Anda di halaman 1dari 23

Universa Medicina

Oktober-Desember 2006, Vol.25 No.4

Penerapangeriatrikkedokteranmenujuusialanjutyang
sehat
KrisPranarka

DivisiGeriatrik,DepartemenIlmuPenyakitDalam

FakultasKedokteranUniversitasDiponegoro

ABSTRAK

Padalanjutusiagejalaklinikpenyakitseringkaliberbedadenganpenderitausialebihmuda.Perubahanyangterjadi
padalanjutusiasejalandenganperiodepenuaanmenunjukkanadanyakelainanpatologiyangmultipelmerupakan
suatutantangandalammenilaigejalaklinik,pemberianpengobatandanrehabilitasi.Kedokterangeriatrikmerupakan
cabangdariilmupenyakitdalamdanmenaruhperhatianterhadapaspekklinik,pencegahan,pengobatan,danpsiko
sosialdarilanjutusiabaikyangsakitmaupunsehat.Tujuandarikedokterangeriatrikadalahi)memeliharakesehatan
lanjutusiadenganmenghindaripenyakit,ii)mempertahankankemandirianyangmaksimal,iii)deteksidinidan
pemberianpengobatanyangtepat,daniv)memberikanperawatanyangsimpatikdanmendukungpadapenyakit
terminal.Menuasehatseringkalidigunakansebagaisinonimdaribebasdariketidakmampuanpadalanjutusia.Jadi
menuasehatharusdiikutidenganlanjutusiayangaktif,senantiasaberperansertapadaaktifitassosial,budaya,
spiritual,ekonomidanperistiwadimasyarakat.Sebuahorganisasikedokterangeriatrikyangtertatadenganbaik
mempunyaiperananpentinguntukmenujuusialanjutyangsehat.

Katakunci:Lanjutusia,sehat,kedokterangeriatrik

Practiceofgeriatricmedicinetowardshealthyageing

ABSTRACT

Clinicalpresentationofdiseaseinoldageisoftenlydifferentfromthatinyoungerpatients.Thisandthefactthatold
peoplealsoshowthechangesofageingandofmultiplepathology,makeclinicalassessment,treatment,and
rehabilitationallthemorechallenging.Geriatricmedicineisabranchofgeneralinternalmedicine,concernedwith
theclinical,preventive,remedialandpsychosocialaspectsofdiseaseandhealthintheelderly.Theaimsofgeriatric
medicineare:(i)maintenanceofhealthinoldage,byavoidanceofdiseaseandcontinuingsocialengagement;(ii)
maintenanceofmaximumindependence;(iii)earlydetectionandappropriatetreatmentofdisease;and(iv)
sympatheticcareandsupportduringterminalillness.HealthaccordingtoWHOreferstophysical,mentalandsocial
wellbeing.Healthyageingiscommonlyusedasasynonymfordisabilityfreelifeexpectancytowardsageing.Inits
development,healthyageingwillbemuchinfluencedbyendogenicaswellasexogenicfactors.Logically,healthy
ageingmustbefollowedbyactiveageing,continuingparticipationinsocial,cultural,spiritual,economicandcivic
affairs.Awellorganizedgeriatricmedicineservicehasamajorroleinhealthyageing.

Keywords:Oldage,healthyageing,geriatricmedicine

Korespondensi:aKrisPranarka

DivisiGeriatrik,DepartemenIlmuPenyakitDalam

187FakultasKedokteran,UniversitasDiponegoro

Jl.Dr.SutomoNo.18SemarangJawaTengah

EMail:krispranarka@yahoo.com

Pranarka

LATARBELAKANG

1960baruberjumlah4,5juta,meningkatmenjadi
8,0jutapadatahun1980,danmenjadi14,9juta
padatahun2000.Jumlahpendudukusialanjut
padatahun2010hampirsamadenganjumlah
balita.(1)

Akibatkeberhasilanpembangunandibidang
kesehatanterjadipenurunanangkakelahiran,
angkakesakitandanangkakematianserta
peningkatanangkaharapanhiduppenduduk
Indonesia.Terjadipeningkatanjumlahpenduduk
usialanjut(60tahun).Dalamangkaabsolut,
populasiusialanjutdiIndonesiayangpadatahun

MenurutBadanPusatStatistik,jikapadatahun
1970angkaharapanhidupperempuanIndonesia
48,1tahun,makapadatahun2000menjadi70
tahun,sedangkanangkaharapanhiduplakilaki
Indonesiameningkatdari45tahunmenjadi65

tahun.Halinimengakibatkanpeningkatan
persentaseusialanjut.Persentaseusialanjutpada
tahun2020diperkirakanakanmeningkatmenjadi
11,4%dibandingkantahun2000sebesar7,4%.(2)
Peningkatanpersentasepopulasiusialanjut
berdampakpadapeningkatanmasalahkesehatan
yangberhubungandenganwargausialanjut.
Masalahkesehatanusialanjutmerupakan
masalahkesehatanyangmemilikikekhususan.
Prosesmenuamengakibatkanberkurangnya
fungsiberbagaiorgantubuhsehinggaseringkali
berbagaimasalahkesehatanterjadipadasatu
individuusialanjut.

Telahdiketahuibahwapenyakitdankesehatan
padausialanjuttidaklahsamadenganpenyakit
dankesehatanpadagolonganpopulasiusia
lainnya,yaitudalamhal:(i)penyakitpadausia
lanjutcenderungbersifatmultipel,merupakan
gabunganantarapenurunanfisiologik/alamiah
danberbagaiprosespatologik/penyakit;(ii)
penyakitbiasanyaberjalankronis,menimbulkan

Geriatrik kedokteran

kecacatandansecaralambatlaunakan
menyebabkankematian;(iii)usialanjutjuga
sangatrentanterhadapberbagaipenyakitakut,
sertadiperberatdengankondisidayatahanyang
menurun;(iv)kesehatanusialanjutjugasangat
dipengaruhiolehfaktorpsikis,sosialdan
ekonomi,dan(v)padausialanjutseringkali
didapatpenyakitiatrogenik(akibatbanyakobat
obatanyangdikonsumsi).

188
Universa Medicina

Geriatri(darikataGeros=tua,iatrea=merumat)
atauilmukesehatanusialanjutadalahbagian
ilmupenyakitdalamyangmempelajariaspek
aspekpencegahan,peningkatan,pengobatan,
pemulihansertaaspekpsikologisdansosialdari
penyakitpenyakitpadausialanjut.Istilahgeriatri
pertamakalidipakaiolehIgnatzNascherpada
tahun1909.(3)Ilmuinibarudikatakan
berkembangdengannyatatahun1935diInggris
olehseorangdokterwanitaMarjorieWarren(4)di
WestMiddlesexHospital,yangdianggapperintis
ilmugeriatri.DiIndonesia,ilmuini
dikembangkanolehBoedhiDarmojodi
Semarangsejaktahun1968.

Prosesmenuadanimplikasiklinis

MenurutAlexComfort(1940)(5)dasardariproses
menuaadalahkegagalanfungsihomeostatik
penyesuaiandiriterhadapfaktorintrinsikdan
ekstrinsik.Menuaadalahprosesyangmengubah
seorangdewasasehatmenjadiseorangyang
rapuhdenganberkurangnyasebagianbesar
cadangansistemfisiologisdanmeningkatnya
kerentananterhadapberbagaipenyakitseiring
denganbertambahnyausia.Terjadiberbagai
perubahanfisiologisyangtidakhanya
berpengaruhterhadappenampilanfisik,namun
jugaterhadapfungsidantanggapanpada
kehidupanseharihari.Namunharusdicermati,
bahwasetiapindividumengalamiperubahan
perubahantersebutsecaraberbeda.Pada
beberapaindividu,lajupenurunannyamungkin
cepatdandramatis,sementarapadaindividu

lainnya,perubahannyakurangbermakna.Proses
menuabukanlahsesuatuyangterjadihanyapada
orangberusialanjut,melainkansuatuproses
normalyangberlangsungsejakmaturitasdan
berakhirdengankematian.Namundemikian,efek
penuaantersebutumumnyamenjadilebihterlihat
setelahusia40tahun.Prosesmenuaseyogianya
dianggapsebagaisuatuprosesnormaldantidak
selalumenyebabkangangguanfungsiorganatau
penyakit.Berbagaifaktorsepertifaktorgenetik,
gayahidup,danlingkungan,mungkinlebihbesar
mengakibatkangangguanfungsidaripada
penambahanusiaitusendiri.Disisilain,
hubunganantarausiadanpenyakitamaterat.
Lajukematianuntukbanyakpenyakitmeningkat
seiringdenganmenuanyaseseorang,terutama
disebabkanolehmenurunnyakemampuanorang
usialanjutberesponterhadapstres,baikstres
fisikmaupunstrespsikologik.Secaraumum
dapatdikatakanterdapatkecenderungan
menurunnyakapasitasfungsionalbaikpada
tingkatselularmaupunpadatingkatorgansejalan
denganprosesmenua.Akibatpenurunan
kapasitasfungsionaltersebut,orangberusialanjut
umumnyatidakberesponsecaraefektifterhadap
berbagairangsangan,internalataueksternal,
sepertiyangdapatdilakukanolehorangyang
lebihmuda.Menurunnyakapasitasuntuk
beresponsterhadaplingkunganinternalyang
berubahcenderungmembuatorangusialanjut
sulituntukmemeliharakestabilanstatusfisikdan
kimiawidalamtubuh,ataumemelihara
homeostasistubuh.Gangguanterhadap
homeostasistersebutdapatmemudahkan
terjadinyadisfungsiberbagaisistemorgandan
turunnyatoleransiterhadapobatobatan.

Perubahanakibatprosesmenua

Semakinbertambahusiaseseorangsemakin
banyakterjadiperubahanpadaberbagaisistem
dalamtubuh.Perubahanyangterjadicenderung
mengarahpadapenurunan

Oktober-Desember 2006, Vol.25 No.4

berbagaifungsitersebut.Padasistemsarafpusat
terjadipenguranganmassaotak,alirandarah
otak,densitaskoneksidendritik,reseptor
glukokortikoidhipokampal,danterganggunya
autoregulasiperfusi.Timbulproliferasiastrosit
danberubahnyaneurotransmiter,termasuk
dopamindanserotonin.Terjadipeningkatan
aktivitasmonoaminoksidasedanmelambatnya
prosessentraldanwaktureaksi.

Padafungsikognitifterjadipenurunan
kemampuanmeningkatkanfungsiintelektual;
berkurangnyaefisiensitransmisisarafdiotak
yangmenyebabkanprosesinformasimelambat
danbanyakinformasihilangselamatransmisi;
berkurangnyakemampuanmengakumulasi
informasibarudanmengambilinformasidari
memori.Kemampuanmengingatkejadianmasa
lalulebihbaikdibandingkankemampuan
mengingatkejadianyangbarusajaterjadi.Pada
fungsipenglihatanterjadigangguanadaptasi
gelap;pengeruhanpadalensa;ketidakmampuan
untukfokuspadabendabendajarakdekat
(presbiopia);berkurangnyasensitivitasterhadap
kontrasdanlakrimasi.Hilangnyanada
berfrekuensitinggisecarabilateraltimbulpada
funsgsipendengaran.Disampingitupadausia
lanjutterjadikesulitanuntukmembedakan
sumberbunyidanterganggunyakemampuan
membedakantargetdarinoise.Padasistem
kardiovaskuler,pengisianventrikelkiridansel
pacujantung(pacemaker)dinodusSA
berkurang;terjadihipertrofiatriumkiri;kontraksi
danrelaksasiventrikelkiribertambahlama;
responsinotropik,kronotropik,terhadapstimulasi
betaadrenergikberkurang;menurunnyacurah
jantungmaksimal;peningkatanatrialnatriuretic
peptide(ANP)serumdanresistensivaskular
perifer.(6,7)Padafungsiparuparuterjadi

penurunanforcedexpirationvolume1second
(FEVI)danforcedvolumecapacity(FVC);

berkurangnyaefektivitasbatukdanfungsisilia
danmeningkatnyavolumeresidual.Adanya

189
Pranarka

ventilationperfusionmismatchingyang
menyebabkanPaO2menurunseiring
bertambahnyausia:100(0,32xumur).

Padafungsigastrointestinalterjadipenururan
ukurandanalirandarahkehati,terganggunya
bersihan(clearance)obatolehhatisehingga
membutuhkanmetabolismefaseIyanglebih
ekstensif.Terganggunyaresponsterhadapcedera
padamukosalambung,berkurangnyamassa
pankreasdancadanganenzimatik,berkurangnya
kontraksikolonyangefektifdanabsorpsi
kalsium.(8)Menurunnyabersihankreatinin
(creatininclearance)danlajufiltrasiglomerulus
(GFR)10ml/dekadeterjadidengansemakin
bertambahnyausiaseseorang.(8)Penurunanmassa
ginjalsebanyak25%,terutamadarikorteks
denganpeningkatanrelatifperfusinefron
jukstamedular.Aksentuasipelepasananti
diuretichormone(ADH)sebagairespons
terhadapdehidrasiberkurangdanmeningkatnya
ketergantunganprostaglandinginjaluntuk
mempertahankanperfusi.Padasalurankemihdan
kelamintimbulperpanjanganwakturefrakter
untukereksipadapria,berkurangnyaintensitas
orgasmepadapriamaupunwanita,berkurangnya
sekresiprostatdiurindanpengosongankandung
kemihyangtidaksempurnasertapeningkatan
volumeresidualurin.Toleransiglukosa
terganggu(guladarahpuasameningkat1
mg/dl/dekade;guladarahpostprandialmeningkat
10mg/dl/dekade).Insulinserummeningkat,
HbA1Cmeningkat,IGF1berkurang.Penurunan
yangbermaknapadadehidroepiandrosteron

(DHEA),hormonT3,testosteronbebasmaupun
yangbioavailable,danproduksivitaminDoleh
kulitsertapeningkatanhormonparatiroid(PTH).
Ovarianfailuredisertaimenurunnyahormon
ovarium.

Padasistemsarafperiferlanjutusiamengalami
hilangnyaneuronmotorspinal,berkurangnya
sensasigetar,terutamadikaki,berkurangnya
sensitivitastermal(hangat

Geriatrik kedokteran

dingin),berkurangnyaamplitudoaksipotensial
yangtermielinasidanmeningkatnya
heterogenitasselaputaksonmyelin.Massaotot
berkurangsecarabermakna(sarkopenia)karena
berkurangnyaseratotot.(9)

Efekpenuaanpalingkecilpadaototdiafragma;
berkurangnyasintesisrantaiberatmiosin,
inervasi,meningkatnyajumlahmiofibrilperunit
ototdanberkurangnyalajubasalmetabolik
(berkurang4%/dekadesetelahusia50).Pada
sistemimunterjadipenurunanimunitasyang
dimediasisel,rendahnyaproduksiantibodi,
meningkatnyaautoantibodi,berkurangnya
hipersensitivitastipelambat,berkurangnya
produksiselBolehsumsumtulang;dan
meningkatnyaIL6dalamsirkulasi.

Konsepmenuasehat

Konsepmenuasehatpadahakikatnyasesuai
dengansloganTahunUsiaLanjutWHOtahun
1982adalah:Donotputyearsintolife,butlife
intoyears,yangberartiusiapanjangtidaklah
adaartinyabilatidakbergunadanbahagiaserta
mandirisejauhmungkin,denganmempunyai
kualitashidupyangbaik.Longlifewithout
continoususefulness,productivityandgood
qualityoflifeisnotablessing.(10)

Tujuanhidupmanusiaadalahmenjadituatetap
sehat(healthyageing).Healthyagingartinya

190

menjadituadalamkeadaansehat.Healthyageing
akandipengaruhiolehbeberapafaktor:i)
endogenicageing,yaituyangdimulaidengan
cellularaging,lewattissuedananatomical
ageingkearahprosesmenuanyaorgantubuh,
prosesinisepertijarumjamyangterusberputar;
ii)exogenicfactor,yangdapatdibagidalam
sebablingkungan(environment)dimana
seseoranghidupdanfaktorsosiobudayayang
palingtepatdisebutgayahidup(lifestyle).Faktor
exogenicageingini,sekaranglebihdikenal
dengansebutanfaktorrisiko.BoedhiDarmojo(11)
menggambarkandalambentukdibawahini
(Gambar1).

Universa Medicina

Oktober-Desember 2006, Vol.25 No.4

Gambar1.Faktorfaktoryangberpengaruhterhadaphealthyaging(11)
Selanjutnyamenuasehat(healthyageing)harus
diikutidenganmenuaaktif(activeageing).
Menuaaktifadalahsuatuprosesyang
mengoptimalkankesempatanuntuksehat,

partisipatifdankesejahteraandalamtujuan
meningkatkankualitashidupsaatseseorang
menua.Menuaaktifiniterjadibaikpada

individumaupunsekelompokorang.Kataaktif
menunjukkanperansertaberkelanjutandalam
bidangsosial,ekonomi,kultural,spiritualdan
pemerintahan.Sedangkankatasehat,merujukke
masalahkesehatanfisik,mentaldansosialseperti
tercantumdidefinisiWHOtentangartisehat.

Gambar2.Thedeterminantsofactiveageing(10)

191
Pranarka
Geriatrik kedokteran

Sebenarnyamenuasehat,adadalamkonsep
menuaaktif.Menjagakelangsunganotonomidan
kemandiriansaatseseorangmenjadituaadalah
tujuanutamasetiaporang.Istilahmenuaaktif
(activeageing)diambildariWHOtahun1990,
yanglebihrincidarimenuasehat,untuk
mengenalifaktorfaktoryangdapat
mempengaruhibagaimanaprosespenuaan
seseorangatausebuahpopulasi.

Beberapacontohdarifaktorfaktoryang
mempengaruhiprosesmenuasehatdanaktif
disajikanpadaGambar2.(10)
Faktorpelayanankesehatandansosial

Prevalensiyangmasihtinggidariinfeksi/
penyakitmenular

Kebalikannyamungkincukupmampu/kaya
sehinggamengundangrisikoobesitas,dan
penyakitpenyakitlainakibatgayahidup

yangkurangbaik.

Masalahmasalahlainmenyangkutpendidikan
seseorang,kepribadianyangsehatdanberbahagia
sertalingkunganyangramah,mempunyai
dampakyangbesaruntukmenjadituasehatdan
aktif.MenurutWHO(10):biarpungenmungkin
berperanuntukterjadinyapenyakit,tetapiuntuk
sebagianbesarpenyakit,faktorexternaldan
lingkunganmempunyaiperanyanglebihbesar
dibandinggenetikdaninternal.Sehinggadapat
ditarikkesimpulanbahwatujuanmencapaiproses
menuasehatdanaktifiniadalahjugaupaya
pencegahanuntukpenyakit

Masalahmalnutrisi

Makinbanyakpenyakitpenyakitpenyakitkronikdegeneratifyangbiasanya
kurangFaktorekonomik
degeneratif

Menurunnyapendapatan

Fasilitaspelayanankesehatanyangmasih

Mungkintidakmemilikiasuransiataupensiun

dideritapopulasilanjutusia.

BoedhiDarmojo(13)menunjukkanlebihjelas
hubunganfaktorfaktorrisikodanpenyakit
penyakitdegeneratifinidalambentukgambaran
labalabasepertidibawahini(Gambar3).

Gambar3.Spidermodel:therelationshipbetweenriskfactorsanddegenerativediseases(13)

192

Universa Medicina

Oktober-Desember 2006, Vol.25 No.4

PELAYANANKESEHATANPADA
LANJUTUSIA;MENGAPAHARUS
DIKHUSUSKAN?

Mengingatsifatpenyakitdanperubahanfungsi
organkarenaprosesmenuapadausialanjutyang
sangatkhusustersebut,makadalamilmugeriatri
terdapatbeberapatatacarayangmerupakan
keharusanuntukdilakukanagarupayakesehatan
bagiusialanjuttersebutdapatdilaksanakan
secaraoptimal.Tatacaratersebutadalahyang
disebutsebagaiasesmengeriatriyangbekerja
secaratim.

Asesmengeriatriadalahsuatuprosesdiagnostik
multidisiplin(banyakdisiplinilmukesehatan)
yangbiasanyadilaksanakansecarainterdisipliner
(dengansatutujuan)olehseorangdokter/geriatris
danatausuatutiminterdisiplingeriatrikuntuk
menentukanmasalahdankapabilitasmedis,
psikososialdanfungsionalgunamerencanakan
terapimenyeluruhsertapemantauankesehatan
yangberkesinambunganbagiseorangpenderita
usialanjut.

Prinsippelayanankesehatanusialanjutyang
menyeluruhyangdiinginkanuntukdilaksanakan
diIndonesiadapatdibagiatas3bentuk,yaitu:

Pelayanankesehatanusialanjutberbasisrumah
sakit(hospitalbasedgeriatricservices),karena
padadasarnyaRSmerupakanpusat/tempat
rujukandaripelayanankesehatandasarusia
lanjut.Olehkarenanyapelayanandirumahsakit
iniseyogyanyamenyelenggarakan/menyediakan

semuajenisupayapelayanankesehatan,mulai
daripromotif,preventif,kuratifdanrehabilitatif,
dengansaranadansumberdayamanusiayang
lengkap.Tentusajatergantungdarikelasrumah
sakit,berbagaipelayanantersebutbisa
dilaksanakantergantungdarikemampuanserta
danayangtersedia.

Pelayanankesehatanusialanjutolehmasyarakat
berbasisrumahsakit(hospitalbasedcommunity
geriatricservices),dimanapusatpusat
pelayanankesehatanusialanjutdiRSbertindak
sebagaikonsultanterhadappelayananusialanjut
dimasyarakat,dandenganpenuhtanggungjawab
mengikutikeadaanusialanjutyangsebelumnya
dirawatataumendapatpelayanandiRStersebut.
Termasukdalamupayakesehatanusialanjutini
adalahpelayanandiluarrumahsakit,berupa
pembinaanolehinstitusiyanglebihtinggi
terhadapinstitusiyanglebihrendahdiwilayah
kerjanyadalamkegiatanrujukantimbalbalik.

Pelayanankesehatanusialanjutberbasis
masyarakat(communitybasedgeriatricservices),
yaitupelayanandarimasyarakatuntuk
masyarakat,sehinggamasyarakatsendiri
diikutsertakandalampelayanankesehatanusia
lanjut,tentusajasetelah

diberitambahanpengetahuansecukupnya.Ketiga
sistempelayanankesehatanusialanjuttersebut
diatasharuslahberkesinambungansertasaling
mendukung,sehinggapadaakhirnyasetiaporang
usialanjutdapatmemperolehpelayanansesuai
denganjenis

danderajatpenyakityangdideritanya.

JENISJENISPELAYANANGERIATRI

PoliklinikGeriatri

193

Tempatpelayananinimemberikanjasa
mengadakanpemeriksaanmenyeluruh,tindakan
pengobatansederhanadankonsultasibagi
penderitarawatjalan,baikdimasyarakat,
puskesmas,maupunantarpoliklinik.Tenaga
minimalyangdibutuhkanadalahdokterumum
ataudokterahlipenyakitdalamyangtelah
mendapatkursusgeriatri,atauseorangdokter
spesialisgeriatri/geriatris,seorangperawat,dan
seorangpetugassosialmedik.

Pranarka Geriatrik kedokteran

KonsultasiGeriatri
BangsalGeriatriAkut

Dibangsalinipadadasarnyahanyadirawat
pasienusialanjutyangmempunyaipenyakitakut
atausemiakut.Terhadappenderitainidilakukan
asesmen,tindakanpengobatandanrehabilitasi
secepatmungkinsetelahkeadaannya
memungkinkan.

BangsalGeriatriKronis

Bangsalinidiperlukanuntukmerawatpasien
usialanjutdenganpenyakitkronisyang
memerlukanrawatinapdalamjangkawaktu
lama,dankarenanyamemerlukanbiayayang
tinggi.Mengingatturnoverratenyayangsangat
rendah,keberadaanbangsalinidisuatuRS
PemerintahdiIndonesia,sementarainibisa
digantikanolehbangsalpenyakitdalam,
sedangkandiRSSwastakeberadaanyamasih
dimungkinkan.

KlinikAsuhanSiang

Ditempatinidapatdilaksanakansemuatindakan
sepertiyangdilakukandibangsalakut,akan
tetapipasientidakharusrawatinapdan
pelayananhanyadilakukanpadajamkerjasaja.
Jasayangdapatdiberikanmeliputipemeriksaan
menyeluruh,tindakanpengobatan,rehabilitasi
danrekreasi.Olehkarenanyatenagayang
dibutuhkanselaindoktergeriatrisjugamacam
macamtenagarehabilitasimedikditambahahli
gizidansebagainya.

Pasienyangdirawatolehbagianlaindapat
dikonsultasikanketimgeriatriuntuk
mendapatkanpemeriksaanmenyeluruh,berbagai
tindakanlain,ataubahkandipindahkanke
bangsallanjutusia.

Penitipan

Oranglanjutusiayangrelatifsehat,tidakada
eksaserbasiakutdaripenyakityangmungkin
diderita,dapatdititipkanselamamaksimaldua

minggudiInstalasiGeriatriyanglengkap,
misalnyadiPaviliunLanjutUsiaBoedhi
DarmojoRS.Dr.KariadiSemarang.Tujuan
pelayananiniantaralainmemberiistirahatpada
keluargayangmerawatagarsegarkembali.

PerawatanTerminal

Pelayanankesehatansejakduludiarahkanuntuk
menyembuhkanpenyakitdanmencegah
kematian,tetapiadakalanyadokterdihadapkan
padakeadaanmenjelangajalyangtidakdapat
dielakan.Hospicecare(asuhansakit)merupakan
salahsatubentuklayanangeriatridenganciri
ciri:(i)harapanhiduppenderitadiperkirakan
kurangdarienambulan;(ii)pendekatanpaliatif,
denganpenekananpadapengelolaannyeridan
gejala;(iii)koordinasiolehtiminterdisiplin,

terdiriatastenagamedik,rohaniwan,keluarga
danrelawan/pekerjasosial.Asuhansakitini
dapatdilakukandirumahsakit,ataudirumah
penderita.

Pendidikan&Riset

Halinimerupakanbagianimplisitdarisuatu
pemberianpelayanangeriatri,antaralain
dilaksanakanuntukpendidikantenagamedis,
paramedis,terapisrehabilitasi,danmahasiswa
dariberbagaibidangkeilmuansertariset,yang
padagilirannyadiperlukanuntukmeningkatkan
pelayanansertapengembanganilmugeriatri.

194

RehabilitasiMedik

Penyakitpadausialanjutselalumempunyai
kecenderunganuntukterjadinyakecacatan,
sehinggaolehWHOselaludiharapkan
penegakandiagnosispasienusialanjutdalam
aspekgangguanorgan(disease),penyakit
(impairment),keterbatasan(disability)yang
diakibatkandankecacatan(handicap).Oleh
karenanyarehabilitasimedikselalumerupakan
aspekyangharusterdapatdalampelayanan
kesehatanusialanjut.Rehabilitasidilaksanakan
sesegeramungkinsejakpasienmasuksampai

Universa Medicina

Oktober-Desember 2006, Vol.25 No.4

pulang,sesuaikebutuhannya.Bilalatihanlatihan
yangdiberikanberjangkalama,sebaiknya
dilakukandiinstalasirehabilitasimedik.

memberikanobatuntuksetiappenyakit.Jumlah
obatobatyangbanyakinidapatmenimbulkan
masalahbaruantaralainkarenaefeksampingdan
interaksiobat.Walaupuntidakmudahmengelola
penderitalanjutusiadenganmultipatologi,
beberapapedomandapatdipakaisebagai
pegangan,antaralain:Langkahlangkahuntuk
menghindaripolifarmasi(14,15)

PantiRawatWredha

PantiRawatWredhaataunursinghomebukan
suatukeharusanuntukdiadakanpadasuatuRS.
Bagianinimerupakanbentukperalihanantara
pelayananRSdanpelayanandirumah/dipanti
wredha,dimanapasiensudahtidakbanyak
memerlukantindakanRS(asesmendankuratif)
akantetapimasihmempunyaimasalahkesehatan
kronisyangmemerlukanperawatan(care),
sehinggatidakdimungkinkanuntukdirawatdi
rumahataudipantiwredhabiasa.Keberadaannya
disuatuRSbesarmemberikannilaitambahuntuk
kepentinganpendidikandanriset,danwalaupun
tidaksempurnadapatuntukmenggantikan
bangsalkronis.

catatsemuaobatyangdipakai,untukreviewdan
monitoring

kenalinamagenerikdangolonganobat

kenaliindikasiklinikuntuksetiapobat

ketahuiprofilefeksampingsetiapobat

kenalifaktorrisikosesuatuefekyangtakterduga

hentikanpemberianobattanpamanfaat
penyembuhan
KAPITASELEKTABEBERAPA
PERSOALANKHUSUSDIBIDANG
GERIATRI

hentikanpemberianobattanpaindikasiklinik

Polifarmasi

gantilahdenganobatyanglebihaman

Penderitausialanjutumumnyamengalami
beberapapenyakitsecarabersamaan,danada
kemungkinandokter(beberapadokter)berusaha

janganmenanganiefektakterdugasuatuobat
denganobatlagi

gunakanobattunggalbilacarapemberiannya
tidaksering

Obatobatherbalyangbanyakberedardi

masyarakatdandikonsumsijugaolehgolongan
lanjutusiatidakbolehdianggapsepenuhnya
aman.Fitofarmakadenganmenggunakanobat
obatinidapatmenyebabkanefeksampingdan
interaksiobatyangberatsamadenganobatobat
sintetik.

Nutrisipadalanjutusia

Oranglanjutusiadapatmempunyairisiko
malnutrisikarenaterjadipenurunanasupan
makananakibatperubahanfungsisalurancerna,

195

metabolismeyangtidakefektif,defekutilisasi
nutriendankegagalanorgan.Keadaantersebut
diperberatdengankoinsidensidaripenyakitakut
ataukronik,trauma,keadaanhiperkatabolik,dan
terapiobatyangdapatmempengaruhistatus
nutrisi.KrisPranarkaetal(16)padapenelitian
terhadap104penderitayangdirawatdiInstalasi
GeriatriselamaperiodeJuli2004sampaidengan
Juni2005,mendapatkanhubunganyang
bermaknaantarastatusgizisaatpenderitamasuk
rumahsakitdimanadidapatkanlebihdari50%
penderitamengalamiundernutrisi,denganlama
perawatan,angkamortalitasdanperubahanAKS
saatkeluardarirumahsakit.

Demensia

Demensiaadalahgangguanfungsiintelektualdan
memorididapat,yangdisebabkanolehpenyakit
otak,dantidakdisertaidengan

Pranarka Geriatrik kedokteran

gangguantingkatkesadaran.Demensiamerujuk
sindromaklinisyangmempunyaibermacam
penyebab.Penderitadengandemensiaharus
mempunyaigangguanmemoriselain
kemampuanmentallainsepertiberpikirabstrak,
penilaian,kepribadian,bahasa,praksisdan
visuospasial.

Defisityangterjadiharuscukupberatsehingga
mempengaruhiaktifitaskerjadansosialsecara
bermakna.Jenisterbanyakdaridemensiaadalah
penyakitAlzheimer.IkaSdanKrisPranarkaet
al(15)diklinikmemoriInstalasiGeriatriRS.Dr.
Kariadimencobamengembangkantesmini
mentalstateexaminationuntukmendeteksidini
adanyagangguanpadafungsikognitif.Dari55
penderitayangberhasildiperiksaantaratahun
20042005,denganrerataumur69,5tahun
didapatkan32%menderitagangguanfungsi
kognitifringansampaiberat.

Gangguankeseimbangandanjatuh

Gangguankeseimbangandikaitkandenganrisiko
terjadinyaperistiwajatuhyangakanberdampak
masalahpsikososialantaralain:

(i)rasakurangpercayadiri;(ii)rasatakut;cemas
dandepresi;dan(iii)ketergantunganbahkan
terisolasidarimasyarakatsekitar.

Dampakpsikososialiniseringkurang
diperhatikanolehparadokter,yanglebihterpusat
perhatiannyapadamasalahmasalahfisik.Orang

lanjutusiayangpernahmengalamigangguan
keseimbangandankemudianjatuh,dapat
demikiantakutuntukjatuhlagi.Jatuhadalah
salahsatuperistiwayangseringdialamioleh
seoranglanjutusia.Jatuhdikaitkandengan
peningkatanmorbiditasdanmortalitasserta
penurunanfungsidankemandirian.Jatuh
biasanyaterjadiakibatrangkaianbeberapafaktor
risiko,yangsebagianbesardapatdikoreksi.
Seringoranglanjutusiatidakmenyadariatau
mengenalifaktorrisikoini,dantidakmelaporkan
padadoktersehinggaupaya

pencegahanjatuhdiabaikan,danfaktorfaktor
risikoinibarumenjadikenyataansetelahterjadi
peristiwajatuh.MenurutGuidelineForThe
PreventionofFallsinOlderPerson,(17)dari
seluruhpopulasilanjutusia65tahunyang
tampaksehatdimasyarakatsekitar3540%
mengalamijatuhsetiaptahun.Terutamabila
terjadiakibatakibatjatuhyangmenyebabkan
harusdirawatdanadakecacatan.Terjadiisolasi
sosialatauketergantungansehinggakesehatan
dankemandirianmenjaditerganggu.Penurunan
aktifitasfisikmenyebabkankemundurandan
kelemahanotototot,sendimenjadilebihsulit
digerakkan,dankewaspadaanterhadap
lingkunganjugaberkurang.Semuainiakan
memperburukdisfungsisosial.Gangguan
keseimbanganyangdapatmembawaakibatjatuh,
sangatmahalnilainyapadalanjutusiabaikdari
segiketergantungandangangguanfungsifisik
maupunbiaya.

KESIMPULAN

Akibatdarikemajuandibidangkesehatan,
terjadipeningkatandaripopulasilanjutusia.
Tetapikalaulanjutusiainiberkaitandengan
kerapuhandankecacatan,makabebanpada
saranadanpelayanankesehatanjugabertambah
berat.Suatupelayanangeriatriyangrapidan
terorganisasisangatberperandalampengelolaan
darikonsekuensidemografikini.Kebanyakan
oranglanjutusiadiatas60tahunmasihhidup
cukupmandiridimasyarakat.Adalahtugas

196

utamadaripelayanangeriatriuntuk
mempertahankankemandirianini,sehingga
dapatmenuasehat.KonsepsehatmenurutWHO
meliputifisik,mentaldansosial.Dengan
demikianmenuasehatdapatdiharapkanjuga
akanberlanjutdenganmenuaaktifsecarasosial,
spiritualdankulturalbahkanekonomidan
pemerintahanuntukmenujupadamenua
(dengan)sukses.

Universa Medicina

Oktober-Desember 2006, Vol.25 No.4

DaftarPustaka

TaliaferroPM,PriceCA.Agingincreasesriskfor
medicationproblems.SeniorSeries2001;127:13.

SamsonMM,MeeuwsenIBA,CroweA,Dessens

UnitedNationsPopulationDivision.Worldpopulation
prospects:2002revision.NewYork:UnitedNation;
2003.

BadanPusatStatistik.ProyeksipendudukIndonesia
20002025.Jakarta:BadanPerencanaanPembangunan
Nasional,BadanPusatStatistik,UnitedNations
PopulationFunds;2005.

NascherIL.Whatisgeriatric?Citedby:GrayL.
Addressingtheneedofgeriatriceducation.Elderly
1997;7:14.

JAG,DuursmaSA,VerhaarHJJ.Relatonshipbetween
physicalperformancemeasures,age,heightandbody
weightinhealthyadults.AgeAging2000;29:23542.

WorldHealthOrganization.Activeageing,apolicy
framework.Geneva:WorldHealthOrganization;
2002.

DarmojoRB,MartonoHH.BukuAjarGeriatri.
Jakarta:BalaiPenerbitFakultasKedokteran
UniversitasIndonesia;1999.

WarrenM.Careofthechronicagedsick.Lancet
1946;i:841843.CitedbyYoungJ,RobinsonJ,
DickinsonE.Rehabilitationforolderpeople.BMJ
1998;316:11089.

KalacheAA.Activeageinginthe21stcentury.
Brazilia:WorldHealthOrganization;2005.

5.ComfortA.Theprocessofageing.NewYork:
Signet;1964.Citedby:JesteDV.Psychiatryofold
ageiscomingofage.AmJPsychiatry1997;

DarmojoRB.Determinantsofactivevitalageingand
preventionofdiseaseintheelderly,KongresNasional
Gerontologi,Jakarta,Oktober,2003.

154:13568.

CarlsonJE.Perilsofpolypharmacy:10stepsto
prudentprescribing.Geriatrics1996;51:2630.

SussmanMA,AnversaP.Myocardialagingand
senescence.AnnRevPhysiol2004;66:2948.

EdelbergJM,ReedMJ.Agingandangiogenesis.
FrontiersBioscience2003;8:1199209.

Supartondo,RoosheroeAG.Pedomanmemberiobat
padapasiengeriatricsertamengatasimasalah
polifarmasi.Dalam:Bukuajargeriatricilmupenyakit
dalam.JilidIII.Jakarta:Geriatri;2006.hal.14378.

IkaSH,PranarkaK,JoniB,AndayaniR,MartonoH.
DeteksidinigangguanfungsikognitifdenganMMSE.
TemuIlmiahGeriatri,Jakarta,2005.

TheDepartmentofHealth,USA:Guidelineforthe
promotionofactiveageinginolderadults.Formeset
CapePrinters,June2000.

197