Anda di halaman 1dari 20

1

Kasus
Topik: Glaukoma Sekunder et causa Katarak Hipermatur
Tanggal (kasus): 18 Desember 2015

Presenter: dr. Dian Rosa Arizona

Tanggal (presentasi): 3 Februari 2016

Pendamping : dr. Endri Susilo Cahyadi

Tempat Presentasi : Ruang Pertemuan Komite Medik


Obyektif Presentasi:
Keilmuan

Keterampilan

Penyegaran

Tinjauan Pustaka

Diagnostik

Manajemen

Masalah

Istimewa

Neonatus

Bayi

Anak

Remaja

Dewasa

Lansia

Bumil

Deskripsi : Perempuan usia 47 tahun dengan keluhan mata kiri merah dan nyeri
Tujuan :
-

Mampu mendiagnosis Glaukoma sekunder ec. Katarak hipermatur


Mampu melakukan penatalaksanaan pada Glaukoma sekunder ec. Katarak hipermatur baik secara medikamentosa maupun non

medikamentosa
Mampu melakukan edukasi kepada pasien Glaukoma sekunder ec. Katarak hipermatur

Bahan bahasan:

Cara membahas:

TinjauanPustaka

Riset

Kasus

Audit

Diskusi

Presentasi dan diskusi

Email

Pos

Data pasien:

Nama: Ny. N

Nomor Registrasi : 07-25-48

Nama wahana : RSUD Abdul Aziz Telp: Terdaftar sejak : 18 Desember 2015
Data utama untuk bahan diskusi:
1. Diagnosis / gambaran klinis : Glaukoma Sekunder et causa katarak hipermatur, mata kiri merah dan nyeri sejak 4 hari SMRS.
Sebelum mata merah pasien sudah mengeluh nyeri pada mata kiri dan nyeri kepala sebelah kiri yang dirasakan 2 minggu SMRS.
Keluhan dirasakan semakin memberat penglihatan menjadi kabur dan silau serta menggangu tidur karena nyeri. Riwayat katarak 5
tahun yang lalu dan dioperasi pada mata kanan. Keadaan umum baik, status generalis dalam batas normal.
2. Riwayat Pengobatan : Pasien mengobati sendiri dengan tetes mata yang dibeli di warung
3. Riwayat Kesehatan/penyakit : Mengeluh sakit yang sama (-), HT (+), DM (-),Asma dan penyakit jantung (-), riwayat operasi
katarak 5 tahun yang lalu (+), Riwayat trauma (-)
4. Riwayat keluarga : Tidak ada anggota keluarga yang menderita keluhan serupa, Riwayat HT (-)
5. Riwayat Pekerjaan : Ibu rumah tangga
6. Lain-lain (diberi contoh : PEMERIKSAAN FISIK, PEMERIKSAAN LABORATORIUM dan TAMBAHAN YANG ADA, sesuai
dengan FASILITAS WAHANA.
Pemeriksaan Fisik
- Keadaan umum : baik
- Tanda Vital
a. Kesadaran : compos mentis
b. TD
: 130/ 90 mmHg
c. Nadi
: 82 x/ menit, reguler isi cukup
d. T
: 37,o,C
e. RR
: 20 x/ menit
- Status Generalis :
a. Kepala

: tidak ditemukan kelainan

b. Mata

: (status oftalmologis)

c. Telinga

: normotia, Sekret (-)

d. Hidung

: deviasi septum (-), sekret (-)

e. Mulut

: bibir kering (-), sianosis (-)

f. Tenggorokan

: tidak ditemukan kelainan

g. Leher

: JVP tidak meningkat, kelenjar getah bening tidak membesar, kaku kuduk (-)

h. Thoraks
Paru

: gerakan pernapasan simetris, sonor,SN vesikuler (+/+), ronkhi (-/-), wheezing (-/-)

Jantung

: iktus kordis tidak terlihat, batas jantung dbn, BJ1/BJ2 reguler, murmur (-), gallop (-)

i. Abdomen

: supel, bising usus (+) 3x/menit

j. Ekstremitas

: akral hangat (+/+), pitting oedem (-/-), capillary refill time < 2 detik

- Status Oftamologis
OD : VOD >1/60, lain-lain dbn
OS : VOS 1/~,injeksi silier (+), COA dalam, Pupil midriasis RCL (-) RCTL (-) Lensa keruh,. Vitreous humor tidak dapat diperiksa
dan pada funduskopi reflek fundus (-).
Pemeriksaan Tekanan intraokuler OD : normal perpalpasi, OS: 37,2 mmHg
7. Pemeriksaan laboratorium :
Hb : 13,6 gr/dl, leukosit 12.000/ul, trombosit 200.000/ul, hematokrit 37,5%, SGOT 21 u/l, PT 9 u/l, ureum 35 mg/dl, creatinin 1,2
GDS 100mg/dl, HBs Ag negatif.
Daftar pustaka
1. IlyasS.Glaukomadalamilmupenyakitmata.Ed3.Cetakanke4.Jakarta:BalaiPenerbitFKUI;2007.Hal:8,167170,212216
2. Vaughan DG, Eva RP, Asbury T. Oftalmologi Umum. Edisi 14. Widya Medika. Jakarta. 2000.hal : 220-38.
3. Ilyas S. Kedaruratan Dalam Ilmu Penyakit Mata. Balai Penerbit FKUI. Jakarta. hal : 97-100.
4. Ilyas S, Tanzil M, Salamun, Azhar Z. Sari Ilmu Penyakit Mata. Balai Penerbit FKUI. Jakarta. 2000. hal : 155-72.
5. JamesB,ChewC,BronA.AnatomidalamOftalmologi.EdisiIX.Erlangga.Jakarta2006;117
6. AmericanAcademyofOphthalmology:Basicandclinicalsciencecourse20032004.

7. GerhardKL,Oscar,Gabriele,Doris,Peter.Ophtalmologyashorttextbook.Secondedition.ThiemeStuttgart:NewYork.2007
8. JaneO,LorraineC.Ophthalmologyataglance.Blsckwellsciene.2005.
9. Jerald A Bell..Ocular Hypertension. In : E Medicine [online].

2008. Available

from:http://www.emedicine.com/ocularhipertention.html
10. Ilyas S. Dasar Teknik Pemeriksaan dalam Ilmu Penyakit Mata. Balai Penerbit FKUI. Jakarta. 2000. hal : 117-37.
Hasil pembelajaran:
1.
2.
3.
4.

Definisi Glaukoma Sekunder


Menganalisa Glaukoma Sekunder et causa Katarak Hipermatur
Diagnosis Glaukoma Sekunder et causa katarak hipermatur
Penatalaksanaan Low Back Pain ec. Sacroiliaca Joint Disfunction

RANGKUMAN PEMBELAJARAN KASUS


1. Subjektif: Pasien datang dengan keluhan mata kiri merah nyeri sejak 4 hari SMRS. keluhan disertai dengan nyeri kepala sebelah kiri. 2
minggu SMRS pasien sudah merasakan nyeri pada mata kiri seperti berdenyut dan keluhan semakin memberat dengan sejak 4 hari terakhir
namun pasien hanya mengobatinya dengan membeli obat tetes mata di warung. Selain itu pasien mengeluhkan penglihatannya menjadi
kabur dan silau jika terkena cahaya. Nyeri pada mata kiri ini membuat paasien menjadi sulit tidur. Riw operasi katarak 5 tahun yang lalu.
2. Objektif: Kesadaran : Compos Mentis; Vital sign : TD : 130/90 mmHg; HR : 82x/m, Suhu : 37 oC, RR :20x/m. Pemeriksaan fisik : status
generalis dalam batas normal. Status oftalmologis didapatkan VOD >1/60, VOS 1/~. OS : injeksi silier (+), COA dalam, Pupil midriasis
RCL (-) RCTL (-) Lensa keruh,. Vitreous humor tidak dapat diperiksa dan pada funduskopi reflek fundus (-) TIO 37,2 mmHg
3. Assesment: Glaukoma Sekunder et Causa Katarak Hipermatur
A. Anatomi dan Fisiologi

Sudutfiltrasimerupakanbagianyangpentingdalampengaturancairanbilikmata.Sudutiniiniberadadalamlimbuskornea.Limbus
adalahbagianyangdibatasiolehgarisyangmenghubungkanakhirdarimembrandescementdanmembranbowman,lalukeposterior0,75
mm,kemudiankedalammengelilingikanalschlemdantrabekulasampaikeCOA. Limbusterdiridaridualapisanepiteldanstroma.
Epitelnyaduakalisetebalepitelkornea.Didalamstromaterdapatseratseratsarafdancabangakhirdaria.Siliarisanterior. 1,2,8Padasudut
filtrasiterdapatgarisschwalbeyangmerupakanakhirperiferendoteldanmembrandescementdankanalschlemmyangmenampungcairan
matakeluarkesalurannya.1
Komposisi Humor Akuos
Humor Akuos adalah suatu cairan jernih yang mengisi kamera anterior dan posterior mata. Volumenya sekitar 250 ml/menit dan
dikeluarkansetiapharinyaberjumlah5mL/hari. Tekanannya sedikit lebih tinggi dari plasma. Komposisi serupa dengan plasma tetapi
cairan ini memiliki komposisi askorbat, piruvat, dan laktat yang lebih tinggi dan protein, urea, dan glukosa yang lebih rendah. 2,3,4

.
Gambar 1. Struktur Segmen Anterior.
Produksi Cairan Humor Akuos
Cairanaquosdiproduksiepitelnonpigmendarikorpussiliaris,tepatnyadariplasmadarahdijaringankapilerproccesussiliaris.Fungsi
Cairanaquosadalahsebagaicairanyangmengisibilikmatadepan,menjagatekananintraokuler,memberinutrisikekorneadanlensadanjuga
memberibentukkebolamataanterior. 1,6Organ yang berperan pada outflow akuos pada sudut COA disebut trabekulum (trabecular meshwork).
Jalinan trabekula terdiri dari berkas-berkas jaringan kolagen dan elastis yang dibungkus oleh sel-sel trabekular yang membentuk suatu saringan
dengan ukuran pori-pori semakin mengecil sewaktu mendekati kanalis schlemm. Kontraksi otot siliaris melalui insersinya ke dalam jalinan
trabekula memperbesar ukuran pori-pori di jalinan tersebut sehingga kecepatan drainase akuos humor juga meningkat. 4,5

MekanismePengaliranCairanAquos
Humorakuousmengalirkedalambilikposterior,kemudianmasukdiantarapermukaanposteriorirismenilaisudutpupil.Selanjutnya
masukkebilikanterior. Humorakuouskeluar memasukisalurankolektormenujupleksusvenaepiskleramelaluikumpulankanalsklera.
Aquousdaribilikanteriormelaluiduajalurkonvensional(jalurtrabekula)danjaluruveosklera(jalurnontrabekula).5,7
1.Jalurtrabekulum(konvensional)
KebanyakanhumorakueuskeluardarimatamelaluijalurjalinantrabekulakanalSchlemmsistemvena.Jalinantrabekuladapatdibagikedalam
tigabagian:4 Uveal,korneoskleral,jukstakanalikular.Fungsijalinantrabekulaadalahsebagaikatupsatujalanyangmembolehkan akueus
meninggalkanmatamelaluialiranterbesarpadaarahlainyangtidakbergantungpadaenergi.
2.Jaluruveosklera(nonkonvensional)
Pada mata normal setiap aliran nontrabekular disebut dengan aliran uveoskleral. Didahului lewatnya akueus dari camera oculi anterior
kedalamototmuskularisdankemudiankedalamruangsuprasiliardansuprakoroid.Cairankemudiankeluardarimatamelaluisklerayangutuh
ataupunsepanjangnervusdanpembuluhdarahyangmemasukinya. Aliranuveoskleraltidakbergantungpadatekanan.Aliranuveoskleral
ditingkatkanolehagensikloplegik,adrenergik,danprostaglandindanbeberapabentukpembedahan(misalsiklodialisis)danditurunkanoleh
miotikum.3,4
Humor akuos berperan sebagai pembawa zat makanan dan oksigen untuk organ di dalam mata yang tidak berpembuluh darah yaitu lensa
dan kornea, dan berguna untuk mengangkut zat buangan hasil metabolisme pada kedua organ tersebut. Cairan tersebut akan mempertahankan
bentuk mata dan menimbulkan tekanan dalam bola mata. Untuk mempertahankan keseimbangan tekanan didalam bola mata cairan aquos
diproduksi secara konstan serta dialirkan keluar melalui sistem drainase mikroskopik. 5 Kecepatan pembentukan cairan aquos dan hambatan
pada mekanisme pengaliran keluarnya menentukan besarnya tekanan intraokuler. Normalnya tekanan di dalam bola mata berkisar antara 10-20
mmHg. Peningkatan tekanan intraokuler dapat terjadi akibat produksi cairan aquos yang meningkat misalnya pada reaksi peradangan dan tumor

intraokuler atau karena aliran keluarnya yang terganggu akibat adanya hambatan pada pratrabekular, trabekular atau post trabekular.5,8

Gambar 2. Sirkulasi dan drainase Humor Akuos


B. Definisi
Glaukomamerupakankumpulanbeberapapenyakitdengantandautamatekananintraookuleryangtinggidengansegalaakibatnyayaitu,
penggaungandanatrofisarafoptiksertadefeklapangpandanganyangkhas.4Mekanismepeningkatantekananintraokulerpadaglaukoma
adalahakibatproduksicairanaquosyangberlebihan,adanyagangguanalirankeluarcairanaquosakibatkelainansistemdrainasesudut
bilikmatadepanataugangguanaksescairanaquoskesistemdrainasedanakibattekananyangtinggipadavenaepisklera.Namunpada
sebagianbesarkasus,peningkatantekananintraokulerdiakibatkanadanyahambatanalirankeluarcairanaquos.1,2,4
C. Faktor Risiko
1. Epidemiologi

Glaukoma lebih banyak di alami oleh etnis Afrika dan Hispanics daripada orang kulit putih
2. Usia, resikoglaukomabertambahtinggidenganbertambahnyausia.
3. Keluarga dengan riwayat glaukoma (herediter)
4. Penyakit sistemik lain seperti hipertensi dan diabetes
5. Miopia berbakat untuk terjadi glaukoma sudut terbuka sementara hipermetropia memiliki kecenderungan menderita glaukoma sudut
tertutup.
6. Obat-obatan, pemakaiansteroidsecararutin,misalnyapemakaiantetesmatayangmengandungsteroidyangtidakterkontroldapat
menginduksiterjadinyaglaukoma.
D. Klasifikasi
Sugarmengklasifikasikanglaukomamenjadi:2,4
1.

GlaukomaPrimer
a. Dewasa
- Glaukomasimpleks(glaukomasudutterbuka,glaukomakronis)
- Glaukomaakut(suduttertutup)
b. Kongenital/Juvenil
2. GlaukomaSekunder
a. Suduttertutup
b. Sudutterbuka
Vaughanmengklasifikasikanglaukomaadalahsebagaiberikut1,2
1.

2.

GlaukomaPrimer
a.
Glaukomasudutterbuka(glaukomasimpleks)
b.
Glaukomasuduttertutup
GlaukomaKongenital

10

3.
4.

a.
Primeratauinfantil
b.
Menyertaikelainankongenitallainnya
GlaukomaSekunder
GlaukomaAbsolut

GlaukomaPrimer
GlaukomaSudutTerbuka(GlaukomaSimpleks)
Glaukomasimpleksadalahglaukomabentukglaukomayangpenyebabnyatidakdiketahui.Merupakansuatuglaukomaprimeryang
ditandaidengansudutbilikmataterbuka. 1Padaglaukomaini,hambatanaliranakuoshumormungkinterdapatpadatrabekulum,kanal
Schlemndanpleksusvenadidaerahintrasklera.Padapemeriksaanpatologianatomididapatkanprosesdegenerasidaritrabekulumdan
kanal Schlemn. Terlihat penebalan dan sklerose dari serat trabekulum, vakuol dalam endotel, dan endotel yang hiperseluler, yang
menutupitrabekulumdankanalSchlemn.Agaknyaprosesketuaanmemegangperanandalamprosesskleroseini,yangdipercepatbila
matatersebutmempunyaibakatglaukoma.Terdapatfaktorresikopadaseseoranguntukmendapatkanglaukomasepertidiabetesmelitus,
hipertensi,pengobatankortikosteroidyanglama,dalamkeluargaadapenderitaglaukoma,danmiopia.4,5
Padaglaukomasimplekstekananbolamatasehariharitinggiataulebihdari20mmHg.Matatidakmerahatautidakterdapatkeluhan,
yangmengakibatkanterdapatgangguansusunananatomisdanfungsitanpadisadariolehpenderita.Gangguansarafoptikakanterlihat
gangguanfungsinyaberupapenciutanlapangpandang.Padawaktupengukuranbiladidapatkantekananbolamatanormalsedangterlihat
gejalagangguanfungsisarafoptiksepertiglaukomamungkinakibatadanyavariasidiurnal.Glaukomaprimeryangkronisdanberjalan
lambatseringtidakdiketahuibilamulainya,karenakeluhanpasienamatsedikitatausamar.Misalnyamatasebelahterasaberat,kepala
peningsebelah,kadangkadangpenglihatankaburdengananamnesayangtidakkhas.Pasientidakmengeluhadanyahalodanmemerlukan
kacamata koreksi untuk presbiopi lebih kuat dibanding usianya. Kadangkadang tajam penglihatan tetap normal sampai keadaan

11

glaukomanyasudahberat.1,7
GlaukomaSudutTertutup
Namainididasarkankeadaansudutyangtampakpadagonioskopi.Glaukomaprimersuduttertutup,bilaterdapatkenaikanmendadak
daritekanan intraokuler, yangdisebabkanpenutupansudutCOA yangmendadak olehakariris,sehinggamenghalangi samasekali
keluarnyaakuoshumoryangmelaluitrabekula,menyebabkantingginyatekananintraokuler,sakityangsangatdimatasecaramendadak
danmenurunnyaketajamanpenglihatansecaratibatiba,disertaitandakongestidimatasepertimatamerah,kelopakmatabengkak.
Karenaglaukomainitimbulnyamendadakdisertaitandatandakongesti,makadisebutpulaglaukomaakutkongestifatauglaukomaakut.
Padasudutbilikmatayangsempit,letaklensamenjadilebihdekatkeiris,sehingaalirancairanbilikmatadaribilikmatabelakangke
bilikmatadepanterhambat.Inilahyangdisebuthambatanpupil.Halinidapatmenyebabkanmeningkatnyatekanandidalambilikmata
belakang dan mendorong iris ke depan. Pada sudut bilik mata depan yang memang sudah sempit, dengan adanya dorongan ini
menyebabkanirismenutupijaringantrabekula,sehinggacairanbilikmatatidakdapatatausukaruntukkeluardanterjadilahglaukoma
suduttertutup4.Glaukomaakut,hanyatimbulpadaorangyangmempunyaisudutbilikmatayangsempit.Jadihanyapadaorangorang
denganpresdiposisianatomis.4
Faktoranatomisyangmenyebabkansudutsempit:4
1. Bulbusokuliyangpendek.Biasanyapadamatayanghipermetrop.Makinberathipermetropnyamakindangkalcoanya
2. Tumbuhnyalensa.Menyebabkancoamenjadilebhdangkal.Padaumur25tahun,dalamnyacoaratarata3,6mm,sedangumur70
tahun3,15mm
3. Korneayangkecil.Dengansendirinyacoanyadangkal
4. Tebalnyairis.Makintebalirismakindangkalcoa
Faktorfisiologisyangdapatmenyebabkancoasempit:4

12

1. Akomodasi.Denganakomodasiparssiliarisdariirismajukedepan
2. Dilatasipupil.Menyebabkanakarirismenjadilebihtebaldansudutcoamenjadilebihsempit.Dilatasipupildapatterjadibila:
3. Lensaletaknyalebihkedepan.Dapatmenyebakanhambatanpupilyangkemudianmenimbulkanirisbombefisiologis,karenatekanan
dibilikmatabelakanglebihtinggidarididepan.Halinidapatmenambahsempitnyasudutcoayangdasarnyasudahsempit
4. Kongestibadansiliar.
Jadi,bilafaktorfisiologisiniterjadipadaseseorangyangmempunyaipredisposisianatomisberupasudutbilikmatayangsempit,
makaadakemungkinantimbulglaukomasuduttertutup.Pendapatlaintentangpenyebabdariglaukomasuduttertutup,yaituterjadinya
labilitasvasomotorissetempat,sehinggamempertinggitekanandidalampembuluhdarahyangkecil.Jikahaliniterjadipadauveabagian
depan,makamenyebabkanpenambahandaricairanyangdikeluarkandibilikmatabelakangsehinggabadankaca,lensadanirismenjadi
lebihterdorongkedepan.4
GlaukomaSekunder
Glaukomasekunderadalahglaukomayangdiketahuipenyebabnya.Dapatdisebabkanataudihubungkandengankeadaankeadaanatau
penyakityangtelahdideritasebelumnyaataupadasaatitu,yangdapatmenyebabkanterjadinyapeningkatantekananintraokuler.2,8
GlaukomaSekunderSudutTerbuka
Glaukomadimanatidakterdapatnyakelainanpadapangkalirissertakorneaperifermelainkanterhambatnyaaliranhumoraquosdi
jalinantrabekuler.Bentukdariglaukomasekundersudutterbukaantaralain;9
a. Glaukomapigmentasi
Sindrominitampaknyadisebabkanolehdegenerasiepitelpigmenirisdankorpussiliaris.Granulapigmenterkelupasdariirisakibat
friksidenganseratseratzonulardibawahnyasehinggaterjaditransiluminasiiris.Pigmenmengendapdipermukaankorneaposterior
(Krukenbergsspindle)dantersangkutdijalinantrabekular,mengganggualirankeluarhumoraquos.Sindrominiterjadipalingsering

13

padapriamiopiausiaantara2540tahunyangmemilikibilikmatadepanyangdalamdengansudutbilikmatayanglebar.
b. Sindrompseudoexfoliasi
Pada sindrom eksfoliasi, dijumpai endapanendapan bahan berserat mirip serpihan di permukaan lensa anterior (berbeda dengan
eksfoliasi kapsul lensasejati akibat pajanan terhadap radiasiinframerah, yaknikatarak glass blower),prosesus siliaris, zonula,
permukaanposterioriris,damdijalinantrabekular(disertaipeningkatan pigmentasi). Penyakitinibiasanyadijumpai padaorang
berusialebihdari65tahun.

c. Glaukomaakibatsteroid
Kortikosteroid topikal dan periokular dapat menimbulkan sejenis glaukoma yang mirip dengan glaukoma primer sudut terbuka,
terutamapadaindividudenganriwayatkeluarga. Halinikemungkinandisebabkankarenameningkatnyadepositmukopolisakarida
yangterdapatpadahumoraquossehinggadrainasenyaterganggu.
d. GlaukomaFakolitik
Sebagiankatarakstadiumlanjutdapatmengalamikebocorankapsullensaanterior,sehinggaproteinproteinlensayangmencairmasuk
kebilik matadepan.Jalinan trabekular menjadi oedemadantersumbat olehproteinproteinlensadanmenimbulkan peningkatan
mendadaktekananintraokular.
GlaukomaSekunderSudutTertutup
Glaukoma sekunder sudut tertutup sama halnya dengan glaukoma primer sudut tertutup, dimana terjadinya peninggian tekanan
intraokulerdisebabkanadanyahambatanataublokadepadatrabekularmeshwork.Penyebabdariglaukomasekundersuduttertutupantara
lain;7,8

14

a. Uveitis
Padauveitis,tekananintraokulerbiasanyalebihrendahdaripadanormalkarenakorpussiliarisyangmeradangkurangberfungsi
dengan baik. Namun, juga dapat terjadi peningkatan tekanan intraokuler melalui beberapa mekanisme yang berlainan. Jalinan
trabekulardapattersumbatolehselselradangdaribilikmatadepan,disertaiedemasekunderataukadangkadangterlibatdalamproses
peradanganspesifikdiarahkankeselseltrabekula(trabekulitis).
Uveitis kronik atau rekuren menyebabkan gangguan permanen fungsi trabekula, sinekia anterior perifer, dan kadangkadang
neovaskularisasisudut,yangsemuanyameningkatkankemungkinanglaukomasekunder.

b. Trauma
Cederakontusiobolamatadapatdisertaipeningkatandinitekananintraokularakibatperdarahankebilikmatadepan(hifema).
Darahbebasmenyumbatjalinantrabekular,yangjugamengalamiedemaakibatcedera.4,9,12
Glaukomaabsolut
Glaukomaabsolutmerupakanstadiumakhirglaukoma(terbuka/tertutup).Glaukomaabsolutadalahsuatuglaukomayangterbengkalai
sampai buta total. Matanya keras seperti batu, karena tekanan intraokuler yang sangat tinggi, buta dan sering sakit sekali. Dengan
timbulnyasetiapseranganyangtakmendapatkanpengobatan,keadaaninimenjadibertambahburuksampaimenjadibuta.Padastadium
initandakongestitidakada,terkecualiinjeksiepiskleradaninjeksiperikornea.Korneajernihataukeruholehselpigmendariirispada
endotel,sedikitinsensitif.Pupilsangatlebar,warnakehijauan,takbergerakpadapenyinaran.Irisatrofi,tipis,kelabu.Bilikmatadepan:
dangkal,mungkinkeruholehselpigmeniris.Tensiintraokulersangattinggi.Funduspenggaungandanatrofidaripailsarafoptic.4,5
Setelahglaukomainidideritabeberapalama,matamenjadidegeneratif. Padaskleratimbulstafilomaskleraanterior,padadaerah

15

skleraantarakorneadanekuatorbolamata,yangberwarnabiru.Korneanyakeruhtertutupvesikel,yangkemudianmenjadibleb. Bila
bleb ini pecah, kemudian menjadi ulkus kornea, oleh infeksi sekunder dapat menjadi perforasi kornea, iridosiklitis, endoftalmitis,
panoftalmia,danberakhirmenjadiptisisbulbi.5
E. Patofisiologi
Pada glaukoma tekanan intraokular berperan penting oleh karena itu dinamika tekanannya diperlukan sekali. Dinamika ini saling
berhubunganantaratekanan,tegangandanregangan.7,9Tingginyatekananintraokulertergantungpadabesarnyaproduksiaquoeushumor
olehbadansiliardanpengalirankeluarnya.Besarnyaalirankeluar aquoeushumor melaluisudutbilikmatadepanjugatergantungpada
keadaansudutbilikmatadepan,keadaanjalinantrabekulum,keadaankanalSchlemmdankeadaantekananvenaepisklera.Mekanisme
utamapenurunanpenglihatanpadaglaukomaadalahatrofiselgangliondifus,yangmenyebabkanpenipisanlapisanseratsarafdaninti
bagian dalam retina dan berkurangnya akson di saraf optikus. Iris dan korpus siliar juga menjadi atrofi, dan prosesus siliaris
memperlihatkandegenerasihialin.2
Diskusoptikusmenjadiatrofidisertaipembesarancekunganoptikusdidugadisebabkanoleh;gangguanpendarahanpadapapilyang
menyebabkandegenerasiberkasserabutsarafpadapapilsarafoptik(gangguanterjadipadacabangcabangsirkulusZinnHaller),diduga
gangguaninidisebabkanolehpeninggiantekananintraokuler.Tekananintraokuleryangtinggisecaramekanikmenekanpapilsarafoptik
yangmerupakantempatdengandayatahanpalinglemahpadabolamata.Bagiantepipapilsarafoptikrelatiflebihkuatdaripadabagian
tengahsehinggaterjadicekunganpadapapilsarafoptik.Serabutatauselsyarafinisangattipisdengandiameterkirakira1/20.000inci.
Bilatekananbolamatanaikserabutsyarafiniakantertekandanrusaksertamati. Kematianseltersebutakanmengakibatkanhilangnya
penglihatanyangpermanen.2,8

16

Gambar3.Aliranaquoshumor

Gambar4.Glaukomasudutterbuka(B)danglakuomasuduttertutup(C)
F. GejalaKlinis4

17

a.

Faseprodormal(fasenonkongestif)
1)

Pengelihatankabur.

2)

Terdapathalo(gambaranpelangi)sekitarlampu.

3)

Sakitkepala,sakitpadamata.

4)

Akomodasilemah.

5)

Berlangsung2jam.

6)

Injeksiperikornea.

7)

Korneaagaksuramkarenaedem.

8)

Bilikmatadepandangkal.

9)

Pupilmelebar

10) Reaksicahayalambat
b.

Fasekongestif
1) Sakitkepalayanghebatsampaimuntahmuntah.
2) Palpebrabengkak.
3) Konjungtivabulbi:hiperemiakongestif,kemosisdenganinjeksisilier,injeksikonjungtiva,injeksiepisklera
4) Korneakeruh,intensitifkarenatekananpadasarafkornea
5) Bilikmatadepandangkal
6) Iris:gambaran,corakbergaristidaknyata,karenaedema,berwarnakelabu
7) Pupil:melebar,lonjong,miringagakvertikal,kadangmidriasistotal,warnakehijauan,refleksicahayamenurunsekaliatautidak
samasekali.

G. PemeriksaanPenunjang10

18

a. Tajampenglihatan
b. Tonometri
MengukurtingginyatekananintraokulerAda3macamtonometri,yaitu:1)Digitaldenganmelakukanpalpasipadakelopakmataatas,
lalumembandingkantahanankeduabolamataterhadaptekananjari.2)TonometerSchitzdenganalatyangditempelkanpadapermukaan
korneasetelahsebelumnyamataditetesianestesitopikal.Jarumtonometerakanmenunjukkanangkatertentupadaskala.Pembacaanskala
disesuaikan dengan kalibrasi dari ZeigerAusschlag Scale yang diterjemahkan ke dalam tekanan intraokuler. 3) Tonometer aplanasi
Goldmann,alatinicukupmahaldantidakpraktis,selainitumemerlukanslitlampyangjugamahal.
c. Gonioskopi
Gonioskopidapatmenilailebarsempitnyasudutbilikmatadepan.Dengangonioskopidapatdibedakanglaukomasuduttertutupdan
glaukomasudutterbuka,jugadapatdilihatadanyaperlekatanirisbagianperiferkedepan(peripheralanteriorsinechiae).
d. LapangPandang(perimetry)
e. Oftalmoskopi
Padapemeriksaanoftalmoskopi,yangharusdiperhatikanadalahkeadaanpapil.
f. Tonografi
Tonografidilakukanuntukmengukurbanyaknyacairanaquosyangdikeluarkanmelaluitrabekuladalamsatusatuanwaktu.
g. TesProvokasi
Untukglaukomasudutterbuka,dilakukantesminumair,pressurecongestiontest,kombinasitesairminumdenganpressurecongestion
test,dantessteroid.Sedangkanuntukglaukomasuduttertutup,dapatdilakukanteskamargelap,tesmembaca,tesmidriasis,dantes

19

bersujud
H. Penatalaksanaan
Sasaranutamapengobatanglaukomaadalahuntukmenurunkantekananintraokulersehinggadapatmencegahterjadinyapenurunan
lapanganpandangdanketajamanpenglihatanlebihlanjutyangberujungpadakebutaandengancaramengontroltekananintraokuler
supayaberadadalambatasannormal.Penatalaksanaanglaukomaterdiridariduamacam,yaitumedikamentosa,operatif. 8,10
Medikamentosa
1. Obat topikal
a. golongan kolinergik : pilokarpin, karbakhol
b. golongan agonis adrenergik : epinefrin, dipivefrin, brimonidin, apraklonidin
c. golongan penyekat reseptor beta / beta-blockers : timolol, carteolol, betaxolol, levobunolol, metoprolol
d. golongan analog prostaglandin : latanoprost, travoprost, bimatoprost, unoprostone
e. golongan inhibitor karbonik anhidrase topikal : dorzolamid, brinzolamid
f.
2. Obat sistemik
a. Golongan inhibitor karbonik anhidrase : acetazolamid, brinzolamid
b. Zat hierosmotik : manitol, gliserin, urea
Operatif
1. Iridektomi atau iridotomi perifer
2. Gonioplasti atau iridoplasti laser
3. Trabekuloplasti laser

20

4. Trabekulektomi
1. Planning
Pada pasien dilakukan penatalaksanaan farmakologis untuk mengurangi tekanan intraokuler. Setelah tekanan intraokuler turun
dipertimbangkan untuk melakukan tindakan operatif.
Obat yang didapat :
IVFD RL 16 tpm
Inf.Manitol 20% 60 tpm
Inj. Ketorolac 3 x 1 amp
Inj. Ranitidin 2 x 1 amp
C. Carpin 2% 6 x 1gtt OS
C. Timolol 0,5% 2 x 1 gtt OS
Glaukon 3 x 1 tab
Edukasi