Anda di halaman 1dari 7

Penyebab, gejala klinis dan pengobatan gondongan atau parotitis

PAROTITISEPIDEMIKA
(Gondong,Mumps)

Parotitisepidemikaadalahpenyakitvirusmenyeluruh,akut,yangkelenjarludahnya
membesarnyeri,terutamakelenjarparotisyangterletakdiantaratelingadanrahangsehingga
menyebabkanpembengkakanpadaleherbagianatasataupipibagianbawah.

ETIOLOGIATAUPENYEBAB
Virus ini adalah anggota kelompok paramiksovirus, yang juga mencakup
parainfluenza, campak dan virus penyakit Newcastle. Hanya diketahui ada satu serotipe.
Biakan manusia atau sel ginjal kera terutama digunakan untuk isolasi virus.penyakit ini
ditularkan melalui kontak dengan sekret pernapasan, seperti air liur dari orang yang
terinfeksi.Saatpenderitanyabatukataubersin,makadapatmenularkankeoranglain.Mumps
atau gondongini juga dapat menyebar dengan berbagi makanan dan minuman.Pengaruh
sitopatikkadangkadangditemukan,tetapihemadsorpsimerupakanindikatorinfeksiyang
palingsensitif.Virustelahdiisolasidariludah,cairanserebrospinal,darah,urin,otakdan
jaringanterinfeksilain.

EPIDEMIOLOGIATAUPENYEBARANPENYAKIT
Parotitisadalahendemikpadakebanyakanpopulasiperkotaan(urban);virustersebar
darireservoirmanusiadengankontaklangsung,tetestetesyangdibawaudara,bendabenda
yang terkontaminasi dengan ludah dan kemungkinan dengan urin. Virus ini tersebar di
seluruhduniadanmengenaikeduajeniskelaminsecarasama;85%infeksiterjadipadaanak
yang lebih muda dari umur 15 tahun sebelum penyebaran imunisasi. Sekarang penyakit
seringterjadipadaorangdewasamuda,menimbulkanepidemidiperguruantinggiataudi
tempat bekerja. Epidemi tampaknya terutama terkait dengan tidak adanya imunisasi
bukannyapadamenyusutnyaimunitas.Epidemiterjadipadasemuamusimtetapisedikitlebih

seringpadamusimdinginakhirdanmusimsemi.Sumberinfeksimungkinsukardilacak
karena3040%infeksiadalahsubklinis.Adapenurunaninsidenssejakpengenalanvaksin
parotitisepidemikapadatahun1968.
Virustelahdiisolasidariludahselama6harisebelumdansampai9harisesudah
munculnya pembengkakan kelenjar ludah. Penularan agaknya tidak terjadi lebih lama
daripada24jamsebelummunculnyapembengkakanataulebihlambatdari3harisesudah
menyembuh.Virustelahdiisolasidariurindariharipertamasampaike14sesudahmulainya
pembengkakankelenjarludah.
Imunitasseumurhidupbiasanyamenyertaiinfeksiklinisatausubklinis,walaupun
infeksi kedua telah terdokumentasi. Antibodi transplasenta agaknya efektif dalam
memproteksibayiselama68bulanpertama.Bayiyangdilahirkandariibuyangmenderita
parotitisdalamminggusebelumpersalinanmungkinmenderitaparotitisyangtampaksecara
klinis pada saat lahir atau mengalami sakit pada masa neonatus. Kisaran keparahan dari
parotitisringansampaipankreatitisberat.Ujineutralisasiserumadalahmetodeyangpaling
dapat dipercaya untuk penentuan imunitas tetapi tidak praktis dan mahal. Uji antibodi
pemfiksasikomplemen tersedia (lihat diagnosis). Adanya antibodi V saja memberi kesan
infeksiparotitissebelumnya.
PATOGENESIS
Sesudahmasukdanmulaipembelahandalamselsaluranpernafasan,virusdibawa
darahkebanyakjaringandiantaranyakekelenjarludahdankelenjarlainyangpalingrentan.
MANIFESTASIKLINIS
Masainkubasiberkisardari1424hari,denganpuncakpada1718hari.Padaanak,
manifestasiprodromaljarangtetapimungkinnampakbersamadengandemam,nyeriotot
(terutama leher), nyeri kepala dan malaise. Mulainya biasa ditandai dengan nyeri dan
pembengkakanpadasatuataukeduakelenjarparotis.Pembengkakanparotiskhas;mulamula
mengisironggaantaratepiposteriormandibuladanmastoiddankemudianmeluasdalam
deretanyangmelengkungkebawahdankedepan,diatasdibatasiolezigoma.Edemakulit
dan jaringan lunak biasanya meluas lebih lanjut dan mengaburkan batas pembengkakan
kelenjar,sehinggapembengkakanlebihmudahdisadaridenganpandangandaripadadengan
palpasi. Pembengkakan dapat maju dengan sangat cepatnya, mencapai maksimum dalam
beberapa jam, walaupun biasanya berpuncak pada 13 hari. Pembengkakan jaringan

mendoronglobustelingakeatasdankeluar,dansudutmandibulatidaklagidapatdilihat.
Pembengkakan perlahanlahan menghilang dalam 37 hari tetapi kadangkadang berakhir
lebihlama.Satukelenjarparotisbiasanyamembengkaksehariatauduaharisebelumyang
lain,tetapilazimpembengkakanterbataspadasatukelenjar.Daerahpembengkakanlunak
dan nyeri, nyeri diperoleh terutama oleh cairan rasa asam seperti jus lemon atau cuka.
KemerahandanpembengkakansekitarlubangsaluranStensenadalahbiasa.Edemafaring
danpalatummollehomolateralmenyertaipembengkakanparotisdanmemindahtonsilke
medial;edemaakutlaringtelahjugadiuraikan.Edemadiatasmanubriumdandindingdada
sebelah atas mungkin dapat terjadi karena penyumbatan limfatik. Pembengkakan parotis
biasanyadisertaidengandemamsedang;suhunormallazim(20%),tetapisuhu40Catau
lebihjarang.
Walaupun hanya kelenjar parotis yang terkena pada sebagian besar penderita,
pembengkakankelenjarsubmandibulaseringterjadidanbiasanyamenyertaiataudekatpasca
pembengkakan kelenjar parotis. Pada 1015% penderita hanya kelenjarkelenjar
submandibuleryangmungkinmembengkak.Sedikitnyeridisertaidenganinfeksimandibula,
tetapipembengkakanmenguranglebihlambatdaripadapembengkakanparotis.Kemerahan
dan pembengkakan pada lubang saluran Wharton sering kali menyertai pembengkakan
kelenjar.
Kelenjar sublingual paling kurang sering terinfeksi, biasanya secara bilateral;
pembengkakanjelaspadadaerahsubmentaldanpadadasarmulut.
Ruameritemamakulopapuler,palingmencolokpadabadan,terjadikurangsering;
jarangberupaurtikaria.

DIAGNOSIS
Diagnosis parotitis epidemika biasanya jelas dari gejalagejala dan pemeriksaan
fisik(khas adanya Bengkak dan nyeri tekan uni atau bilateral glandula parotis). Bila
manifestasiklinisterbataspadamanifestasidarisalahsatulesiyangkurangbiasa,diagnosis
tidak begitu jelas, tetapi dapat dicurigai, terutama selama epidemi.

Ujilaboratoriumrutintidakspesifik,biasanyaleukopeniadenganlimfositosisrelatif,namun
komplikasi sering menimbulkan leukositosis polimorfonuklear tingkat sedang. Lazim ada
kenaikan amilase serum; kenaikan cenderung paralel dengan pembengkakan parotis dan

kemudian kembali ke normal dalam kurang lebih 2 minggu.

Diagnosisetiologitergantungpadaisolasivirusdariludah,urin,cairanspinalataudarahatau
peragaan kenaikan bermakna antibodi fiksasi komplemen dalam sirkulasi selama
konvalesens. Antibodi serum terhadap antigen S mencapai puncaknya pada sekitar 75%
penderita dan dapat dideteksi pada saat gejalagejala muncul. Antibodi ini sedikit demi
sedikit menghilang dalam 612 bulan; antibodi terhadap antigen V atau virus biasanya
mencapaititerpuncakpadasekitar1bulan,tetapstabilselamasekitar6bulan,dankemudian
perlahanlahan menurun selama 2 tahun sampai kadar rendah, dan kemudian titer ini
menetap.AdanyatiterantiSyangtinggidandantiterantiVyangrendahselamastadium
akut kalau tidak didiagnosis meningoensefalitis, misalnya, sangat memberi kesan infeksi
parotitis, yang akan diperkuat jika serum konvalesen (diambil 1421 hari kemudian)
menunjukkankenaikanempatkaliantibodiantiVyangdisertaidengansedikitperubahan
padatiterantibodiantiS.
KOMPLIKASI
AkibatadanyaVirusdidalamdarah(Viremia) yangterjadipadaawalinfeksi,
makaPenyakitgondongataumumps inidapatmenyebabkankomplikasiyangmelibatkan
organorganlain.Komplikasiyangdapatterjadiyaitu:

Meningoensefalitis.

Komplikasiinimerupakankomplikasiyangseringpadamasaanak.Insidensyangsebenarnya
sukar diperkirakan karena infeksi subklinis sistem saraf sentral, seperti dibuktikan oleh
pleositosiscairanserebrospinal,telahdilaporkanlebihdari65%penderitadenganparotitis.
Manifestasiklinisterjadipadalebihdari10%penderita.Insidensmeningoensefalitisparotitis
sekitar250/100.000kasus;10%darikasusiniterjadipadapenderitayanglebihtuadari20
tahun.Angkamortalitasadalahsekitar2%.Lakilakiterkena35kalilebihseringdaripada
wanita.Parotitismerupakansalahsatudaripenyebabmeningitisaseptikyangpalingsering.
Patogenesismeningoensefalitisparotitistelahdiuraikansebagai:
1. Infeksiprimerneurondan
2. Ensefalitaspascainfeksidengandemielinasi.

Padatipepertamaparotitisseringmunculbersamaanataumenyertaiensefalitis.Pada
tipe kedua, ensefalitis menyertai parotitis pada sekitar 10 hari. Parotitis mungkin pada
beberapakasustidakada.Stenosisaqueduktusdanhidrosefalustelahdihubungkandengan
infeksiparotitis.Menginjeksikanvirusparotitiskedalamtupaipadaumurmenyusuitelah
menghasilkanlesiyangserupa.
Meningoensefalitisparotitissecaraklinistidakdapatdibedakandarimeningitissebab
lain.Adakekakuanlehersedang,tetapipemeriksaanneurologislainbiasanyanormal.Cairan
serebrospinal(CSS)biasanyaberisiselkurangdari500sel/mm 3,walaupunkadangkadang
jumlahseldapatmelebihi2.000.Selnyahampirselalulimfosit,berbedadenganmeningitis
aseptik enterovirus, dimana lekosit polimorfonuklear sering mendominasi pada awal
penyakit.Virusparotitisdapatdiisolasidaricairanserebrospinalpadaawalpenyakit.

Orkitis,Epididimitis.

Komplikasiinijarangterjadipadaanaklakilakiprapubertastetapisering(1435%)pada
remaja dan orang dewasa. Testis paling sering terinfeksi dengan atau tanpa epididimitis;
epididimitis dapat juga terjadi sendirian. Jarang ada hidrokel. Orkitis biasanya menyertai
parotitisdalam8hariatausekitarnya,orkitisdapatjugaterjaditanpabuktiadanyainfeksi
kelenjar ludah. Pada sekitar 30% penderita kedua testis terkena. Mulainya biasanya
mendadak,dengankenaikansuhu,menggigil,nyerikepala,mualdannyeriperutbawah;bila
testiskananterlibat,appendisitisdapatdikesankansebagaikemungkinandiagnosis.Testis
yangterkenamenjadinyeridanbengkakdankulityangberdekatanedemadanmerah.Rata
ratalamanyaadalah4hari.Sekitar3040%testisyangterkenaatrofi.Gangguanfertilitas
diperkirakansekitar13%,tetapiinfertilitasabsolutmungkinjarang.

Ooforitis

Nyeripelvisdankesakitanditemukanpadasekitar7%padapenderitawanitapascapubertas.
Tidakadabuktiadanyagangguanfertilitas.

Pankreatitis.

Keterlibatanberatpankreasjarang,tetapiinfeksiringanatausubklinismungkinlebihsering
daripadayangdiketahui.Pankreatitismungkintidakterkaitdenganmanifestasikelenjarludah

dandiagnosismungkindikelirukandengangastroenteritis.Nyeridansakitepigastrium,yang
manamemberikesan,dapatdisertaidengandemam,menggigil,muntahdantidakberdaya.
Kenaikannilaiamilaseserumadalahkhaspadaparotitis,denganatautanpamanifestasiklinis
pankreatitis.

Nefritis.

Viruriatelahseringdilaporkan.Padasatupenelitianorangdewasa,kelainanfungsiginjal
terjadikadangkadangpadasetiappenderita,danviruriaterdeteksipada75%.Frekuensi
keterlibatanginjalpadaanakbelumdiketahui.Nefritisyangmematikan,terjadi1014hari
sesudahparotitis,telahdilaporkan.

Tiroiditis.

Walaupuntidakbiasapadaanak,pembengkakantiroidyangnyeridandifusdapatterjadi
padasekitar1minggusesudahmulaiparotitisdenganperkembanganselanjutnyaantibodi
antitiroid.

Miokarditis.

Manifestasijantungyangserius sangatjarang,tetapiinfeksiringanmiokardiummungkin
lebihseringdaripadayangdiketahui.Rekamanelektrokardiografimenunjukkanperubahan
perubahan, kebanyakan depresi segmen ST, pada 13% orang dewasa pada satu seri.
Keterlibatan demikian dapat menjelaskan nyeri prekordium, bradikardia dan kelelahan
kadangkadangditemukanpadaremajadanorangdewasadenganparotitis.

Mastitis.

Komplikasiinitidaklazimpadamasingmasingjeniskelamin.

Ketulian.

Tulisarafdapatterjadiunilateral,jarangbilateral;walaupuninsidensnyarendah(1:15.000),
parotitis adalah penyebab utama tuli saraf unilateral. Kehilangan pendengaran mungkin
sementaraataupermanen.

Komplikasiokuler.

Komplikasiinimeliputi dakrioadenitis,pembengkakanyangnyeri,biasanyabilateral,dari
kelenjarlakrimalis; neuritisoptik(papilitis) dengangejalagejalabervariasidarikehilangan
penglihatansampaikekaburanringandenganpenyembuhandalam1020hari;uveokeratitis,
biasanya unilateral dengan fotofobia, keluar air mata, kehilangan penglihatan cepat dan
penyembuhandalam20hari; skleritis,tenonitis,denganakibateksoftalmus;dan trombosis
venasentral.

Artritis.

Artralgiayangdisertaidenganpembengkakandankemerahansendimerupakankompliksi
yangjarang;biasanyapenyembuhansempurna.