
(440Kg)
Simmental
(782Kg)
Limosin
(321Kg)
Limosin
(415Kg)
Brangus
(483kg)

Jmlhyg
diberikan
(kg,asfed)

%BK**)

12
7,5

69,34
31,47

Jmlh
diberika
n
(KgBK)
8,32
2,36

8
4,5

69,34
31,47

5,55
1,42

12
7,5

69,34
31,47

8,93
2,36

12
7,5

69,34
31,47

8,32
2,36

16
10,5

69,34
31,47

11,09
3,30

8
4,5

69,34
31,47

5,55
1,42

12
7,5

69,34
31,47

8,93
2,36

12
7,7

69,34
31,47

8,32
2,36

Keterangan:*)Jumlahpemberianpakan(kgBK)samadenganjumlahyangdiberikan(kg,as
fed).
**) Hasil analisis Laboratorium Nutrisi dan Makanan Ternak Fakultas
PeternakanUNDIP(2008)
Berdasarkantabel8dapatdiketahuijumlahpemberianpakanberdasarkanbobotbadan
(%BB)darimasingmasingjenissapisepertiterlihatpadatabel9sebagaiberikut:
Tabel9.Pemberianpakanberdasarkanbobotbadansapi(%BB)diCV.SumberBajaPerkasa
Jenissapi
PO
PFH
PFH

BBSapi
(kg)
413
347
447

Jumlahpakanyg
diberikan(kgBK)
10,68
6,97
10,68

%BBsapi
2,58
2,00
2,38

Simmental
Simental
Limosin
Limosin
Brangus

440
782
321
415
483

10.68
14,39
6,97
10,68
10,68

2,42
1,84
2,17
2,57
2,21

Sumberdata:Hasilperhitunganberdasarkantabel8.
Kemampuan sapi dalam mengonsumsi ransum diukur dalam bentuk bahan kering.
Semakin tinggi bobot badan sapi akan semakin menurun persentase kemampuannya
mengonsumsibahankeringransum.PadausahapenggemukansapipotongdiCV.SumberBaja
Perkasapemberiaanpakannyasudahcukupkarenadiberikansebesar2%3%BBsapi. Dari
beberapasapidapatdiketahuibahwarataratapemberianpakansudahsesuai%dariberat
badansapi,hanyaadasatuyangmasehkurangsedikitpemberianpakannyayaitusapisimental
denganbobotbadan782kg.
4. FrekuensiPemberianPakan
PemberianpakandiCV.Sumberbajaperkasayaitupadapagiharipukul08.00pemberian
konsentrat. Setelah konsentrat habis kemudian di beri singkong yang yang sudah dipotong
potong sekitar pukul 09.00. Jerami fermentasi diberikan setelah kirakira 2 jam setelah
pemberian konsentrat. Kemudian pemberian konsentrat yang kedua pada pukul 14.30.
Kemudianyangterakhirdiberikanhijauanberuparumputgajahdanjeramifermentasi.Untuk
rumputgajahhanyadiberikanpadasoreharisaja.PemberianKonsentratdanjeramidilakukan
duakalidalamsehari.Pemberianjeramidalamjumlahbanyakpadasoreharibertujuanuntuk
menimbulkanrasakenyangdanmemenuhisumberpakanseratkasar.
Menurut Siregar (2003), sapi yang akan digemukkan dan memperoleh ransum yang
terdiri dari hijauan dan konsentrat harus diatur pemberiannya agar tercapai hasil yang
memuaskan. Pemberian hijauan pada sapi yang digemukkan sebaiknya dihindari pemberian
yangsekaligusdandalamjumlahyangbanyak.Pemberianyangdemikianakanberakibatpada
banyaknyahijauanyangterbuangdantidakdimakansapi,sehinggatidakefisien.Menuruthasil
penelitianyangsudahdilakukanbahwafrekuensipemberianpakanlebihdariduakalisehari
hasilnyalebihbaikdaripadayangdilakukanduaatautigakalisehari.Frekuensipemberian
pakansemakinseringmakasemakinbaik,namundalamjumlahyangsama.
5. SistemPemberianPakan
Teknikpemberianpakanyangbaikuntukmencapaipertambahanbobotbadanyanglebih

tinggipadapenggemukansapipotongadalahdenganmengaturjarakwaktuantarapemberian
konsentratdenganhijauan.Hijauandiberikansekitarduajamsetelahpemberiankonsentratpada
pagiharidandilakukansecarabertahapminimalempatkalidalamseharisemalam.Frekuensi
pemberianhijauanyanglebihseringdilakukandapatmeningkatkankemampuansapi untuk
mengkonsumsi ransum dan juga meningkatkan kecernaan bahan kering hijauan itu
sendiri(Cullough,1973).
6. PemberianAirMinum
Pemberianairminumdilakukansecara adlibitum,dimanaketersediaannyatidakpernah
kurangbagiternakatausecaraterusmenerus.Airdalambakdikontrolsetiapsaatsehinggaair
selalu terisi penuh. Pengontrolan dan pembersihan tempat air minum dilakukan setelah
pemberiankonsentrat.Kebutuhanairminumuntukternaksapididasarkanpadakebutuhansapi
itu sendiri. Air minum sebaiknya disediakan sesaat sebelum makan untuk menghindari
terjadinyakembungperut.
Airminumdiberikansecara adlibitum,dimanaketersediaannyatidakpernahkurang
bagiternak.MenurutAkoso(1996)sapidewasarataratamembutuhkanairminum2030liter
setiaphari.KebutuhanairminumuntuksapidiCV.Sumberbajaperkasaterpenuhikarenaair
minum diberikan secara ad libitum. Kebutuhan air untuk kebutuhan ternak baik untuk air
minummaupunkebersihankandangbersumberdarisumurboryangkemudiaanditampungke
dalambakpenampunganair.
7. PertambahanBeratBadanHarian
Pertambahanbobotbadanharianyangberbedajugadipengaruhiolehjumlahkonsumsi
pakanyangdiberikan.Karenapakanyangdiberikanmemilikikandungannutrienyangberbeda.
Selainitu,yanglebihutamalagiadalahfaktorgenetik(kemampuantubuhdalammengubah
pakan menjadi produk atau PBB ). Kemampuan sapi ataupun ternak lainnya dalam
mengkonsumsiransumadalahterbatas.Keterbatasaninidipengaruhiolehbanyakfaktoryang
mencakupternakitusendiri,keadaanransumdanfaktorluarlainnyasepertisuhuudarayang
tinggidankelembapanudarayangrendah.Karenabanyaknyafaktoryangmempengaruhimaka
tidakmungkinmendapatkanangkayangtepatdanakuratuntukmenentukankemampuaansapi
dalammengkonsumsiransum(Siregar,1999).
Pertambahan bobot badan harian dihitung dari selisih bobot badan akhir dikurangi
bobotbadanawalkemudiandibagidenganlamaperiodepenggemukan(Rasyaf,1993). Atau

dapatditulisdenganrumussebagaiberikut:
PBBH=BeratbadanakhirBeratbadanawal
LamaPenggemukan

Tabel.10.PertambahanbobotbadanhariansapidiCV.SumberBajaPerkasa
No
1
2
3
4
5
6
7
8

JenisSapi
PO
PFH
PFH
Simmental
Simmental
Limousin
Limousin
Brangus

ratarata
beratawal
413
347
447
440
782
321
415
483

ratarata
beratahkir
482
368
478
471
807
347
444
501

ratarata
PBBH
0,50
0,70
1,03
1,03
0,83
0,87
0,97
0,60

Sumber:Hasilperhitunganberdasarkantabel4,5,6.
DaritabeldiatasdapatdiketahuibahwauntukjenissapiPOpertambahanbobotbadannya
palingsedikitdibandingkandengansapiyangyanglainyaitu0,50kg/hari.Disebabkankarena
untukjenissapiPOmemilikiketerbatasandalampertambahanbobotbadanmeskipundengan
pemberianpakanyangmemilikikandungannutrienyangbaik.UntukjenissapiPFH(3)dan
Simental(4)pertumbuhanbobothariannyapalingtinggiyaitu1,03kg/hari.Sedangkanuntuk
jenis sapi yang lainnya memeliki pertambahan bobot harian antara 0,60 0,90 kg/hari.
Pertambahanbobotbadanharianyangberbedaipengaruhiolehjumlahkonsumsipakanyang
diberikan.Selainitu,yanglebihutamalagiadalahfaktorgenetik.Kemampuansapiataupun
ternaklainnyadalammengkonsumsiransumadalahterbatas.Keterbatasaninidipengaruhioleh
banyakfaktoryangmencakupternakitusendiri,keadaanransumdanfaktorluarlainnyaseperti
suhu udara yangtinggi dan kelembapan udara yang rendah. Karena banyaknya faktor yang
mempengaruhimakatidakmungkinmendapatkanpertumbuhanbobotharianyangsama.
8. KonversiPakan
Konversipakandihitungdengandengancaramembagijumlahkomsumsipakandengan
pertambahanbobotbadanharian(Siregar,1994).

KonversiPakan

=KonsumsiPakan
PBBH

KonversipakanuntuksemuajenissapiyangadadiCV. SumberBajaPerkasadapat
dilihatdaritabel.8sebagaiberikut:
Tabel11.KonversiPakan
No
1
2
3
4
5
6
7
8

JenisSapi
PO
PFH
PFH
Simmental
Simmental
Limousin
Limousin
Brangus

Berat
badan
413
347
447
440
782
321
415
483

Konsumsi
pakanBK
10,68
6,97
10,68
10,68
14,39
6,97
10,68
10,68

ratarata
PBBH
0,50
0,70
1,03
1,03
0,83
0,87
0,97
0,60

Konversi
pakan
21,3
9.9
10,3
10,3
17,3
8
11
18

Sumber:Hasilperhitunganberdasarkantabel8dan10
Daritabeldiatas dapatdiketahuibahwauntukjenis sapiPO danbrangus konversi
pakannyapalingtinggi.UntukjenisPFH, Simmental dan Limousin konversipakannyapaling
sedikit,yangberartilebihefisiendalammemanfaatkanpakanyangdikonsumsidanrelatiflebih
menguntungkan dibandingkan dengan jenis sapi PO dan Brangus. Semakin kecil angka
konversi pakan maka semakin sedikit pula pakan yang dibutuhkan oleh ternak untuk
menghasilkanpertambahanberatbadan.
9. FeedCostPerGain
Feed cost per gain diperoleh dengan cara menghitung jumlah biaya pakan yang
diperlukanuntukmenghasilkanpertambahanbobotbadan(Wodzicka etal.,1993). Feedcost
per gain dihitung berdasarkan pada harga pakan saat pelaksanaan kegiatan magang yang
dikeluarkansetiapharidibagidenganreratapertambahanbobotbadanyangdihasilkan.Atau
dapatditulisdenganrumussebagaiberikut:
FeedCostPerGain =KonsumsiPakan(BK)/harixHargapakan/kg
PBB

Untukperhitunganfeedcostpergaindapatdilihatpadatabel12berikut:

Tabel12.FeedCostPerGain
No

1
2
3
4
5
6
7
8

JenisSapi

PO
PFH
PFH
Simmental
Simmental
Limousin
Limousin
Brangus

Berat

Konsumsi

Harga

badan

pakan

pakan/kg

413
347
447
440
782
321
415
483

(BK)/hari
10,68
6,97
10,68
10,68
14,39
6,97
10,68
10,68

1.686
1.686
1.686
1.686
1.686
1.686
1.686
1.686

PBBH

Feedcost
pergain

0,50
0,70
1,03
1,03
0,83
0,87
0,97
0,60

36.012
16.787
17.482
17.482
28.700
13.507
18.563
30.010

Sumber:Hasilperhitunganberdasarkantabel8dan10.
Darihasilperhitungan(tabel.12)menunjukkanbahwafeedcostpergainuntuksapiPO
paling tinggi bila dibandingkan dengan jenis sapi sapi yang lainnya. Nurdin (2000) cit
Sugiharto, et al., (2004) menyatakan bahwa nilai feed cost per gain erat kaitannya dengan
menurunnyanilaikonversipakan.Semakinrendahkonversipakan,makasemakinrendahbiaya
yangharusdikeluarkanuntukpertambahanbobotbadan.

V.KESIMPULANDANSARAN
A. Kesimpulan
BerdasarkanhasilmagangdipeternakanCV.SumberBajaPerkasadapatdisimpulkan,bahwa
padadasarnyamanajemenpenggemukansapipotongdiCV.SumberBajaPerkasasudahcukup
baik..Haliniterlihatdaribeberapakegiatanyangdijalankandiantaranyasebagaiberikut:
1. Pengadaansapibakalansudahmempunyailanggananpedagangsapidaridaerah
Boyolali,Kalioso,SumberLawangdanBayat,denganjenisbakalansepertisapi
Simmental, Limousin, Peranakan Friesian Holstein (PFH), Peranakan Ongole
(PO)danBrangus.
2. Frekuensipemberianpakanduakali sehariyaitukonsentratpadapukul08.00
WIBdanpadapukul14.00WIBsedangkanuntukhijauanpadapukul10.00WIB
dan 15.00 WIB dengan imbangan konsentrat dan hijauan (dalam BK) dalam
ransumadalah70%dan30%.
3. Untuk jenis sapi PO memiliki pertambahan bobot badan paling sedikit
dibandingkanjenis sapiyanglain.PeternakansapiCV.SumberBaja Perkasa
memeliharasapiPOdalamjumlahbanyakhanyapadasaatmendekatilebaran
haji.
4. PenyakityangseringmunculdipeternakanCV.Sumber BajaPerkasaadalah
lukadankudisyangpenanganannyadengandiberikanobat Gusanex danobat
Ivervet,sedangkanuntukmenambahnafsumakandancacinganpenanganannya
yaitudengandiberikanvitaminBkompleksdanobatKalbazenC.
5. Pemasarandenganmenggunakansistemtafsiran(jogrokan)dantimbanganberat
hidup.SuperVisordiPeternakansapiCV.SumberBajaPerkasamengatakan
bahwa lebih menguntungkan bila menggunakan system jogrokan karena
penafsirantidakseakurattimbangan.

B. Saran
1. Pelaksanaanrecordingataupencatatansebaiknyalebihlengkapdanteraturagarmudah
melakukanevaluasi.
2. Sebaiknyaselalumemantau perkembanganhargasapidipasaransehinggapadasaat

penjualansapitidaktertipuolehpembeli.
3. sebaiknya membuat kandang karantina karena disana tidak ada kandang karantina hanya
dibiasakan dengan kondisi kandang atau lingkungan setempat dan pakan yang diberikan.
Padahalsebaiknyasapiyangbarusajadatangditempatkandikandangkarantinaterlebihdahulu
haliniuntukmengantisipasiterjadinyapenularanbibitpenyakityangdibawasapiini.
4.

DAFTARPUSTAKA
Abidin,Z.2002.PenggemukanSapiPotong.AgromediaPustaka.Jakarta.
Anonimus.1991.BeternakSapiPotong.Kanisius.Yogyakarta.
.2001. SapiPotong. BalaiPengakajianTeknologiPertanianJawa
Tengah.
Darmono,1993.TataLaksanaUsahaSapiKereman.KanisiusYogyakarta.
Djarijah,A.S.1996.UsahaTernakSapi.Kanisius.Yogyakata.
Murtidjo,B.A.1990.BeternakSapiPotong.Kanisius.Yogyakarta.
MeCullough,M.E.1973.OptimumFeedingofDairyAnimalforMeatandMilk
(Athens:TheUniversityofGeorgiaPress).
Parakkasi, A. 1998. Ilmu Nutrisi dan makanan Ternak Ruminan. Universitas
IndonesiaPress.Jakarta.
Reksohadiprodjo,S.1984. PengembanganPeternakandiDaerahTropis.BPFE.
Yogyakarta.
Santosa,U.2002. . TataLaksanaPemeliharaanTernakSapi.PenebarSwadaya.
Jakarta.
Sarwono,B.2002.PenggemukanSapiSecaraCepat.PenebarSwadaya.Jakarta
Sarwono,BdanH.B.Arianto.2002. PenggemukanSapiPotongSecaraCepat.
PenebarSwadaya.Jakarta.
Setiadi, B. 2001. Beternak Sapi Pedaging dan Masalahnya. Aneka Ilmu.
Semarang.
Siregar,S.B.,1996.RansumTernakRuminansia.PenebarSwadaya.Jakarta.
.2003.PenggemukanSapi.PenebarSwadaya.Jakarta.
Sugeng,Y.B.2002.SapiPotong.PenebarSwadaya.Jakarta.
Wodzicka,M.,Tomaszewska,A.Djajanegara,S.Gardiner,T.R.Wiradarya,dan
I.M.Mastika, 1993. Small Ruminant ProductionInTheHumidTropics
(With Special Reference to Indonesia). Sebelas Maret University Press.
Surakarta.

47